(data stored in ACNUC17686 zone)

EMBL: CP002131

ID   CP002131; SV 1; circular; genomic DNA; STD; PRO; 2280035 BP.
XX
AC   CP002131;
XX
PR   Project:PRJNA30983;
XX
DT   06-AUG-2010 (Rel. 105, Created)
DT   23-NOV-2011 (Rel. 110, Last updated, Version 4)
XX
DE   Thermosediminibacter oceani DSM 16646, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Thermosediminibacter oceani DSM 16646
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacterales Family III. Incertae Sedis; Thermosediminibacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2280035
RX   PUBMED; 21304740.
RA   Pitluck S., Yasawong M., Munk C., Nolan M., Lapidus A., Lucas S.,
RA   Glavina Del Rio T., Tice H., Cheng J.F., Bruce D., Detter C., Tapia R.,
RA   Han C., Goodwin L., Liolios K., Ivanova N., Mavromatis K., Mikhailova N.,
RA   Pati A., Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Rohde M., Spring S., Sikorski J., Goker M., Woyke T.,
RA   Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C.,
RA   Klenk H.P.;
RT   "Complete genome sequence of Thermosediminibacter oceani type strain
RT   (JW/IW-1228P)";
RL   Stand Genomic Sci 3(2):108-116(2010).
XX
RN   [2]
RP   1-2280035
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Spring S.,
RA   Schroeder M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Thermosediminibacter oceani DSM 16646";
RL   Unpublished.
XX
RN   [3]
RP   1-2280035
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Munk A.C., Detter J.C., Han C., Tapia R.F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Schroeder M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d0a847ab2fbe9b0cf20d38e10b4daa53.
DR   BioSample; SAMN00713558.
DR   CABRI; DSM 16646.
DR   EnsemblGenomes-Gn; EBG00001124697.
DR   EnsemblGenomes-Gn; EBG00001124698.
DR   EnsemblGenomes-Gn; EBG00001124699.
DR   EnsemblGenomes-Gn; EBG00001124700.
DR   EnsemblGenomes-Gn; EBG00001124701.
DR   EnsemblGenomes-Gn; EBG00001124702.
DR   EnsemblGenomes-Gn; EBG00001124703.
DR   EnsemblGenomes-Gn; EBG00001124704.
DR   EnsemblGenomes-Gn; EBG00001124705.
DR   EnsemblGenomes-Gn; EBG00001124706.
DR   EnsemblGenomes-Gn; EBG00001124707.
DR   EnsemblGenomes-Gn; EBG00001124708.
DR   EnsemblGenomes-Gn; EBG00001124709.
DR   EnsemblGenomes-Gn; EBG00001124710.
DR   EnsemblGenomes-Gn; EBG00001124711.
DR   EnsemblGenomes-Gn; EBG00001124712.
DR   EnsemblGenomes-Gn; EBG00001124713.
DR   EnsemblGenomes-Gn; EBG00001124714.
DR   EnsemblGenomes-Gn; EBG00001124715.
DR   EnsemblGenomes-Gn; EBG00001124716.
DR   EnsemblGenomes-Gn; EBG00001124717.
DR   EnsemblGenomes-Gn; EBG00001124718.
DR   EnsemblGenomes-Gn; EBG00001124719.
DR   EnsemblGenomes-Gn; EBG00001124720.
DR   EnsemblGenomes-Gn; EBG00001124721.
DR   EnsemblGenomes-Gn; EBG00001124722.
DR   EnsemblGenomes-Gn; EBG00001124723.
DR   EnsemblGenomes-Gn; EBG00001124724.
DR   EnsemblGenomes-Gn; EBG00001124725.
DR   EnsemblGenomes-Gn; EBG00001124726.
DR   EnsemblGenomes-Gn; EBG00001124727.
DR   EnsemblGenomes-Gn; EBG00001124728.
DR   EnsemblGenomes-Gn; EBG00001124729.
DR   EnsemblGenomes-Gn; EBG00001124730.
DR   EnsemblGenomes-Gn; EBG00001124731.
DR   EnsemblGenomes-Gn; EBG00001124732.
DR   EnsemblGenomes-Gn; EBG00001124733.
DR   EnsemblGenomes-Gn; EBG00001124734.
DR   EnsemblGenomes-Gn; EBG00001124735.
DR   EnsemblGenomes-Gn; EBG00001124736.
DR   EnsemblGenomes-Gn; EBG00001124737.
DR   EnsemblGenomes-Gn; EBG00001124738.
DR   EnsemblGenomes-Gn; EBG00001124739.
DR   EnsemblGenomes-Gn; EBG00001124740.
DR   EnsemblGenomes-Gn; EBG00001124741.
DR   EnsemblGenomes-Gn; EBG00001124742.
DR   EnsemblGenomes-Gn; EBG00001124743.
DR   EnsemblGenomes-Gn; EBG00001124744.
DR   EnsemblGenomes-Gn; EBG00001124745.
DR   EnsemblGenomes-Gn; EBG00001124746.
DR   EnsemblGenomes-Gn; EBG00001124747.
DR   EnsemblGenomes-Gn; EBG00001124748.
DR   EnsemblGenomes-Gn; EBG00001124749.
DR   EnsemblGenomes-Gn; EBG00001124750.
DR   EnsemblGenomes-Gn; EBG00001124751.
DR   EnsemblGenomes-Gn; EBG00001124752.
DR   EnsemblGenomes-Gn; EBG00001124753.
DR   EnsemblGenomes-Gn; EBG00001124754.
DR   EnsemblGenomes-Gn; EBG00001124755.
DR   EnsemblGenomes-Gn; EBG00001124756.
DR   EnsemblGenomes-Gn; EBG00001124757.
DR   EnsemblGenomes-Gn; EBG00001124758.
DR   EnsemblGenomes-Gn; EBG00001124759.
DR   EnsemblGenomes-Gn; EBG00001124760.
DR   EnsemblGenomes-Gn; EBG00001124761.
DR   EnsemblGenomes-Gn; EBG00001124762.
DR   EnsemblGenomes-Gn; EBG00001124763.
DR   EnsemblGenomes-Gn; EBG00001124764.
DR   EnsemblGenomes-Gn; EBG00001124765.
DR   EnsemblGenomes-Gn; EBG00001124766.
DR   EnsemblGenomes-Gn; EBG00001124767.
DR   EnsemblGenomes-Gn; EBG00001124768.
DR   EnsemblGenomes-Gn; EBG00001124769.
DR   EnsemblGenomes-Gn; EBG00001124770.
DR   EnsemblGenomes-Gn; EBG00001124771.
DR   EnsemblGenomes-Gn; EBG00001124772.
DR   EnsemblGenomes-Gn; EBG00001124773.
DR   EnsemblGenomes-Gn; EBG00001124774.
DR   EnsemblGenomes-Gn; EBG00001124775.
DR   EnsemblGenomes-Gn; EBG00001124776.
DR   EnsemblGenomes-Gn; EBG00001124777.
DR   EnsemblGenomes-Gn; EBG00001124778.
DR   EnsemblGenomes-Gn; EBG00001124779.
DR   EnsemblGenomes-Gn; EBG00001124780.
DR   EnsemblGenomes-Gn; EBG00001124781.
DR   EnsemblGenomes-Gn; EBG00001124782.
DR   EnsemblGenomes-Gn; EBG00001124783.
DR   EnsemblGenomes-Gn; EBG00001124784.
DR   EnsemblGenomes-Gn; EBG00001124785.
DR   EnsemblGenomes-Gn; EBG00001124786.
DR   EnsemblGenomes-Gn; EBG00001124787.
DR   EnsemblGenomes-Gn; EBG00001124788.
DR   EnsemblGenomes-Gn; EBG00001124789.
DR   EnsemblGenomes-Gn; EBG00001124790.
DR   EnsemblGenomes-Gn; EBG00001124791.
DR   EnsemblGenomes-Gn; EBG00001124792.
DR   EnsemblGenomes-Gn; EBG00001124793.
DR   EnsemblGenomes-Gn; EBG00001124794.
DR   EnsemblGenomes-Gn; EBG00001124795.
DR   EnsemblGenomes-Gn; EBG00001124796.
DR   EnsemblGenomes-Gn; EBG00001124797.
DR   EnsemblGenomes-Gn; EBG00001124798.
DR   EnsemblGenomes-Gn; EBG00001124799.
DR   EnsemblGenomes-Gn; EBG00001124800.
DR   EnsemblGenomes-Gn; EBG00001124801.
DR   EnsemblGenomes-Gn; EBG00001124802.
DR   EnsemblGenomes-Gn; EBG00001124803.
DR   EnsemblGenomes-Gn; EBG00001124804.
DR   EnsemblGenomes-Gn; EBG00001124805.
DR   EnsemblGenomes-Gn; EBG00001124806.
DR   EnsemblGenomes-Gn; EBG00001124807.
DR   EnsemblGenomes-Gn; EBG00001124808.
DR   EnsemblGenomes-Gn; EBG00001124809.
DR   EnsemblGenomes-Gn; EBG00001124810.
DR   EnsemblGenomes-Gn; EBG00001124811.
DR   EnsemblGenomes-Gn; EBG00001124812.
DR   EnsemblGenomes-Gn; EBG00001124813.
DR   EnsemblGenomes-Gn; EBG00001124814.
DR   EnsemblGenomes-Gn; EBG00001124815.
DR   EnsemblGenomes-Gn; EBG00001124816.
DR   EnsemblGenomes-Gn; EBG00001124817.
DR   EnsemblGenomes-Gn; EBG00001124818.
DR   EnsemblGenomes-Gn; EBG00001124819.
DR   EnsemblGenomes-Gn; EBG00001124820.
DR   EnsemblGenomes-Gn; EBG00001124821.
DR   EnsemblGenomes-Gn; EBG00001124822.
DR   EnsemblGenomes-Gn; EBG00001124823.
DR   EnsemblGenomes-Gn; EBG00001124824.
DR   EnsemblGenomes-Gn; EBG00001124825.
DR   EnsemblGenomes-Gn; EBG00001124826.
DR   EnsemblGenomes-Gn; EBG00001124827.
DR   EnsemblGenomes-Gn; EBG00001124828.
DR   EnsemblGenomes-Gn; EBG00001124829.
DR   EnsemblGenomes-Gn; EBG00001124830.
DR   EnsemblGenomes-Gn; EBG00001124831.
DR   EnsemblGenomes-Gn; EBG00001124832.
DR   EnsemblGenomes-Gn; EBG00001124833.
DR   EnsemblGenomes-Gn; EBG00001124834.
DR   EnsemblGenomes-Gn; EBG00001124835.
DR   EnsemblGenomes-Gn; EBG00001124836.
DR   EnsemblGenomes-Gn; EBG00001124837.
DR   EnsemblGenomes-Gn; EBG00001124838.
DR   EnsemblGenomes-Gn; EBG00001124839.
DR   EnsemblGenomes-Gn; EBG00001124840.
DR   EnsemblGenomes-Gn; EBG00001124841.
DR   EnsemblGenomes-Gn; EBG00001124842.
DR   EnsemblGenomes-Gn; EBG00001124843.
DR   EnsemblGenomes-Gn; EBG00001124844.
DR   EnsemblGenomes-Gn; EBG00001124845.
DR   EnsemblGenomes-Gn; EBG00001124846.
DR   EnsemblGenomes-Gn; EBG00001124847.
DR   EnsemblGenomes-Gn; EBG00001124848.
DR   EnsemblGenomes-Gn; EBG00001124849.
DR   EnsemblGenomes-Gn; EBG00001124850.
DR   EnsemblGenomes-Gn; EBG00001124851.
DR   EnsemblGenomes-Gn; EBG00001124852.
DR   EnsemblGenomes-Gn; EBG00001124853.
DR   EnsemblGenomes-Gn; EBG00001124854.
DR   EnsemblGenomes-Gn; EBG00001124855.
DR   EnsemblGenomes-Gn; EBG00001124856.
DR   EnsemblGenomes-Gn; EBG00001124857.
DR   EnsemblGenomes-Gn; EBG00001124858.
DR   EnsemblGenomes-Gn; EBG00001124859.
DR   EnsemblGenomes-Gn; Toce_R0001.
DR   EnsemblGenomes-Gn; Toce_R0002.
DR   EnsemblGenomes-Gn; Toce_R0003.
DR   EnsemblGenomes-Gn; Toce_R0004.
DR   EnsemblGenomes-Gn; Toce_R0005.
DR   EnsemblGenomes-Gn; Toce_R0006.
DR   EnsemblGenomes-Gn; Toce_R0007.
DR   EnsemblGenomes-Gn; Toce_R0008.
DR   EnsemblGenomes-Gn; Toce_R0010.
DR   EnsemblGenomes-Gn; Toce_R0011.
DR   EnsemblGenomes-Gn; Toce_R0012.
DR   EnsemblGenomes-Gn; Toce_R0013.
DR   EnsemblGenomes-Gn; Toce_R0014.
DR   EnsemblGenomes-Gn; Toce_R0015.
DR   EnsemblGenomes-Gn; Toce_R0016.
DR   EnsemblGenomes-Gn; Toce_R0017.
DR   EnsemblGenomes-Gn; Toce_R0018.
DR   EnsemblGenomes-Gn; Toce_R0019.
DR   EnsemblGenomes-Gn; Toce_R0020.
DR   EnsemblGenomes-Gn; Toce_R0021.
DR   EnsemblGenomes-Gn; Toce_R0022.
DR   EnsemblGenomes-Gn; Toce_R0023.
DR   EnsemblGenomes-Gn; Toce_R0024.
DR   EnsemblGenomes-Gn; Toce_R0025.
DR   EnsemblGenomes-Gn; Toce_R0026.
DR   EnsemblGenomes-Gn; Toce_R0027.
DR   EnsemblGenomes-Gn; Toce_R0028.
DR   EnsemblGenomes-Gn; Toce_R0029.
DR   EnsemblGenomes-Gn; Toce_R0030.
DR   EnsemblGenomes-Gn; Toce_R0031.
DR   EnsemblGenomes-Gn; Toce_R0032.
DR   EnsemblGenomes-Gn; Toce_R0033.
DR   EnsemblGenomes-Gn; Toce_R0034.
DR   EnsemblGenomes-Gn; Toce_R0035.
DR   EnsemblGenomes-Gn; Toce_R0036.
DR   EnsemblGenomes-Gn; Toce_R0037.
DR   EnsemblGenomes-Gn; Toce_R0038.
DR   EnsemblGenomes-Gn; Toce_R0039.
DR   EnsemblGenomes-Gn; Toce_R0040.
DR   EnsemblGenomes-Gn; Toce_R0041.
DR   EnsemblGenomes-Gn; Toce_R0042.
DR   EnsemblGenomes-Gn; Toce_R0043.
DR   EnsemblGenomes-Gn; Toce_R0044.
DR   EnsemblGenomes-Gn; Toce_R0045.
DR   EnsemblGenomes-Gn; Toce_R0046.
DR   EnsemblGenomes-Gn; Toce_R0047.
DR   EnsemblGenomes-Gn; Toce_R0048.
DR   EnsemblGenomes-Gn; Toce_R0049.
DR   EnsemblGenomes-Gn; Toce_R0050.
DR   EnsemblGenomes-Gn; Toce_R0051.
DR   EnsemblGenomes-Gn; Toce_R0052.
DR   EnsemblGenomes-Gn; Toce_R0053.
DR   EnsemblGenomes-Gn; Toce_R0054.
DR   EnsemblGenomes-Gn; Toce_R0055.
DR   EnsemblGenomes-Gn; Toce_R0056.
DR   EnsemblGenomes-Gn; Toce_R0057.
DR   EnsemblGenomes-Gn; Toce_R0058.
DR   EnsemblGenomes-Gn; Toce_R0059.
DR   EnsemblGenomes-Gn; Toce_R0060.
DR   EnsemblGenomes-Gn; Toce_R0061.
DR   EnsemblGenomes-Gn; Toce_R0062.
DR   EnsemblGenomes-Gn; Toce_R0063.
DR   EnsemblGenomes-Gn; Toce_R0064.
DR   EnsemblGenomes-Tr; EBT00001715857.
DR   EnsemblGenomes-Tr; EBT00001715858.
DR   EnsemblGenomes-Tr; EBT00001715859.
DR   EnsemblGenomes-Tr; EBT00001715860.
DR   EnsemblGenomes-Tr; EBT00001715861.
DR   EnsemblGenomes-Tr; EBT00001715862.
DR   EnsemblGenomes-Tr; EBT00001715863.
DR   EnsemblGenomes-Tr; EBT00001715864.
DR   EnsemblGenomes-Tr; EBT00001715865.
DR   EnsemblGenomes-Tr; EBT00001715866.
DR   EnsemblGenomes-Tr; EBT00001715867.
DR   EnsemblGenomes-Tr; EBT00001715868.
DR   EnsemblGenomes-Tr; EBT00001715869.
DR   EnsemblGenomes-Tr; EBT00001715870.
DR   EnsemblGenomes-Tr; EBT00001715871.
DR   EnsemblGenomes-Tr; EBT00001715872.
DR   EnsemblGenomes-Tr; EBT00001715873.
DR   EnsemblGenomes-Tr; EBT00001715874.
DR   EnsemblGenomes-Tr; EBT00001715875.
DR   EnsemblGenomes-Tr; EBT00001715876.
DR   EnsemblGenomes-Tr; EBT00001715877.
DR   EnsemblGenomes-Tr; EBT00001715878.
DR   EnsemblGenomes-Tr; EBT00001715879.
DR   EnsemblGenomes-Tr; EBT00001715880.
DR   EnsemblGenomes-Tr; EBT00001715881.
DR   EnsemblGenomes-Tr; EBT00001715882.
DR   EnsemblGenomes-Tr; EBT00001715883.
DR   EnsemblGenomes-Tr; EBT00001715884.
DR   EnsemblGenomes-Tr; EBT00001715885.
DR   EnsemblGenomes-Tr; EBT00001715886.
DR   EnsemblGenomes-Tr; EBT00001715887.
DR   EnsemblGenomes-Tr; EBT00001715888.
DR   EnsemblGenomes-Tr; EBT00001715889.
DR   EnsemblGenomes-Tr; EBT00001715890.
DR   EnsemblGenomes-Tr; EBT00001715891.
DR   EnsemblGenomes-Tr; EBT00001715892.
DR   EnsemblGenomes-Tr; EBT00001715893.
DR   EnsemblGenomes-Tr; EBT00001715894.
DR   EnsemblGenomes-Tr; EBT00001715895.
DR   EnsemblGenomes-Tr; EBT00001715896.
DR   EnsemblGenomes-Tr; EBT00001715897.
DR   EnsemblGenomes-Tr; EBT00001715898.
DR   EnsemblGenomes-Tr; EBT00001715899.
DR   EnsemblGenomes-Tr; EBT00001715900.
DR   EnsemblGenomes-Tr; EBT00001715901.
DR   EnsemblGenomes-Tr; EBT00001715902.
DR   EnsemblGenomes-Tr; EBT00001715903.
DR   EnsemblGenomes-Tr; EBT00001715904.
DR   EnsemblGenomes-Tr; EBT00001715905.
DR   EnsemblGenomes-Tr; EBT00001715906.
DR   EnsemblGenomes-Tr; EBT00001715907.
DR   EnsemblGenomes-Tr; EBT00001715908.
DR   EnsemblGenomes-Tr; EBT00001715909.
DR   EnsemblGenomes-Tr; EBT00001715910.
DR   EnsemblGenomes-Tr; EBT00001715911.
DR   EnsemblGenomes-Tr; EBT00001715912.
DR   EnsemblGenomes-Tr; EBT00001715913.
DR   EnsemblGenomes-Tr; EBT00001715914.
DR   EnsemblGenomes-Tr; EBT00001715915.
DR   EnsemblGenomes-Tr; EBT00001715916.
DR   EnsemblGenomes-Tr; EBT00001715917.
DR   EnsemblGenomes-Tr; EBT00001715918.
DR   EnsemblGenomes-Tr; EBT00001715919.
DR   EnsemblGenomes-Tr; EBT00001715920.
DR   EnsemblGenomes-Tr; EBT00001715921.
DR   EnsemblGenomes-Tr; EBT00001715922.
DR   EnsemblGenomes-Tr; EBT00001715923.
DR   EnsemblGenomes-Tr; EBT00001715924.
DR   EnsemblGenomes-Tr; EBT00001715925.
DR   EnsemblGenomes-Tr; EBT00001715926.
DR   EnsemblGenomes-Tr; EBT00001715927.
DR   EnsemblGenomes-Tr; EBT00001715928.
DR   EnsemblGenomes-Tr; EBT00001715929.
DR   EnsemblGenomes-Tr; EBT00001715930.
DR   EnsemblGenomes-Tr; EBT00001715931.
DR   EnsemblGenomes-Tr; EBT00001715932.
DR   EnsemblGenomes-Tr; EBT00001715933.
DR   EnsemblGenomes-Tr; EBT00001715934.
DR   EnsemblGenomes-Tr; EBT00001715935.
DR   EnsemblGenomes-Tr; EBT00001715936.
DR   EnsemblGenomes-Tr; EBT00001715937.
DR   EnsemblGenomes-Tr; EBT00001715938.
DR   EnsemblGenomes-Tr; EBT00001715939.
DR   EnsemblGenomes-Tr; EBT00001715940.
DR   EnsemblGenomes-Tr; EBT00001715941.
DR   EnsemblGenomes-Tr; EBT00001715942.
DR   EnsemblGenomes-Tr; EBT00001715943.
DR   EnsemblGenomes-Tr; EBT00001715944.
DR   EnsemblGenomes-Tr; EBT00001715945.
DR   EnsemblGenomes-Tr; EBT00001715946.
DR   EnsemblGenomes-Tr; EBT00001715947.
DR   EnsemblGenomes-Tr; EBT00001715948.
DR   EnsemblGenomes-Tr; EBT00001715949.
DR   EnsemblGenomes-Tr; EBT00001715950.
DR   EnsemblGenomes-Tr; EBT00001715951.
DR   EnsemblGenomes-Tr; EBT00001715952.
DR   EnsemblGenomes-Tr; EBT00001715953.
DR   EnsemblGenomes-Tr; EBT00001715954.
DR   EnsemblGenomes-Tr; EBT00001715955.
DR   EnsemblGenomes-Tr; EBT00001715956.
DR   EnsemblGenomes-Tr; EBT00001715957.
DR   EnsemblGenomes-Tr; EBT00001715958.
DR   EnsemblGenomes-Tr; EBT00001715959.
DR   EnsemblGenomes-Tr; EBT00001715960.
DR   EnsemblGenomes-Tr; EBT00001715961.
DR   EnsemblGenomes-Tr; EBT00001715962.
DR   EnsemblGenomes-Tr; EBT00001715963.
DR   EnsemblGenomes-Tr; EBT00001715964.
DR   EnsemblGenomes-Tr; EBT00001715965.
DR   EnsemblGenomes-Tr; EBT00001715966.
DR   EnsemblGenomes-Tr; EBT00001715967.
DR   EnsemblGenomes-Tr; EBT00001715968.
DR   EnsemblGenomes-Tr; EBT00001715969.
DR   EnsemblGenomes-Tr; EBT00001715970.
DR   EnsemblGenomes-Tr; EBT00001715971.
DR   EnsemblGenomes-Tr; EBT00001715972.
DR   EnsemblGenomes-Tr; EBT00001715973.
DR   EnsemblGenomes-Tr; EBT00001715974.
DR   EnsemblGenomes-Tr; EBT00001715975.
DR   EnsemblGenomes-Tr; EBT00001715976.
DR   EnsemblGenomes-Tr; EBT00001715977.
DR   EnsemblGenomes-Tr; EBT00001715978.
DR   EnsemblGenomes-Tr; EBT00001715979.
DR   EnsemblGenomes-Tr; EBT00001715980.
DR   EnsemblGenomes-Tr; EBT00001715981.
DR   EnsemblGenomes-Tr; EBT00001715982.
DR   EnsemblGenomes-Tr; EBT00001715983.
DR   EnsemblGenomes-Tr; EBT00001715984.
DR   EnsemblGenomes-Tr; EBT00001715985.
DR   EnsemblGenomes-Tr; EBT00001715986.
DR   EnsemblGenomes-Tr; EBT00001715987.
DR   EnsemblGenomes-Tr; EBT00001715988.
DR   EnsemblGenomes-Tr; EBT00001715989.
DR   EnsemblGenomes-Tr; EBT00001715990.
DR   EnsemblGenomes-Tr; EBT00001715991.
DR   EnsemblGenomes-Tr; EBT00001715992.
DR   EnsemblGenomes-Tr; EBT00001715993.
DR   EnsemblGenomes-Tr; EBT00001715994.
DR   EnsemblGenomes-Tr; EBT00001715995.
DR   EnsemblGenomes-Tr; EBT00001715996.
DR   EnsemblGenomes-Tr; EBT00001715997.
DR   EnsemblGenomes-Tr; EBT00001715998.
DR   EnsemblGenomes-Tr; EBT00001715999.
DR   EnsemblGenomes-Tr; EBT00001716000.
DR   EnsemblGenomes-Tr; EBT00001716001.
DR   EnsemblGenomes-Tr; EBT00001716002.
DR   EnsemblGenomes-Tr; EBT00001716003.
DR   EnsemblGenomes-Tr; EBT00001716004.
DR   EnsemblGenomes-Tr; EBT00001716005.
DR   EnsemblGenomes-Tr; EBT00001716006.
DR   EnsemblGenomes-Tr; EBT00001716007.
DR   EnsemblGenomes-Tr; EBT00001716008.
DR   EnsemblGenomes-Tr; EBT00001716009.
DR   EnsemblGenomes-Tr; EBT00001716010.
DR   EnsemblGenomes-Tr; EBT00001716011.
DR   EnsemblGenomes-Tr; EBT00001716012.
DR   EnsemblGenomes-Tr; EBT00001716013.
DR   EnsemblGenomes-Tr; EBT00001716014.
DR   EnsemblGenomes-Tr; EBT00001716015.
DR   EnsemblGenomes-Tr; EBT00001716016.
DR   EnsemblGenomes-Tr; EBT00001716017.
DR   EnsemblGenomes-Tr; EBT00001716018.
DR   EnsemblGenomes-Tr; EBT00001716019.
DR   EnsemblGenomes-Tr; Toce_R0001-1.
DR   EnsemblGenomes-Tr; Toce_R0002-1.
DR   EnsemblGenomes-Tr; Toce_R0003-1.
DR   EnsemblGenomes-Tr; Toce_R0004-1.
DR   EnsemblGenomes-Tr; Toce_R0005-1.
DR   EnsemblGenomes-Tr; Toce_R0006-1.
DR   EnsemblGenomes-Tr; Toce_R0007-1.
DR   EnsemblGenomes-Tr; Toce_R0008-1.
DR   EnsemblGenomes-Tr; Toce_R0010-1.
DR   EnsemblGenomes-Tr; Toce_R0011-1.
DR   EnsemblGenomes-Tr; Toce_R0012-1.
DR   EnsemblGenomes-Tr; Toce_R0013-1.
DR   EnsemblGenomes-Tr; Toce_R0014-1.
DR   EnsemblGenomes-Tr; Toce_R0015-1.
DR   EnsemblGenomes-Tr; Toce_R0016-1.
DR   EnsemblGenomes-Tr; Toce_R0017-1.
DR   EnsemblGenomes-Tr; Toce_R0018-1.
DR   EnsemblGenomes-Tr; Toce_R0019-1.
DR   EnsemblGenomes-Tr; Toce_R0020-1.
DR   EnsemblGenomes-Tr; Toce_R0021-1.
DR   EnsemblGenomes-Tr; Toce_R0022-1.
DR   EnsemblGenomes-Tr; Toce_R0023-1.
DR   EnsemblGenomes-Tr; Toce_R0024-1.
DR   EnsemblGenomes-Tr; Toce_R0025-1.
DR   EnsemblGenomes-Tr; Toce_R0026-1.
DR   EnsemblGenomes-Tr; Toce_R0027-1.
DR   EnsemblGenomes-Tr; Toce_R0028-1.
DR   EnsemblGenomes-Tr; Toce_R0029-1.
DR   EnsemblGenomes-Tr; Toce_R0030-1.
DR   EnsemblGenomes-Tr; Toce_R0031-1.
DR   EnsemblGenomes-Tr; Toce_R0032-1.
DR   EnsemblGenomes-Tr; Toce_R0033-1.
DR   EnsemblGenomes-Tr; Toce_R0034-1.
DR   EnsemblGenomes-Tr; Toce_R0035-1.
DR   EnsemblGenomes-Tr; Toce_R0036-1.
DR   EnsemblGenomes-Tr; Toce_R0037-1.
DR   EnsemblGenomes-Tr; Toce_R0038-1.
DR   EnsemblGenomes-Tr; Toce_R0039-1.
DR   EnsemblGenomes-Tr; Toce_R0040-1.
DR   EnsemblGenomes-Tr; Toce_R0041-1.
DR   EnsemblGenomes-Tr; Toce_R0042-1.
DR   EnsemblGenomes-Tr; Toce_R0043-1.
DR   EnsemblGenomes-Tr; Toce_R0044-1.
DR   EnsemblGenomes-Tr; Toce_R0045-1.
DR   EnsemblGenomes-Tr; Toce_R0046-1.
DR   EnsemblGenomes-Tr; Toce_R0047-1.
DR   EnsemblGenomes-Tr; Toce_R0048-1.
DR   EnsemblGenomes-Tr; Toce_R0049-1.
DR   EnsemblGenomes-Tr; Toce_R0050-1.
DR   EnsemblGenomes-Tr; Toce_R0051-1.
DR   EnsemblGenomes-Tr; Toce_R0052-1.
DR   EnsemblGenomes-Tr; Toce_R0053-1.
DR   EnsemblGenomes-Tr; Toce_R0054-1.
DR   EnsemblGenomes-Tr; Toce_R0055-1.
DR   EnsemblGenomes-Tr; Toce_R0056-1.
DR   EnsemblGenomes-Tr; Toce_R0057-1.
DR   EnsemblGenomes-Tr; Toce_R0058-1.
DR   EnsemblGenomes-Tr; Toce_R0059-1.
DR   EnsemblGenomes-Tr; Toce_R0060-1.
DR   EnsemblGenomes-Tr; Toce_R0061-1.
DR   EnsemblGenomes-Tr; Toce_R0062-1.
DR   EnsemblGenomes-Tr; Toce_R0063-1.
DR   EnsemblGenomes-Tr; Toce_R0064-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP002131.
DR   SILVA-SSU; CP002131.
DR   StrainInfo; 677776; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083012
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Thermosediminibacter oceani JW/IW-1228P, DSM
CC                          16646
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: 252 meters
CC   alt_elev            :: Missing
CC   country             :: Peru
CC   environment         :: Deep sea, Sediment, Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 16646, ATCC BAA-1034
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02252
CC   Type Strain         :: Yes
CC   Isolation Site      :: Deep sea sediments (252 m below sea level)
CC                          of Peru Margin collected during Leg 201 of
CC                          the Ocean Drilling Program
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Temperature Range   :: Thermophile
CC   Temperature Optimum :: 52 - 76C
CC   pH                  :: 6.3 - 9.3
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   Phenotypes          :: Barophile
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: Sanger/454
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2280035
FT                   /organism="Thermosediminibacter oceani DSM 16646"
FT                   /strain="DSM 16646"
FT                   /mol_type="genomic DNA"
FT                   /country="Peru"
FT                   /isolation_source="deep sea sediment"
FT                   /db_xref="taxon:555079"
FT   gene            102..1451
FT                   /locus_tag="Toce_0001"
FT   CDS_pept        102..1451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR001957:IPR013317:IPR013159:IPR020591:IPR
FT                   003593:IPR018312; KEGG: bmq:BMQ_0001 chromosomal
FT                   replication initiator protein DnaA; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06798"
FT                   /db_xref="GOA:D9RYX0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX0"
FT                   /protein_id="ADL06798.1"
FT                   /translation="MTHNLPDLWQQVLKTLGSELNNDVSFNTFLKPTKLVSIEDDIAIV
FT                   EVPNEFLKGILEKRYANLLKDILGSILNRSVSIFFKIDPLASEEQASTVDTAEKDIKPV
FT                   AEEGQSTLNSKYTFDTFVVGNSNRFAHAASLAVAQAPAKAYNPFFIYGGVGLGKTHLMH
FT                   AIGHYILQHNPSCKVVYVSSEKFTNELINSIRDDKNVEFRNKYRNIDVLLIDDIQFIAG
FT                   KERTQEEFFHTFNALYEANKQIIISSDRPPKEIPTLEERLRSRFEWGLITDIQPPDFET
FT                   RIAILRKKAMMENLTVPDDVINFIATKIETNIRELEGALIRIVAFSSLTNKPIDLDLAE
FT                   HVLKDLLPNNKPKTVTVMDILQVVGGHFSIKIDDFKSKKRTKELAYARQIAMYLCRELT
FT                   DYSLPKIGEEFGGRDHTTVLHACEKISRDIQRDAQLSSLIENLKKKILHG"
FT   gene            1702..2814
FT                   /locus_tag="Toce_0002"
FT   CDS_pept        1702..2814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tte:TTE0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06799"
FT                   /db_xref="GOA:D9RYX1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX1"
FT                   /protein_id="ADL06799.1"
FT                   /translation="MQFLIEKDQLLSGVSVAERFIASKTTMPILSGIKFSAYGSTLELS
FT                   STDLEMGIECRLPAQIMEEGDAVISTKVFSDIARKLPQGQVLFRRQEGQITVEAGDFRL
FT                   NMPVLEAGDFPEVVPPETNPILKFPKETFKNMVKQTIFARAEDSIARPVLTGELLEARN
FT                   GRFHVVALDGFRIAWRWEEAEVPDFSVVVPGRALLELTRALSDTGEDTFEIHTGRNRVV
FT                   FCTENLVMATRVLEGKFIDYEQVVKVDPKITVVAKTDALLSSIERAFIVAREGSKNNLV
FT                   KFRIGNGRMEVSSETEMGSVYEKVECETSGDDLVVAFNARFFIEALRSVEQPEIELKFA
FT                   GEVGPCVIRPRNVENHINFILPVRLRSEDY"
FT   gene            2811..3029
FT                   /locus_tag="Toce_0003"
FT   CDS_pept        2811..3029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR002942; KEGG: cac:CAC0003 hypothetical protein;
FT                   PFAM: RNA-binding S4 domain protein; SMART: RNA-binding S4
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06800"
FT                   /db_xref="GOA:D9RYX2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX2"
FT                   /protein_id="ADL06800.1"
FT                   /translation="MREVFIKTESINLDQFLKWAGAVFTGGEAKIKIRQGLVKVNGQVE
FT                   TRRSRKLFPGDTVEFHGETFVVKGGSE"
FT   gene            3031..4134
FT                   /locus_tag="Toce_0004"
FT   CDS_pept        3031..4134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR001238:IPR003395; KEGG:
FT                   bha:BH0004 recombination protein F; PFAM: SMC domain
FT                   protein; SPTR: DNA replication and repair protein recF;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM:
FT                   RecF/RecN/SMC N terminal domain; TIGRFAM: recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06801"
FT                   /db_xref="GOA:D9RYX3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX3"
FT                   /protein_id="ADL06801.1"
FT                   /translation="MHLTKIRLFDFRNFREAEVEFSGGLNVLYGDNGQGKTNLLEAIHF
FT                   LCNLRPVRTTREQDVIAWDKTKAYLKGVFDTSSGPVDRELLLVAGDRKKVRECGVERHR
FT                   LSELYWQIHAVFFSPDDLSLVKGRPSERRRFLDLIIARLKPQYGRYLSEYNRALFHRNR
FT                   LLKDLKKNRTLITALDAWDEQLSSLGTVILKTRAAFTEKLFPLVRKYYLYFSREEREIE
FT                   IKYAGSIVSTGTSPESIHEAFLAALRKSLPQDLASGYTRVGPHRDDLQFLLGGRDLRYF
FT                   GSQGEQRTLSLSLKFAERRVFFETTGVYPILLLDDAMSELDANRRRWILEGEEPCQVFV
FT                   TTVDLSAIPEDILKKSRVYRVRAGSVG"
FT   gene            4139..4624
FT                   /locus_tag="Toce_0005"
FT   CDS_pept        4139..4624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: gsu:GSU0638 hypothetical
FT                   protein; PFAM: protein of unknown function DUF721; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06802"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX4"
FT                   /protein_id="ADL06802.1"
FT                   /translation="MEKIKNILLKILKKTDLERRLREAMVFVHYEEMVGEKIARVSKPV
FT                   FFRGDTLFIGVESPIWAHQLLFFKSDIINRINSRFSPPLVKDIRFQVCRVDGRPESHKK
FT                   DVKEDVEVKIPDKKKQMVYNITSNIKDEKLRQKFTELMLKDLEFKIKRGESLVPSHR"
FT   gene            4605..4862
FT                   /locus_tag="Toce_0006"
FT   CDS_pept        4605..4862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dae:Dtox_0005 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06803"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX5"
FT                   /protein_id="ADL06803.1"
FT                   /translation="MFLHIGKNTVVRTKDIIMILDRACTESRDTSDFLQVAREEGFVIT
FT                   GEEAGKSIIVTDKKVYFSPISSITLLKRANFIKGIGEQSF"
FT   gene            4879..6792
FT                   /locus_tag="Toce_0007"
FT   CDS_pept        4879..6792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0007"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR011557:IPR003594:IPR013506:IPR006171:IPR
FT                   002288:IPR000565:IPR001241:IPR018522; KEGG: tpd:Teth39_0010
FT                   DNA gyrase subunit B; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein; DNA gyrase
FT                   subunit B domain protein; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein; SPTR: DNA topoisomerase IV, B
FT                   subunit; TIGRFAM: DNA gyrase, B subunit; PFAM: Toprim
FT                   domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; DNA gyrase B; DNA gyrase B subunit, carboxyl
FT                   terminus; TIGRFAM: DNA topoisomerase IV, B subunit,
FT                   Gram-positive; DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06804"
FT                   /db_xref="GOA:D9RYX6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX6"
FT                   /protein_id="ADL06804.1"
FT                   /translation="MEKKTVYDETKIEVLEGLEHVRLRPGMYIGSTDSRGLHHLVYEVV
FT                   DNSIDEALAGFCKNILVTINKDGSITVDDDGRGIPVKIHPKVGKPALEVALTMLHAGGK
FT                   FGTGGYKVSGGLHGVGVSVVNALSKWLEVEVKRDGFKYFQRYERGKPVTEVKKIGEASD
FT                   TGTKITFMPDDQIFEDTSFNYDILAQRLREQAFLNRGLKIEIKDLRTGKEQVFHYEGGI
FT                   VSFVKYLNRNKDVLHEDPIYMRAASQEGEWEVEVALQYNDSYAENVLSFANNINTQEGG
FT                   THLVGFKSALTRSINDYARKMNLLKEQDPNLSGDDVREGLTAVISVKLVNPQFEGQTKT
FT                   KLGNSEMRGIVESVVGDAMNRFLEENPSVARVIVEKAISAARAREAARKARELVRRKNA
FT                   LDRTSLPGKLADCREKDPRLCELYLVEGDSAGGSAKQGRDPRFQAILPLRGKILNVEKA
FT                   RLDKILGNEEIRAMITALGTGIGDDFDIEKLRYHKIILMADADVDGAHIRTLLLTFLYR
FT                   YMRPLIEAGMVYIAQPPLYQVSKGKEVYYAYSDEELKAILERLGKDRDKAEVKRFKGLG
FT                   EMNADQLWDTTMNPKTRTILKVNLEDAIEADEIFTILMGEKVEPRRQFIFEHAAEVRNL
FT                   DI"
FT   gene            6807..9236
FT                   /locus_tag="Toce_0008"
FT   CDS_pept        6807..9236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0008"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit; InterPro
FT                   IPR005743:IPR002205:IPR006691; KEGG: chy:CHY_2704 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: DNA gyrase, A
FT                   subunit; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   domain, beta-propeller; TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06805"
FT                   /db_xref="GOA:D9RYX7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX7"
FT                   /protein_id="ADL06805.1"
FT                   /translation="MSELGGKVVPVTIEDEMKKSYIDYAMSVIVGRALPDVRDGLKPIH
FT                   RRILYAMSELNLTPDRPHRKSATIVGDVMGKYHPHGDAAIYDAMVRLAQDFSIRYPLID
FT                   GHGNFGSIDGDPPAAMRYTEARLSRIALEMLSDIDKDTVDFIPNFDDTLKEPAVLPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHNLSEVIDGVVMMIENPDVTSQELMAAIKGPDFPTGGI
FT                   ILGREGIREMYTTGRGSIIVRAKATIEPMEGGKQRIVVTEIPYMVNKARLIEKIAELVR
FT                   DKHLDGISDLRDESDRNGLRIVIELKRDANAHVILNQLYKHTQMQVTFGAIMLALVENK
FT                   PQVLTLREMIYHYLRHQQEVVVRRTKYELARAEERVHILEGLRIALNHLDEVIALIRKS
FT                   KDVPTAREGLMKNFGLTEKQAQVILDMRLQRLTALERQKIEDEYRELLEKIDYYKRVLG
FT                   DEKLVFAIIKEELLKIKERFGDERRTRIVAEVKDFDEQDLIPEEDVVITMTYMGYVKRM
FT                   PLSSYRSQKRGGKGVTGITTREEDFVERILVATTHHVVLFFTNQGNVYRLKAHEIPEAG
FT                   RTAKGTAIVNLLPLKPQEKVNAVIPIKDFGEASYLVMVTKRGLVKKTLLSEYESSRKTG
FT                   IIAITLTSGDELIGVKLVGKKDELILGTSHGMSIRFSVEDVTPTGRTARGVKAITLGEG
FT                   DEVASMDVTSVGSDVLVITEKGFGKRTPLDEYRIQTRGGRGIITQRVTDTTGRLVGLRV
FT                   VAEGDDIILCTASGMMIRLEVSGISSMSRNTRGVTLMKLEEGDQVSAVAVIRESED"
FT   gene            complement(9233..9481)
FT                   /locus_tag="Toce_0009"
FT   CDS_pept        complement(9233..9481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pth:PTH_1732 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06806"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX8"
FT                   /protein_id="ADL06806.1"
FT                   /translation="MEFQFNCPLCNGLISVRETCPECGSLMEDWGRVQDYLDPYHPYLD
FT                   MNTTAPGEQREKKCVHLFKCPQCGRDTRLVVNQVIAP"
FT   gene            9577..10998
FT                   /locus_tag="Toce_0010"
FT   CDS_pept        9577..10998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0010"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="COGs: COG1982 Arginine/lysine/ornithine
FT                   decarboxylase; InterPro IPR000310:IPR008286; KEGG:
FT                   cya:CYA_1002 Orn/Lys/Arg decarboxylase; PFAM: Orn/Lys/Arg
FT                   decarboxylase major region; Orn/Lys/Arg decarboxylase
FT                   domain protein; SPTR: Orn/Lys/Arg decarboxylase; PFAM:
FT                   Orn/Lys/Arg decarboxylase, C-terminal domain; Orn/Lys/Arg
FT                   decarboxylase, major domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06807"
FT                   /db_xref="GOA:D9RYX9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYX9"
FT                   /protein_id="ADL06807.1"
FT                   /translation="MPLVEKLILYSGKSPVRFHMPGHKGGRGVPKNLRLMMEKNLFRWD
FT                   VTEIPGLDNWHDPEGAIEEAQRLLAELYGADRSYFLVNGSTSGVMAMLGAALEKGDEVL
FT                   LPRNSHKAALMGIILTGAKPVYLKPQVDEELGVATGVPLSEWRKALEQHPDAKALFITN
FT                   PTYQGFCPNLSGISSEAKARGMKVLVDEAHGPHLAFSKRLPSSAGECKVDVWVQSPHKM
FT                   LCSLTQSAWLHLKGRDLDRERLRSYLSLLTSTSPSYILMASLDVARAVMETRGRYWVER
FT                   GLELAERARRSINEKTPFYCVGREVRGRRGVYDVDLSRLMVNVSSAGYTGFFVEKVLRK
FT                   RFHIYAEYADFSNVYFLLTGGNTRDDVAKLVRALKRFPARKKKIKSVCFPGDLPERAMD
FT                   PGKAYFSPAEWIHLDAAFGRITSDAVVPYPPGVPLLYPGEVVEKQHIEVIREIQKAGGY
FT                   CQGIKNGRIKVVKNG"
FT   gene            10991..11626
FT                   /locus_tag="Toce_0011"
FT   CDS_pept        10991..11626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0011"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COGs: COG0125 Thymidylate kinase; InterPro
FT                   IPR018094:IPR000062:IPR018095; KEGG: gwc:GWCH70_0026
FT                   thymidylate kinase; PFAM: thymidylate kinase; PRIAM: dTMP
FT                   kinase; SPTR: Thymidylate kinase; TIGRFAM: thymidylate
FT                   kinase; PFAM: Thymidylate kinase; TIGRFAM: thymidylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06808"
FT                   /db_xref="GOA:D9RYY0"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY0"
FT                   /protein_id="ADL06808.1"
FT                   /translation="MARNLRKGKFITIEGPDGAGKTTQAEKIVQYLKSKGKRVISTREP
FT                   GGTALGEQLRKVLLDPEGSPVSNAEALIYAACRAQLLERMVIPALREGFTVVCDRFVDS
FT                   SLAYQGWARGIGINRILQLNKWVIGSYWPDITILLDVDPAVSLGRLVGGRKDRLESEAL
FT                   EFHQKVREGYMKVREMFPDRIRIIDASQPADEVFRQIVAELEKAGVVE"
FT   gene            11655..11978
FT                   /locus_tag="Toce_0012"
FT   CDS_pept        11655..11978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0012"
FT                   /product="protein of unknown function DUF970"
FT                   /note="COGs: COG3870 conserved hypothetical protein;
FT                   InterPro IPR010375; KEGG: sth:STH3257 hypothetical protein;
FT                   PFAM: protein of unknown function DUF970; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF970)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06809"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY1"
FT                   /protein_id="ADL06809.1"
FT                   /translation="MKMLMAVVQDIDAPKLVEELTKNNVGVTRLTSTGGFLKRGNTTLM
FT                   IGVEEERLEDVMKMIERICRPRKQVVTPFPAAPGDTMIPYPIEVTVGGATVFVMNVERF
FT                   EKI"
FT   gene            11975..12418
FT                   /locus_tag="Toce_0013"
FT   CDS_pept        11975..12418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0013"
FT                   /product="protein of unknown function DUF327"
FT                   /note="COGs: COG1728 conserved hypothetical protein;
FT                   InterPro IPR005585; KEGG: bha:BH1478 hypothetical protein;
FT                   PFAM: protein of unknown function DUF327; SPTR: BH1478
FT                   protein; PFAM: Protein of unknown function (DUF327)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06810"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY2"
FT                   /protein_id="ADL06810.1"
FT                   /translation="MIKVRGLSSEEVSTASGYVSHRAASGGSRFQEILRSAREVCAKEQ
FT                   LEGMLASIEEQGRRLVKTMSLADLKKYREMLARFLRQCVESGLDLKEERFFTRYGRQKV
FT                   LTAVKIVDRKLMELAELILSKSDAVKVLAIVDEIRGLLLDLYA"
FT   gene            12402..13217
FT                   /locus_tag="Toce_0014"
FT   CDS_pept        12402..13217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0014"
FT                   /product="DNA polymerase III gamma/tau subunits"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   KEGG: bbe:BBR47_00780 DNA polymerase III delta' subunit;
FT                   SPTR: DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06811"
FT                   /db_xref="GOA:D9RYY3"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY3"
FT                   /protein_id="ADL06811.1"
FT                   /translation="MTCMRNVFHAYILIGSEEETTEKALELAQAANCNDDGLPCGFCDC
FT                   CRRIREGSHPDLFHVFPDGSSIKIEKIRNVILSASQPPIEGRRKIYVIHEAGKMTQDAQ
FT                   NTLLKTLEDPPTASIFLLLTQNIKNLLPTVVSRCQILDYSKLDESEIPIPGDVKETLMD
FT                   IIFSRPDLSKIHFYVQKLTGTEIDPDVLMEFMAGVYRDLLVIKTKSRASIKNREFLNRL
FT                   KEQAAKFSPRALVAAIDTLYSQIEAVKSRGNANLVWFNLLLRLQEQEVI"
FT   gene            13219..14052
FT                   /locus_tag="Toce_0015"
FT   CDS_pept        13219..14052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0015"
FT                   /product="PSP1 domain protein"
FT                   /note="COGs: COG1774 Uncharacterized homolog of PSP1;
FT                   InterPro IPR007557; KEGG: gwc:GWCH70_0028 PSP1 domain
FT                   protein; PFAM: PSP1 domain protein; SPTR: PSP1 domain
FT                   protein; PFAM: PSP1 C-terminal conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06812"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY4"
FT                   /protein_id="ADL06812.1"
FT                   /translation="MVKVVGVRFKRAGKIYYFNPGTIELSVGDKVIVETARGIEYGEVV
FT                   IGPKDVREEDVITPLKDVIRKATPEDKMVAEENRVKAREAADIAVKKIQEHGLEMKLVD
FT                   VEYTFDRSKLIFYFTADGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMVGGLGPCGR
FT                   VACCHTFLGEFDPVSIKMAKQQNLSLNPGKISGLCGRLMCCLRFEYDGYCEAAKCCESC
FT                   KEAGGLPEVDSEVITPDGEGTVVSVNKDKGAVTVRLAENGEKKEFPAEEVELKGS"
FT   gene            14135..14836
FT                   /locus_tag="Toce_0016"
FT   CDS_pept        14135..14836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0016"
FT                   /product="peptidase membrane zinc metallopeptidase
FT                   putative"
FT                   /note="COGs: COG2738 Zn-dependent protease; InterPro
FT                   IPR007395; KEGG: hmo:HM1_2075 conserved hypothetical
FT                   protein, possible neutral zinc metallopeptidase; PFAM:
FT                   peptidase membrane zinc metallopeptidase putative; SPTR:
FT                   Putative uncharacterized protein; PFAM: Putative neutral
FT                   zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06813"
FT                   /db_xref="GOA:D9RYY5"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY5"
FT                   /protein_id="ADL06813.1"
FT                   /translation="MFPIWFFDPTLIILLPALVLAFYAQAKVSTTFERYLRVPARVGLT
FT                   GAEVARELLRRNGIYDVTVEMTGGRLSDYYDPRRKVLRLSPDVYNGRSLAALGVAAHEC
FT                   GHAIQHNIGYVPLVFRNTIVPLAGIGSQMAFPLFFIGLLFSSEFLATLGILFFSAAVIF
FT                   QLITLPVEYNASSRAVAALEGAGFIYPDEVGPVRSVLSAAALTYVAATLMAVLQLLRLI
FT                   ALFGLYNRDDR"
FT   sig_peptide     14135..14212
FT                   /locus_tag="Toce_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            14959..15834
FT                   /locus_tag="Toce_0017"
FT   CDS_pept        14959..15834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0017"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR005263:IPR002220:IPR020624:IPR020625; KEGG:
FT                   dae:Dtox_3164 dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; SPTR: Dihydrodipicolinate
FT                   synthase; TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   Dihydrodipicolinate synthetase family; TIGRFAM:
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06814"
FT                   /db_xref="GOA:D9RYY6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY6"
FT                   /protein_id="ADL06814.1"
FT                   /translation="MDFGRVITAMVTPFDGDLNVDYAAFENLVDHLIKNGSDALVVTGT
FT                   TGESPTLSDEEKLTLYKLAKEVAGGRAKIIAGTGSYNTRHSIELSLKAQEIGVDGLLLV
FT                   SPYYNKPTQEGLYQHFKMIAEAVDIPVMLYNVPGRTAVTIEPETLMKLSKVKNIVAVKD
FT                   AGGNLDKTSKTRLLAPDLTVYSGDDSLTLPMLALGAKGIVSVASHIVGREIKEMIESFE
FT                   KGDVNRAREIHLKLFDLFKVLFIVTNPIPVKEAMNMIGVKVGGLRPPLTPADEKTKEAI
FT                   KETLQALGLV"
FT   gene            complement(15926..16828)
FT                   /locus_tag="Toce_0018"
FT   CDS_pept        complement(15926..16828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0018"
FT                   /product="Hsp33 protein"
FT                   /note="COGs: COG1281 Disulfide bond chaperones of the HSP33
FT                   family; InterPro IPR000397; KEGG: gyc:GYMC61_0064 HSP33
FT                   protein; PFAM: Hsp33 protein; SPTR: Chaperonin HslO; PFAM:
FT                   Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06815"
FT                   /db_xref="GOA:D9RYY7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY7"
FT                   /protein_id="ADL06815.1"
FT                   /translation="MTGLKDYMVRAIDEEAGILAFAARTTELVEKARTIHGCSPTATAA
FT                   LGRLLTAAAMMGSMLKGEGDTVTVRVDGGGPAGPLIAFSDSRGNVKGYIGNPSADLPLN
FT                   EKGKLDVGGIVGREGTLTVIKDLGLKEPFVGRVPLISGEIAEDITYYFARSEQVPSAVS
FT                   LGVLVDRDRRVRAAGGFIIQLMPGSTEETAIFIEEKIKGMKPVTELLDEKNSPEDLINL
FT                   ILPGFKLRFLASQPVNYSCSCSRERLEGVLLNLGREEAEEILKAQGRVEFVCQYCREKY
FT                   EFTGEDVRRIFESAENPAS"
FT   gene            16983..17840
FT                   /locus_tag="Toce_0019"
FT   CDS_pept        16983..17840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0019"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: bcg:BCG9842_B3361 putative polysaccharide
FT                   deacetylase; PFAM: polysaccharide deacetylase; SPTR:
FT                   Putative polysaccharide deacetylase; PFAM: Polysaccharide
FT                   deacetylase; TIGRFAM: polysaccharide deacetylase family
FT                   sporulation protein PdaB"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06816"
FT                   /db_xref="GOA:D9RYY8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY8"
FT                   /protein_id="ADL06816.1"
FT                   /translation="MRKPLIAGILIAIGILLLWAHINGYELRLVPNRREFQTPKYQSRS
FT                   PKEITEHFKLAGGSERDNRGFPQRKIDDLSSKLPELFYREGPRNVKMVALTFDDGPDSV
FT                   YTPQILDVLKEQNVKATFFLVGKRAELFPDVVRRMVREGHVVGNHTWSHPNIIKMNNED
FT                   MVREILRAEETLSKLTGYRPALFRSPYGSIDEARVKEIAKLNYKVIAWSVDSLDWKSLT
FT                   AEQVKTNILENVREGSIILQHSAGGGEDLSGSVAALKDVIVTLKKEGYRFVTIPELLKI
FT                   PYKK"
FT   sig_peptide     16983..17042
FT                   /locus_tag="Toce_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(17817..18455)
FT                   /locus_tag="Toce_0020"
FT   CDS_pept        complement(17817..18455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0020"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="COGs: COG0352 Thiamine monophosphate synthase;
FT                   InterPro IPR003733; KEGG: tit:Thit_0601 thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase;
FT                   SPTR: Thiamine-phosphate pyrophosphorylase; TIGRFAM:
FT                   thiamine-phosphate pyrophosphorylase; PFAM: Thiamine
FT                   monophosphate synthase/TENI; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06817"
FT                   /db_xref="GOA:D9RYY9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYY9"
FT                   /protein_id="ADL06817.1"
FT                   /translation="MKPDFTLYAVTERSYLHGRDLVEAVEEAIRAGITVLQLREKDAPG
FT                   REFYELALRLRELTRVYGIPFIINDRVDIALAVDADGVHVGQEDIPADVARKIIGPGKI
FT                   LGVSAKTVEEAIRAEKDGADYLGVGAIFPSPTKPSSEAIGLEGLIKIKNAVKIPVVAIG
FT                   GITVQNANEVMATGVDGICCISAVFCGDITENVRALRRAISQSFFIGDF"
FT   gene            complement(18475..19278)
FT                   /locus_tag="Toce_0021"
FT   CDS_pept        complement(18475..19278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0021"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="COGs: COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   InterPro IPR004399:IPR013749; KEGG: tte:TTE2235
FT                   hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   PFAM: Phosphomethylpyrimidine kinase type-1; SPTR:
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06818"
FT                   /db_xref="GOA:D9RZC0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC0"
FT                   /protein_id="ADL06818.1"
FT                   /translation="MKLALTIAGSDSGGGAGIQADLKTFSAHGVFGMSVITSVTAQNTK
FT                   AVIGVEDISPEMVYLQIKAVFEDLPPDAVKIGMVSSASIIRSVAKGLDEFGPEKVVLDP
FT                   VMISKSGHALLKPDAVEALKRELLPRCLVVTPNIPEAKALTGMSIKGVEDMERAAEKIM
FT                   SYGCRAVVVKGGHLEGDAVDVFFDGREFHRLKSERIFSRNTHGTGCTFSSAIAANLALG
FT                   RDLFTAVKLAKEYITGAIKNSMDIGGGAGPVHHFYELYRRAGLNV"
FT   gene            complement(19577..20122)
FT                   /locus_tag="Toce_0022"
FT   CDS_pept        complement(19577..20122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0022"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   tex:Teth514_0342 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06819"
FT                   /db_xref="GOA:D9RZC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC1"
FT                   /protein_id="ADL06819.1"
FT                   /translation="MFTGEKVRLRAYRKEDLEKALQFINDPEVKRFLAPGIPFPLTESD
FT                   EEKFISKQSGFNTDAYSFAIETLEGEYIGGCGINSTDWKNSVAVVGIFIGNKDYWGKGY
FT                   GTDAMRVLLRFIFEQMNINKVKLFVYDFNKRAIRCYEKCGFKVEGVLRQEIYRDGRYHD
FT                   ELAMGILRSEWFGAGNKK"
FT   gene            20400..21275
FT                   /locus_tag="Toce_0023"
FT   CDS_pept        20400..21275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0023"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="COGs: COG0313 methyltransferase; InterPro
FT                   IPR008189:IPR000878:IPR018063; KEGG: tit:Thit_0092
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: conserved hypothetical protein
FT                   TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06820"
FT                   /db_xref="GOA:D9RZC2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC2"
FT                   /protein_id="ADL06820.1"
FT                   /translation="MAEKKEPGILYLCPTPIGNLEDITLRVLRVLKEVDYIAAEDTRVT
FT                   RKLLNHYDIKTPLTSYREHNRAKKGDEIITDLLAGKSVALVSDAGTPGISDPGEDLVKK
FT                   AVEAGIRVVPLPGPSAVICAVAASGLSTGKFVFEGFLPQKSTERQKRLAELKEEERTIV
FT                   IYEAPHRLLKALSDIREILGNRRITVAREMTKVHEEFFRGSIEEAIIRYQSAPPRGEIV
FT                   LVLEGSSCDKGETGGLDLEDEGSRRLLLEKIKTYMSRGMDKKQALKTAAKELGVPKREA
FT                   YKLLVKSERE"
FT   gene            21357..22187
FT                   /locus_tag="Toce_0024"
FT   CDS_pept        21357..22187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0024"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COGs: COG0345 Pyrroline-5-carboxylate reductase;
FT                   InterPro IPR000304:IPR004455; KEGG: ddf:DEFDS_1283
FT                   pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; PRIAM:
FT                   Pyrroline-5-carboxylate reductase; SPTR:
FT                   Pyrroline-5-carboxylate reductase; TIGRFAM:
FT                   pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; TIGRFAM:
FT                   pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06821"
FT                   /db_xref="GOA:D9RZC3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC3"
FT                   /protein_id="ADL06821.1"
FT                   /translation="MYNRLGFFGAGSMAEALLKGILSASVLAPEDIFVLNRKDDDRLKF
FT                   FEKTYGVNTTRDYGRLVGECETLIIAVKPSDVKGVMLKIRDFLKEQHTIISVAAGITTS
FT                   RIEEFAGKRIRVIRAMPNTSCQVKESATAITAGRHAGRDDLEKAFRIFSSVGQVIEVDE
FT                   EWMDAVTALSGSGPAYVYLMMEALTEAGVKVGLPREVSYELAVQTVLGAAKMVKETGEH
FT                   PASLRKKVTSPGGTTMAGIETLEKMGFTNCIIQAVNSAARRSRELMEGGSYGNC"
FT   gene            complement(22259..22510)
FT                   /locus_tag="Toce_0025"
FT   CDS_pept        complement(22259..22510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0025"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="InterPro IPR006339:IPR007159; KEGG: cac:CAC3647
FT                   transition state regulatory protein AbrB; PFAM: SpoVT/AbrB
FT                   domain protein; SPTR: Transition state regulatory protein
FT                   AbrB; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT / AbrB like domain; TIGRFAM: looped-hinge helix
FT                   DNA binding domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06822"
FT                   /db_xref="GOA:D9RZC4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC4"
FT                   /protein_id="ADL06822.1"
FT                   /translation="MKSTGVVRKVDELGRVVIPIELRRTLDISEKDALEIYVDTDKIIL
FT                   KKYQPGCIFCGSAENVISFKGKNICEKCAGQIEQTKKN"
FT   gene            22640..23596
FT                   /locus_tag="Toce_0026"
FT   CDS_pept        22640..23596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0026"
FT                   /product="NurA domain protein"
FT                   /note="InterPro IPR018977; KEGG: bcl:ABC0059 hypothetical
FT                   protein; PFAM: NurA domain; SPTR: NurA domain superfamily;
FT                   PFAM: NurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06823"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC5"
FT                   /protein_id="ADL06823.1"
FT                   /translation="MQELNEGLKNEFRQAAGALRKRLEQRPNRAAMRAYIAGSGMGRFT
FT                   KSRKMSNIELEQIAEKGGIAGVDGSTNSAGGIFPYVITLQQAMAKSTVAQEEIYFQRVM
FT                   CPLLFEEALDEAGYQEMVKSSLAGLEARAALSAIEKFSPAVLLIDGSLVRLKIEAKHLW
FT                   EKLKEAALDSGTLLAGVVEGISTRVISSALKGVLPEAVTGACDWELLFGVMDVGEGLEV
FT                   APGCFKEGFRTVFMRTSGDPKPIGIDLLEEQYEHLELVENLIYTLTPESGRGIPLWLDL
FT                   IDKKVKISDATIEGLLKTYLGQDYAEFLTPKRAKRSP"
FT   gene            23690..25522
FT                   /locus_tag="Toce_0027"
FT   CDS_pept        23690..25522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR002543; KEGG:
FT                   bha:BH0052 hypothetical protein; SPTR: BH0052 protein;
FT                   PFAM: Domain of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06824"
FT                   /db_xref="GOA:D9RZC6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC6"
FT                   /protein_id="ADL06824.1"
FT                   /translation="MQVVGLTTPQEIFVASKERKFRINEILVIDDPYQGPLIGEVVEAN
FT                   SYNRFIPLSINHDFIDARVLESLERLGYSISEDEINIARVKLMTEASFPVTTGAKAHLP
FT                   EFSEVRDFLVRSDAEGGLALGEIKNTEETASTMDENLKGLFYVYSRGERYRTRNVPFLL
FT                   DLKSFQQYPHIGIFGGSGSGKSYGLRVIMEELMMKGIPSIILDPHYEMDFSAMEEGLEG
FT                   APDFRGAFRKFQIGEDIGVEFLALGKRDLLDLLSAVKPLTEAMSSAVEILHRRGDTFIS
FT                   FSSRLELLAEALELGRIRIEKMLQQDLEPAEREKYKKMKELIEEYPNIPLVSVQGIAWR
FT                   LRRLHASGIFNYDIKPVKEALLSGKLAVIQGPIWLLQVFSTYLLSNLYRARRDYKDGEL
FT                   RGQNTADYFPPFVIATDEAHNFAPKGRDAASKGVITEIAQEGRKYGVFLVLATQRPTLL
FT                   DETVTAQLNTKIIFRTVRGHDIATITEETDIGAEEARRLPYLPSGDAFVSSPLFGRTVA
FT                   IRVRYPYTRSPHTLNPFDELKRYRVSAEEKLFGLLEPHLPVYDTNLLQVLQAINTDAPE
FT                   LKLEVKTLKESLDNLVKSGRLKKTETPFGAMYHS"
FT   gene            25846..27780
FT                   /locus_tag="Toce_0028"
FT   CDS_pept        25846..27780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0028"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="COGs: COG0143 Methionyl-tRNA synthetase;
FT                   InterProIPR002304:IPR004495:IPR015413:IPR002547:IPR
FT                   014758:IPR018247; KEGG: ttj:TTHA1298 methionyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class I (M);
FT                   t-RNA-binding domain protein; SPTR: Methionyl-tRNA
FT                   synthetase; TIGRFAM: methionyl-tRNA synthetase;
FT                   methionyl-tRNA synthetase, beta subunit; PFAM:
FT                   Anticodon-binding domain; tRNA synthetases class I (M);
FT                   Putative tRNA binding domain; TIGRFAM: methionyl-tRNA
FT                   synthetase C-terminal region/beta chain; methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06825"
FT                   /db_xref="GOA:D9RZC7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC7"
FT                   /protein_id="ADL06825.1"
FT                   /translation="MKDRIFYITTPIYYVNAQPHIGHAYTTIVADFLARWHRLAGYDTF
FT                   FLTGTDEHGEKIAQAAQKNGEEPQAFVDRVSARFREAWEKLCIEYDDFIRTTDERHKKV
FT                   VQYVLQKVYDAGDIYYGEYEGLYCVGCERFLTEKELVDGRCPDHGTVPERRREGNYFFR
FT                   MEKYREWLRDYIQANPDFIRPEGYRNEVLSMLSEPVGDLSISRPRQRVPWGIPLPWDED
FT                   HVTYVWFDALLNYVSALGYPDGEKYHRFWTHAWHLVGKDILKPHAVFWPTMLKSAGIPL
FT                   YRHLNVGGFLLGPDGRKMSKSLGNVVDPFALAEKYGPDVVRYYLLRELPYGQDGAVGEP
FT                   GLVERYNADLANDLGNLLSRTVTMIEKFYSGYIPAPGLSEGPDHELIALAEGLPDRLEN
FT                   LINGLEITEALKEIWKFIGRANKYIDETAPWTLAKDPAKKERLATVIYNLAEALRIISV
FT                   HISPVMPNTSGEIRRQLGIADEGLFTWESVRKWGRLPAGLKIGGKRIIFPRIENKSASG
FT                   KEAKAVEQKDTAVNRDESREGLITIDDFAKIDLRVAVVLEAERIEGADKLLKLKVKIGE
FT                   EERQIVAGIAKHYTPEELVGKKIVVVANLKPAKLRGVESQGMLLAASTKDKLTLVTVEN
FT                   DIEPGAKVK"
FT   gene            27792..28568
FT                   /locus_tag="Toce_0029"
FT   CDS_pept        27792..28568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0029"
FT                   /product="hydrolase, TatD family"
FT                   /note="COGs: COG0084 Mg-dependent DNase; InterPro
FT                   IPR012278:IPR015991:IPR001130; KEGG: tit:Thit_0099
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; SPTR: Hydrolase, TatD family; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD related DNase; TIGRFAM:
FT                   hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06826"
FT                   /db_xref="GOA:D9RZC8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC8"
FT                   /protein_id="ADL06826.1"
FT                   /translation="MLVDVHAHLDDEAFDGDRDQLLEEIKSQGIKVINAGTDLETSRFS
FT                   LQLAREYGFVYACVGVHPHEASRVPADYLDALREMARDPKVVAIGEIGLDYHYNFSPGD
FT                   VQKEVFEEQLSLARELGLPVVVHSREADCDTLEILKKSGVRKSLMHCYSGSPEMAAELA
FT                   ELGFYFSFGGPLTFKNAAKTREVAAGLPRDRVLIETDCPYLTPEPFRGKRNDPTRLPYI
FT                   AAALAQIWRVPVEEVVEITCRNAVSLFNIDLKPGRR"
FT   gene            28657..29268
FT                   /locus_tag="Toce_0030"
FT   CDS_pept        28657..29268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0030"
FT                   /product="Radical SAM domain protein"
FT                   /note="InterPro IPR007197; KEGG: drm:Dred_1747 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SPTR: Radical SAM domain protein; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06827"
FT                   /db_xref="GOA:D9RZC9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZC9"
FT                   /protein_id="ADL06827.1"
FT                   /translation="MDMIAYPIGDSLYLNITNRCPNRCSFCIRQLGDGIEGYNLWLDKE
FT                   PTTKEIIEAIGDPSGYREVVFCGYGEPLMRLQVVLDVARYLKKNYPNLPIRINTNGLAN
FT                   LIYGEDITPQFKGLIDTVSISLNAENAQKYHELCRSDYGEDAFFSVLEFARRCKNYVPK
FT                   VVLTVVDVPGIDIEKCKRIAEELGVGFRVRHYEGKDGEEN"
FT   gene            29265..30113
FT                   /locus_tag="Toce_0031"
FT   CDS_pept        29265..30113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0031"
FT                   /product="dimethyladenosine transferase"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro
FT                   IPR011530:IPR001737:IPR020598:IPR020596; KEGG:
FT                   gym:GYMC10_0027 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; PRIAM: rRNA
FT                   (adenine-N(6)-)-methyltransferase; SMART: Ribosomal RNA
FT                   adenine methylase transferase-like; SPTR: Dimethyladenosine
FT                   transferase; TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   Ribosomal RNA adenine dimethylase; TIGRFAM:
FT                   dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06828"
FT                   /db_xref="GOA:D9RZD0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD0"
FT                   /protein_id="ADL06828.1"
FT                   /translation="MNARAIMREFGIRPSKRLGQHFLIDEAPLYKMLEAARLNESDEVL
FT                   EIGPGLGVLTLELCRRAKKVVAVEKDPNLIPVLEKLTKSYNNICLLREDVLKLDMEKLW
FT                   REYFDGKFKVVANLPYYITSPVIMKIINNRHLIEMAVIMIQKEVAHRLVAAPGNKDYGI
FT                   LSVAVQLYADVDLVCHVGRSAFLPPPKVDSAVVRLVLKEGSAVPLEDERLFFKVVEAAF
FT                   GERRKTVKNSLRSRLSLFAGDVEEALERAGIDGSRRAETLTIEEFAALAREIKDYLKDC
FT                   S"
FT   gene            30205..30675
FT                   /locus_tag="Toce_0032"
FT   CDS_pept        30205..30675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0032"
FT                   /product="protein of unknown function DUF458"
FT                   /note="COGs: COG1978 conserved hypothetical protein;
FT                   InterPro IPR007405; KEGG: mta:Moth_0053 hypothetical
FT                   protein; PFAM: protein of unknown function DUF458; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF458)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06829"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD1"
FT                   /protein_id="ADL06829.1"
FT                   /translation="MYFISPTKGRIPIEEVVKDIIAFMEEEPNAPYKLIIGTDSQARDN
FT                   VCFVTAIIVHRVGKGARYYYQRKIMPQVKSLRHKVYTETSLSLEAVSLLKGELSKTSYR
FT                   NMDVEIHVDIGQNGDTKELIREVVGWVMSSGYKVKIKPQAFGATKVADKYTK"
FT   gene            complement(30668..31486)
FT                   /locus_tag="Toce_0033"
FT   CDS_pept        complement(30668..31486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0033"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: adg:Adeg_2109 glycosyl
FT                   transferase family 2; PFAM: glycosyl transferase family 2;
FT                   SPTR: Glycosyl transferase, family 2; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06830"
FT                   /db_xref="GOA:D9RZD2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD2"
FT                   /protein_id="ADL06830.1"
FT                   /translation="MNIAVVPAKNEQGRIGKVLDNLSDTAVDRIVVVLNGSRDGTLKEI
FT                   KTQKLPKVEVLSFREPLGYDIPRAVGVYYALKKGAECVVFVDGDMTGNLLPAVNRLVDA
FT                   VVSEKVDLAMTRIQPEMISENELARELYLFRRVLNERLGLYKKVGVAIPSHGPCAVSRR
FT                   LMEKADIRDFAVPPVILAFAVKNDLRVEAPVEMHSRELGSKVRGFSHAKKIADTIIGDI
FT                   LEALAFFEGKPRKRILLQKEYQGYNPRRRFDLLERFIALYGRNFDFNPST"
FT   gene            31588..32445
FT                   /locus_tag="Toce_0034"
FT   CDS_pept        31588..32445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0034"
FT                   /product="sporulation peptidase YabG"
FT                   /note="InterPro IPR008764; KEGG: dhd:Dhaf_0082 sporulation
FT                   peptidase YabG; PFAM: peptidase U57 YabG; SPTR: Sporulation
FT                   peptidase YabG; TIGRFAM: sporulation peptidase YabG; PFAM:
FT                   YabG peptidase U57; TIGRFAM: sporulation peptidase YabG"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06831"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD3"
FT                   /protein_id="ADL06831.1"
FT                   /translation="MAMIKVGDVVARLSYGKDIYFKVVDIREEQHIALLRGINVRIFAD
FT                   APLEDLVFPSASEIREYKKEYIRKYNECLERIFYRREVEMNRLKRGDSDENGFFYIPGK
FT                   VLHVDGDEEYLELCLTTYRQLGIEAHGVKLSEKDQPGKIRKLVMEYNPDILVITGHDGL
FT                   LKNRSDFNNVEAYRNSKFFIEAVKEARKYEPSLDDLVIFAGACQSHYEGLIKAGANFAS
FT                   SPHRVFIHALDPVFVIEKIAFTPIDKIVSAKDVIEATITGIKGIGGIGTRGKLREGLPR
FT                   SPYD"
FT   gene            32462..33901
FT                   /locus_tag="Toce_0035"
FT   CDS_pept        32462..33901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0035"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="COGs: COG2385 Sporulation protein and related
FT                   protein; InterPro IPR014225:IPR013486:IPR013693:IPR002508;
FT                   KEGG: aoe:Clos_0281 SpoIID/LytB domain-containing protein;
FT                   PFAM: cell wall hydrolase/autolysin; Stage II sporulation D
FT                   domain protein; SMART: cell wall hydrolase/autolysin; SPTR:
FT                   SpoIID/LytB domain; TIGRFAM: SpoIID/LytB domain protein;
FT                   stage II sporulation protein D; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase; Stage II sporulation
FT                   protein; TIGRFAM: SpoIID/LytB domain; stage II sporulation
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06832"
FT                   /db_xref="GOA:D9RZD4"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD4"
FT                   /protein_id="ADL06832.1"
FT                   /translation="MAEECDGLKVRVFDVEKKRHLVLEMEEYVAGAVAYAMPAEFPPEA
FT                   LKAQAICARTIAVRRMRAFGGTGCRRYPDYDLCSDPLHCQGFLDEDDRRKLWGARFGEY
FT                   MQRIKKAVEDTFGIILTFNGKPIEAVYHRACGGYTEDSESVWGNRVAYLRRVECNYCKD
FT                   SPYWRVTRTFSIRQLKKRLGIKLDENCFDKRELPGLVDEVQSTPSGRVKRMRIGDRVFD
FT                   GTDVKKLLDLPSTRFGWKVSSITFEALGTGHGLGMCQCGAMGMALLGFPFDEILKFYFT
FT                   GVELSDVVKPTAAKPLSGKVVAVDPGRGGEADHCGPMGLSEGYVNLEIARVLAAMLVRE
FT                   GAQVVMTREKDEYKSLSERVKIINQNKADIAMSIHQSFHSDESMGGTEVFYFPGDKKAR
FT                   MLSLCVHRELISALNLTDHGVKEADLYILRETNIPCIVVNVAHLSNPEEERLLSEREFR
FT                   EKAARAILSGIKSYYQGLLKE"
FT   gene            34039..34302
FT                   /locus_tag="Toce_0036"
FT   CDS_pept        34039..34302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0036"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="COGs: COG4466 Uncharacterized protein; InterPro
FT                   IPR009366; KEGG: amt:Amet_4610 hypothetical protein; PFAM:
FT                   protein of unknown function DUF1021; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1021)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06833"
FT                   /db_xref="GOA:D9RZD5"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD5"
FT                   /protein_id="ADL06833.1"
FT                   /translation="MATENTLLRIRKSIEPYVGQKVRVRANRGRKKTFEKEGILEKVYP
FT                   SIFVIRVEESPDFVRRISYSYSDILTETVQLTLCQKEKSGSK"
FT   gene            34403..35407
FT                   /locus_tag="Toce_0037"
FT   CDS_pept        34403..35407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0200 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06834"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD6"
FT                   /protein_id="ADL06834.1"
FT                   /translation="MLRAERILRRYERKLLRLENVVGTGLGYKIIEGRITNEPAVIVLV
FT                   RKKKPERELPASQVVPKKLDEVYTDIIEVGDVRLLTARTQKTRPAMPGMSIGHYKITAG
FT                   TFGAVVRDQITGEPLILSNNHVLANASNGRDGRAAVGDPIMQPGPYDGGGPEDVIAHLY
FT                   RFIPVEKDVTHSRCPIARRGENLLNFFVRMIRPDYRVAFMKHRAAYNLVDAAVAKPINP
FT                   DYISPEILDLGEIRGIAEPRIGMTLVKSGRTSGVSKSEVKALNVKIRVMMGAGEEATFY
FT                   DQILTGPMAQPGDSGSLVLNENMEAVGLLFAGSDLVTLINPISAVLKLLKVTF"
FT   gene            35590..36270
FT                   /locus_tag="Toce_0038"
FT   CDS_pept        35590..36270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0038"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014258:IPR014044; KEGG: pth:PTH_2171
FT                   hypothetical protein; PFAM: SCP-like extracellular; SPTR:
FT                   Uncharacterized protein; PFAM: Cysteine-rich secretory
FT                   protein family; TIGRFAM: uncharacterized protein, YkwD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06835"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR014258"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD7"
FT                   /protein_id="ADL06835.1"
FT                   /translation="MRKPLRNLIVLTLLAALVLLPGVASAAGWITVNLNYNGKVQTFRI
FT                   PIEGLEGGTYKCNITIPKLPGQTLSKPAPQPAPQPKPQPAPGDDKPITPPVKGLTADEQ
FT                   QMLNLVNAERVKAGLKPLEIDMRLVDISRKKSKDMIENNYFGHTSPTYGTPFDALKAAG
FT                   ISYRYAGENIAGAPTVQRAHEGLMNSPGHRANILNPNYNRIGIGIVDGGPYGKMFTQTF
FT                   IGTN"
FT   sig_peptide     35590..35667
FT                   /locus_tag="Toce_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            36470..36889
FT                   /locus_tag="Toce_0039"
FT   CDS_pept        36470..36889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfo:BRAFLDRAFT_74208 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06836"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD8"
FT                   /protein_id="ADL06836.1"
FT                   /translation="MLLLGLTVGLGVAIVVLYFFARKYFIGKKGCIKEPPKEKKKPVKP
FT                   LPAEENPVGVPEPPEGQKPEQSEDQKTEQPEDQKPEQPEGQKPEQAEGQKPEQPESQEP
FT                   EQPEDKKAEQEQPVEPVPSDKAKDGTDTPEAHPLP"
FT   gene            37030..38652
FT                   /locus_tag="Toce_0040"
FT   CDS_pept        37030..38652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0040"
FT                   /product="spore coat assembly protein SafA"
FT                   /note="InterPro IPR014248:IPR018392:IPR002482; KEGG:
FT                   hor:Hore_21410 peptidoglycan-binding LysM; PFAM:
FT                   Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; SPTR: Peptidoglycan-binding
FT                   LysM; TIGRFAM: spore coat assembly protein SafA; PFAM: LysM
FT                   domain; TIGRFAM: spore coat assembly protein SafA"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06837"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZD9"
FT                   /protein_id="ADL06837.1"
FT                   /translation="MGVKLSKELVRVDQVVGEDRAQTVVEGIILLPGGKPDIERVLSVE
FT                   AEVNPQSLEINILDGKVMVEGSIDVQALYVGCVPSGSQPVHFVEGTVDFSFFVKIPGAK
FT                   KNMDVRVKSRVEHVQFSCKENRPREIEVRIVVEFFVKVTQRVQIEIVVDATGPADLQVL
FT                   RENIRVDNVVGEARTQAIVKSDVSVPEKKPDILEIIKVEGKARINETKLLDGKIIVEGV
FT                   LEISVLYVADVPCDKPEQPVHFMEAEVPFTQFIEVEGAREDMSKFVKVQVEHIRARKKD
FT                   ERTLTVEAVLDIKARVFEPKMIEVVQDLFSPSQMLDVQKTRLKVDQVIGEDENQVVVKE
FT                   ALTVPLEKPPIEQIFKTNAKAKVTDTRIIDDKVIVDGVLKLETLYVASVPPHHPQQPLH
FT                   FVEHEVPFTVFVEIPGAREDMMLDFDVEVEHVSSKVEPNDCRRFEVRVVVRLFAKVTKM
FT                   VQLDVVVDVKQIEKGAKEEKEEKEKKDSSPTMTIYIVQKGDTLWKIAKRYNVTLEAIIQ
FT                   ANNLENPDLIYPGQRLIIPRRMY"
FT   gene            38728..39570
FT                   /locus_tag="Toce_0041"
FT   CDS_pept        38728..39570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0041"
FT                   /product="cyanophycinase"
FT                   /EC_number="3.4.15.6"
FT                   /note="COGs: COG4242 Cyanophycinase and related
FT                   exopeptidase; InterPro IPR011811:IPR005320; KEGG:
FT                   dhd:Dhaf_0084 cyanophycinase; PFAM: peptidase S51
FT                   dipeptidase E; PRIAM: Cyanophycinase; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: cyanophycinase; PFAM:
FT                   Peptidase family S51; TIGRFAM: cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06838"
FT                   /db_xref="GOA:D9RZE0"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE0"
FT                   /protein_id="ADL06838.1"
FT                   /translation="MGEKVKGFLIIIGGAEDRKGECKILKKFINISGGKDARITVITAA
FT                   AQDPQQVGAEYIEIFSELGAHDVQALNIESRKEADREEIADRILDSTGIFFTGGDQLRI
FT                   TSLLGGTRVYNALHRAYREGVIVAGTSAGASAMSDTMIIGGSGDQAPKGSTVSMAPGLG
FT                   LLEEVVVDQHFAQRGRMSRLLLAVAQNPYILGVGIDEDTAILVSPDGKFRVIGSNTVTV
FT                   VDGSIVDFTNVSELESGEPLAMFNAKIHILSPGFGFDMKNRKPLKGEATGTYIRSGNG"
FT   gene            39616..42243
FT                   /locus_tag="Toce_0042"
FT   CDS_pept        39616..42243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0042"
FT                   /product="cyanophycin synthetase"
FT                   /note="COGs: COG0769 UDP-N-acetylmuramyl tripeptide
FT                   synthase;
FT                   InterProIPR011810:IPR005479:IPR013221:IPR004101:IPR
FT                   018109:IPR011761; KEGG: tte:TTE2785 cyanophycin synthetase;
FT                   PFAM: Mur ligase middle domain protein; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; cytoplasmic peptidoglycan
FT                   synthetase domain protein; SPTR: UDP-N-acetylmuramyl
FT                   tripeptide synthase; TIGRFAM: cyanophycin synthetase; PFAM:
FT                   RimK-like ATP-grasp domain; Mur ligase family, glutamate
FT                   ligase domain; Mur ligase middle domain; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type; cyanophycin
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06839"
FT                   /db_xref="GOA:D9RZE1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE1"
FT                   /protein_id="ADL06839.1"
FT                   /translation="MDIVDIKAIEGPNIYSPKPVIRMLVDVGEYEDIPTKDIEGFNRRL
FT                   LEKLPGLAMHHCCFEEPGGFLMRLQEGTYIPHVIEHVALEILNLLGQDVKFGRARRLEK
FT                   TTYNIVFSYKGKFAALEAGRLAFRLVNALARGSDLDLEGELERIKRYCAEMELGPSTAA
FT                   IEREAKSRGIPVTRVGDESLLILGYGAYQKRVKATITGETSCVAVDIACDKTLTKKMLT
FT                   LAGIPVPEGTVVCSEEEAVRAARELGFPVVIKPVDGNQGNGVSLNLENEAEVAEAFRLA
FT                   AGYSPRVIVEKYIRGRHYRVLVVGGKFVCAAERIPAHVVGDGIRSIRELIEEVNRDPVR
FT                   GEKHEKPLTKIKVDPVVLRVLARRGYTLDTVPGKGELVFLRENGNLSTGGTAVDVTDLV
FT                   CPENRMLAERAAAMIGLDVAGIDITTEDISIPVEKSGGAVIEVNAAPGIRMHLYPSMGE
FT                   SRPAARAIVDMLFPQEPPRFPLVAVTGTNGKTTTVRMVANILSAHGLKVGMTCTDGVYV
FT                   GSMCIRRGDCSGPESAKMVLLDPSVEAAVLEIARGGLIRGGLAYEYADVGIITNITGDH
FT                   LGQDGVNTLEDLMFVKSLVAEQVKPEGYAVLNADDITSVEVKKRVKSRVIFFSLQEDNL
FT                   VLRKHIAEGGRGVYVKDGFIFFQEGDKSVSLMKVADIPAAMNGRARHNVQNALAAAAAG
FT                   WALDVPAETIRRALSDFRCDESTNPGRLNIISEGNIRIILDYGHNPAALEAIIGTARSM
FT                   NPARMVGVIASPGDRRDEAIVKLGQVAGRGFQRLIIKEDEDPRGRKPGEVASLLLEGAL
FT                   SAGLKKDQIDVILKEEEAITFALENAQDGDLIVIFYEHYDSAIEAIRESLKRRRKTPAA
FT                   ARIV"
FT   gene            42323..43177
FT                   /locus_tag="Toce_0043"
FT   CDS_pept        42323..43177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0043"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR004424:IPR006204:IPR013750:IPR000870;
FT                   KEGG: cce:Ccel_0022
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein; SPTR: 4-(Cytidine
FT                   5'-diphospho)-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases C terminal; GHMP kinases N terminal domain;
FT                   TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06840"
FT                   /db_xref="GOA:D9RZE2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE2"
FT                   /protein_id="ADL06840.1"
FT                   /translation="MDKVELEARAKINLTLDVLYRRSDGYHEVEMIMQTISLKDRIVIT
FT                   LIPEKGIRIVNSCRELPDGEDNLAFKAAKLMMDEYGLDAGVEIKLFKEIPIAAGLAGGS
FT                   ADAAAVLEGLNELFGLGLPKEALMRLGEMIGADVPFCTMGGTALARGKGEKLTPLPPVP
FT                   PMNLLLVKPPFAVSTREVYNRLKIDSITKRPDTEAVIRSIEKGDVDGISRGLCNVLEEV
FT                   TFAQHPELGIIKAWLVERGAMGSLMSGSGPTVYGIFENRRDAERAAASMPLSGCRIFIS
FT                   QVD"
FT   gene            43190..43891
FT                   /locus_tag="Toce_0044"
FT   CDS_pept        43190..43891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0044"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1802 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011711:IPR000485; KEGG: mta:Moth_0073 GntR
FT                   family transcriptional regulator; PFAM: GntR domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; SPTR: Transcriptional regulator, GntR
FT                   family; PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06841"
FT                   /db_xref="GOA:D9RZE3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE3"
FT                   /protein_id="ADL06841.1"
FT                   /translation="MAGKLKSIRLDNYKPLREIVFEALREAIITGELKPGERLMEVQLA
FT                   EEMGVSRTPVREAIRKLELEGLVVMIPRRGAYVSGLSLKDAADVFEVRQSLEGLAAALA
FT                   AERITDEELESLERILVEISEAAEKDDVDTVIKKDSEFHQILFKATRNDRLVQIINNLK
FT                   EQIDRFRLQSFTNRARVRSLLEEHKKIVEAISDRNVELAKKLAEEHIERVENNVMNILR
FT                   KQMDFEEELSC"
FT   gene            43885..44643
FT                   /locus_tag="Toce_0045"
FT   CDS_pept        43885..44643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0045"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A-like protein"
FT                   /note="KEGG: tpd:Teth39_0178 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A-like protein; SPTR:
FT                   Molybdopterin-guanine dinucleotide biosynthesis protein
FT                   A-like protein; PFAM: Uncharacterized protein family
FT                   UPF0007"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06842"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE4"
FT                   /protein_id="ADL06842.1"
FT                   /translation="MLKALVLAGGDGDEKLQESEGTKALVRINGREMILYILDALKKLD
FT                   YIEKIAIVGPKEKLSSIKVGPNVVVVEESDSIVGNILRGLELFSDDDEILIMTCDIPMV
FT                   TAEAIDDFVKKAKGLNADFCYPIIRKEDTEKKYPGIKRTYARVREGTFTGGNVALVKVG
FT                   SAKRCIKKAEEFFTYRKNPLKLASILGFSVVLKFLLGKLSIPELEKRVYDIFGIKARAV
FT                   ISDFPEIGNDVDKKSDLELVREVLGREVVQ"
FT   gene            44640..45464
FT                   /locus_tag="Toce_0046"
FT   CDS_pept        44640..45464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0046"
FT                   /product="pur operon repressor"
FT                   /note="COGs: COG0503 Adenine/guanine
FT                   phosphoribosyltransferase and related PRPP-binding protein;
FT                   InterPro IPR010078:IPR015265:IPR000836; KEGG: aoe:Clos_2648
FT                   pur operon repressor; PFAM: purine repressor ;
FT                   phosphoribosyltransferase; SPTR: Purine operon repressor,
FT                   PurR; TIGRFAM: pur operon repressor; PFAM: Phosphoribosyl
FT                   transferase domain; Bacterial purine repressor, N-terminal;
FT                   TIGRFAM: pur operon repressor, Bacillus subtilis type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06843"
FT                   /db_xref="GOA:D9RZE5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE5"
FT                   /protein_id="ADL06843.1"
FT                   /translation="MRRSKRLVLLSKFLSENPNRIFTLKYFGDKYDAAKSSISEDLNII
FT                   KDAFHEAGEGTLETIPGAAGGVRFRIKRPAQAIEKFVLELSSILSDRSRIIPGGYLYMT
FT                   DVIFSPEYSSKIGEIFAQLFVDEEPTCVLTVETKGIPLALMTARALGVPLVVARRDSRV
FT                   TEGPSVNISYISGSSRRIQNMALPTRALSEKARVLIVDDFMKGGGTARGMSELVREFRA
FT                   EVVGVAVLVATAYPEEKLVKNYTSLLVLEKIDAERGEVRLKPVKIPIKKEGV"
FT   gene            45516..45776
FT                   /locus_tag="Toce_0047"
FT   CDS_pept        45516..45776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0047"
FT                   /product="SpoVG family protein"
FT                   /note="COGs: COG2088 Uncharacterized protein involved in
FT                   the regulation of septum location; InterPro IPR007170;
FT                   KEGG: gyc:GYMC61_0042 SpoVG family protein; PFAM: SpoVG
FT                   family protein; SPTR: Uncharacterized protein, involved in
FT                   the regulation of septum location; PFAM: SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06844"
FT                   /db_xref="GOA:D9RZE6"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE6"
FT                   /protein_id="ADL06844.1"
FT                   /translation="MEVTDVRIKRVENEGRMKAIVSVTFDDEFVVHDIRIIEGDKGLFI
FT                   AMPSRKTSSGHFRDVAHPINSAARAKIEEAVLKQYNGEDSK"
FT   gene            45896..47296
FT                   /locus_tag="Toce_0048"
FT   CDS_pept        45896..47296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0048"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase
FT                   ;UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="COGs: COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains); InterPro
FT                   IPR005882:IPR005835:IPR001451:IPR018357; KEGG: tte:TTE2572
FT                   N-acetylglucosamine-1-phosphate uridyltransferase; PFAM:
FT                   Nucleotidyl transferase; transferase hexapeptide repeat
FT                   containing protein; SPTR: UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06845"
FT                   /db_xref="GOA:D9RZE7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE7"
FT                   /protein_id="ADL06845.1"
FT                   /translation="MDFTAVILAAGEGTRMKSNTPKVLHKVCGIPMLGHVVSAARGAGA
FT                   KRIVVVVGRGSDEVKRAFEGEEVEFVLQAEQKGTGHALKQAQEAVKGEAAILVLYGDMP
FT                   LVKSETLRAMADFHWKNGATATVMTARVKDPTGYGRIIRKGLEVLAIREEKDATPEEKA
FT                   IDEINSGIYFFQAEKVFDALNQVNNNNKQGEYYLTDVIEILNAGKEKVLAYEVQDPDEV
FT                   QGVNDRFQLSVAQAIMQRRIIHRLMAQGVTFLSPETCVVDAGVKIGRDTVIYPGVFLEG
FT                   DTWIGEGCTIIGTSRIIDSRIGNGVEITMCHIQESVVEDGVKIGPFANLRPGSHVMAGA
FT                   KIGDFVEVKNSRVGEGSKIPHLAYVGDAEIGRRVNIGAGVIFVNYDGFEKHRTVVEDDA
FT                   FIGCNSNLIAPVTIGAGSYVAAGSTINMDVEKGALAIARERQVNKPEWVEKRRRKREGG
FT                   DKTDGKQA"
FT   gene            47280..48218
FT                   /locus_tag="Toce_0049"
FT   CDS_pept        47280..48218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0049"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR005946:IPR000836:IPR000842; KEGG:
FT                   chy:CHY_0193 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: Ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06846"
FT                   /db_xref="GOA:D9RZE8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE8"
FT                   /protein_id="ADL06846.1"
FT                   /translation="MENRLEIFTGNANPELAREIARNLGIMVGDAVVNTFSDGEIQVKI
FT                   NESVRGADVFVIQPLSYPVNDHLMELLIMLDALKRASAWRITAVMPYYGYARQDRKIRA
FT                   RDPITAKLVADLISTAGAHRVLTMDLHAGQIQGFFNFPVDHLMAVPILADYFRKKELED
FT                   PVVVSPDLGGVTRARELANRIGASIAIIDKRRPEPNKAEVMNIIGDIRNKTVIMIDDMI
FT                   DTAGTITLGAQALLDKGAKEVYACCTHPVLSGPAIERLNASPIKEVVVTNTIPLRDHQK
FT                   IEKITVLSVAPLFAEAIRRIHLHQSVSTLFD"
FT   gene            48282..48914
FT                   /locus_tag="Toce_0050"
FT   CDS_pept        48282..48914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0050"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="COGs: COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc); InterPro IPR001021:IPR020055; KEGG:
FT                   gka:GK0045 50S ribosomal protein L25/general stress protein
FT                   Ctc; PFAM: Ribosomal protein L25-like; SPTR: 50S ribosomal
FT                   protein L25; TIGRFAM: ribosomal 5S rRNA E-loop binding
FT                   protein Ctc/L25/TL5; PFAM: Ribosomal L25p family; TIGRFAM:
FT                   ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06847"
FT                   /db_xref="GOA:D9RZE9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZE9"
FT                   /protein_id="ADL06847.1"
FT                   /translation="MAQVTLTAEERKLAGKGTLNELRRNGKVPAVFYGKNIENRTIAVD
FT                   AKELHKLLKTHGEGVLIDLVLGGEKHTVIIKEIQRDALKGDITHVDFFRVSMTEKIEVD
FT                   LPIVLKGEPEGVKAGGVLQHQLHELTIEALPADIPEQIEVDISHLQIGDVLMVKDIKLS
FT                   DKITVIDDPGEVVVTVLAPTSGEELESTAGETNEPEVVAKGKEKEGE"
FT   gene            48963..49526
FT                   /locus_tag="Toce_0051"
FT   CDS_pept        48963..49526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0051"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COGs: COG0193 Peptidyl-tRNA hydrolase; InterPro
FT                   IPR001328:IPR018171; KEGG: tit:Thit_2235 peptidyl-tRNA
FT                   hydrolase; PFAM: peptidyl-tRNA hydrolase; PRIAM:
FT                   Aminoacyl-tRNA hydrolase; SPTR: Peptidyl-tRNA hydrolase;
FT                   TIGRFAM: peptidyl-tRNA hydrolase; PFAM: Peptidyl-tRNA
FT                   hydrolase; TIGRFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06848"
FT                   /db_xref="GOA:D9RZF0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF0"
FT                   /protein_id="ADL06848.1"
FT                   /translation="MFLIVGLGNPGREYEETRHNVGFMVLDSLAAELGIKVDKVKFKGL
FT                   LGEGVYEGKKLLLLKPMTYMNNSGQSVVEAVKFYKIPPENLVVIYDDMDLPVGRLRVRG
FT                   SGSSGGQKGMESIIYHIATEGFPRIRIGIGRPKGDVINHVLGRFDKEERKKIDAVIDAA
FT                   VGAALTIVQHGVQEAMNRYNGFEA"
FT   gene            49612..49899
FT                   /locus_tag="Toce_0052"
FT   CDS_pept        49612..49899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsg:lse_1318 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06849"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF1"
FT                   /protein_id="ADL06849.1"
FT                   /translation="MTKLRSFLLGVGAAALAYGLLTRRKRAVAEIETDAEGGIRVRPIK
FT                   RVELVTPGLGQAYRGVNPEEQGLVRLSDELSNLKDAITRLQSEIEELKKK"
FT   sig_peptide     49612..49662
FT                   /locus_tag="Toce_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            50083..54072
FT                   /pseudo
FT                   /locus_tag="Toce_0053"
FT   gene            51505..53574
FT                   /locus_tag="Toce_0054"
FT   CDS_pept        51505..53574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0054"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG3711 Transcriptional antiterminator;
FT                   InterPro IPR011608:IPR002178:IPR013011; KEGG: amt:Amet_4270
FT                   transcriptional antiterminator, BglG; PFAM: PRD domain
FT                   protein; PRIAM: Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase; SPTR: Transcriptional antiterminator,
FT                   BglG; PFAM: HTH domain; Mga helix-turn-helix domain; PTS
FT                   system, Lactose/Cellobiose specific IIB subunit; PRD
FT                   domain; Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06850"
FT                   /db_xref="GOA:D9RZF2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF2"
FT                   /protein_id="ADL06850.1"
FT                   /translation="MVIPVDLKRREREILKILLEGPTTTERIASLLGVSRRTVLRGLPE
FT                   LSEKLKSLGINLVKKAGTGVSLEGRKDSMEKLECLIERPSKRVEMTPDERQQLIILSLL
FT                   EQKGPRKLYTFAREFNVTDATISNDLDKIEEILSRYGIKLLRRPGLGVWIEGHEKNIRA
FT                   LVTELFYENFDEAQLVRLIKDNLRCEIISGRGVRAQVKDRLLGLIDRNLVEEIEHALKE
FT                   VVEESGLHLADSAYAGLLVHIALALERLKSGEIITMDEPFLANFKNTKEFDLARRLGSK
FT                   LEAAFGISIPEGELGYITMHLLGAKLRMGDNLDELFLLDHRDAAQAAREILKEAGRELK
FT                   KDLLEDGRVLEDLALHLKPALVRLKLGMEIRNPLLSQIKESYPRLMQVAGRAARLLEKR
FT                   FGVTVPESEIGYIAMHIGAALEHGGGAERAGVVLVCPSGIGSARMLASRIKKELPELEV
FT                   LEVVSALDLEKALEKHPDAEAVISTVPMEVSKAPVLLVSPLLNDDDVEKIRAYFRARRL
FT                   KERESSGVVTGRGRPEERRELVFEILEEFVIEEVDADNLEELLDVLVEKIRKKPGITSA
FT                   GRIKQDLYSREIKAGTAVPGLGLSVLHARTGGVEKPFLGLFRLKKSLKMKNMDGDTEEV
FT                   KACLVMLLSPRPSPGEIEVMGRISAGLVEDPTLAGVLKSGSGEDVIKALLRILK"
FT   gene            54069..55202
FT                   /locus_tag="Toce_0055"
FT   CDS_pept        54069..55202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0055"
FT                   /product="D-mannitol 1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="COGs: COG0246 Mannitol-1-phosphate/altronate
FT                   dehydrogenase; InterPro IPR013131:IPR013118:IPR000669;
FT                   KEGG: bbe:BBR47_56360 mannitol-1-phosphate 5-dehydrogenase;
FT                   PFAM: Mannitol dehydrogenase domain; Mannitol dehydrogenase
FT                   rossman domain; SPTR: Mannitol-1-phosphate 5-dehydrogenase;
FT                   PFAM: Mannitol dehydrogenase C-terminal domain; Mannitol
FT                   dehydrogenase Rossmann domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06851"
FT                   /db_xref="GOA:D9RZF3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF3"
FT                   /protein_id="ADL06851.1"
FT                   /translation="MKKAVHFGAGNIGRGFIGFLLSRAGYRVVFVDINAELIETLNEKG
FT                   FYRVMEKGEDEKVYRVEGVTGILSTEEQKVAEAVAHAHIVTTAVGPGVLGSIAPLIAAG
FT                   ISRRLQHSPEPLNVIACENMVGASTFLKEKVMEHLSPSEREKLEKTVGFPDAAVDRIVP
FT                   PQSGTDPLGVAVEPYFEWVVDIGGFKGAVPEIPGMKAVENLQAYVERKIYTLNTGHAVA
FT                   AYLGYEKGCTTIREALQNPQILEAVKGAMAESGVYLRACFGFSEEEHEVYIEKTLQRFL
FT                   NPALEDPVVRVGRNPVRKLGPKDRLVYPSVRALELGVKPVNLARGIAAALKFDYEEDQE
FT                   ARKLQQMLREQGIDVVLNKVCGIPDESPLRDIIKATL"
FT   gene            55444..55958
FT                   /pseudo
FT                   /locus_tag="Toce_0056"
FT   gene            55948..56932
FT                   /pseudo
FT                   /locus_tag="Toce_0057"
FT   gene            57025..57123
FT                   /locus_tag="Toce_0058"
FT   CDS_pept        57025..57123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06852"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF4"
FT                   /protein_id="ADL06852.1"
FT                   /translation="MIKIEIDEKAKDFIREKNSDAITVKLERFGGG"
FT   gene            complement(57306..58079)
FT                   /locus_tag="Toce_0059"
FT   CDS_pept        complement(57306..58079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0059"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387:IPR018130; KEGG: adg:Adeg_1668
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06853"
FT                   /db_xref="GOA:D9RZF5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF5"
FT                   /protein_id="ADL06853.1"
FT                   /translation="MIDGKLIRNIRRKRNMSLQELARRADLSVSYLSEIERGIKQPSLE
FT                   TIEKMANALNISKNALFGAEPTENRNSRSIGEKIALLRQEKGISLSELAEKAGISATYL
FT                   CQIEKGNALPSLSTLKALAEALCMTAQDLMVATSHVGYKIKKIRQERGLTQVELAKKAG
FT                   VSTGLIGQIESGRVEPSLKTLEKIAHALSLSPCYFVTDDDEIASLLRPMNPELKRLLVD
FT                   PKVRSFLEMVADCTPEEFEFIMKFIQLYKEHRSAD"
FT   gene            58235..58549
FT                   /locus_tag="Toce_0060"
FT   CDS_pept        58235..58549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0060"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR005746:IPR013766:IPR006662:IPR017937:IPR 017936;
FT                   KEGG: rmr:Rmar_0180 thioredoxin; PFAM: Thioredoxin domain;
FT                   SPTR: Thioredoxin; TIGRFAM: thioredoxin; PFAM: Thioredoxin;
FT                   TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06854"
FT                   /db_xref="GOA:D9RZF6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF6"
FT                   /protein_id="ADL06854.1"
FT                   /translation="MKPLTLTDDNFEQEVLKSDVPVLVDFWAPWCGPCRMMAPVIDELA
FT                   AEYEGKIKVGKLNVDENPNSAAAYGVMSIPTLILFKDGQPDKKLIGFRPKREIIAELGI
FT                   "
FT   gene            58676..59635
FT                   /locus_tag="Toce_0061"
FT   CDS_pept        58676..59635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0061"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro
FT                   IPR006127:IPR006129:IPR006128; KEGG: lmy:LM5923_2813
FT                   hypothetical protein; PFAM: periplasmic solute binding
FT                   protein; SPTR: Periplasmic solute binding protein; PFAM:
FT                   Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06855"
FT                   /db_xref="GOA:D9RZF7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF7"
FT                   /protein_id="ADL06855.1"
FT                   /translation="MKGKGVTAVFLSLLVIVLTLSACSFNTDTPASPHGQEKIRVYTTI
FT                   YPLYDFALKIAGGRAEVVNVTPAGVEAHDFEPSPRTVADIYEADVFIYLGGPMDPWAEK
FT                   IAKQLAEKGVVAVAAAEGLLGDEDHENEGDRDRDRDHDHDRGPDPHVWLDPVISKTLAE
FT                   RIAQALIAADGENADHYRQNFEVLKARLDDLDKKFREAFSGVKKRDFVVNHDAFGYLAR
FT                   RYNLNQIAIRGLSPQQEPSPRKLAELARICREKDIKYIFFETAAGSKLAETLAREVGAG
FT                   TLVLNPIESMTEDEMKAGEDYFSAMEKNLENLKKALAE"
FT   sig_peptide     58676..58741
FT                   /locus_tag="Toce_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            59652..60407
FT                   /locus_tag="Toce_0062"
FT   CDS_pept        59652..60407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0062"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: amt:Amet_1173 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06856"
FT                   /db_xref="GOA:D9RZF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF8"
FT                   /protein_id="ADL06856.1"
FT                   /translation="MKEENKKTPVVELQNVTFSYNGPPVLEGVSLRVERGDFMALIGPN
FT                   GAAKSTLMKIMVGLLTPNRGTVRLFGEDIRKFRQWYRIGYVPQQGGHVNLAFPATVEEA
FT                   VASGLYGGFMKFFKGQEIDKAVREAMATVGIEHLARSLLGELSGGQRQKVFLARSLVKK
FT                   PEALFLDEPTAGIDPESQEEFYSLLKNLNELHGITVVMITHDIGMAYDRATRIGCVGSR
FT                   KVDVHENIKDITEDHIAEVMGYRIKKKRH"
FT   gene            60432..61256
FT                   /locus_tag="Toce_0063"
FT   CDS_pept        60432..61256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0063"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   amt:Amet_1174 ABC-3 protein; PFAM: ABC-3 protein; SPTR:
FT                   ABC-3 protein; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06857"
FT                   /db_xref="GOA:D9RZF9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZF9"
FT                   /protein_id="ADL06857.1"
FT                   /translation="MEIFSYSFMVRAFIAGVIAAVLTSTIGVFVVLRRMSIVGDSLSHA
FT                   SLAGVAAGMLFGFYPFYGALLFSVLAALLIEVMRATFKSYAEVAMAVVMSAGMGTAVVL
FT                   ISLGKSFNADLFSYLFGSLMAVTPGDIKVISVLGLFVTASIILLRRELFAVTFDEDTAR
FT                   LSGVPVRAVNIYFSVITALTVALSVRVVGTLLVSALIVIPAAVSLQLARSFRSAFFISN
FT                   IVAIFSVVVGLYISFYLDLAPGGTIVLIATSVLFLVLLLKKGVGKGWNWKIC"
FT   gene            61235..61672
FT                   /locus_tag="Toce_0064"
FT   CDS_pept        61235..61672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0064"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: amt:Amet_2333 ferric uptake
FT                   regulator family protein; PFAM: ferric-uptake regulator;
FT                   SPTR: Ferric uptake regulator, Fur family; PFAM: Ferric
FT                   uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06858"
FT                   /db_xref="GOA:D9RZG0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG0"
FT                   /protein_id="ADL06858.1"
FT                   /translation="MELENLLKQKGLKITDQRKAIVKVLKECGCMLSAREIFDKVKKII
FT                   PGVNFSTIYRNLDLMSQKGILCGLMVDTGVSLYGLRSEEGHHHHFVCKGCGRSLAIDYC
FT                   PMGLLEKELAKKGFSHTEHQFVVYGFCGSCGTSGGVKAKSY"
FT   gene            62169..62678
FT                   /locus_tag="Toce_0065"
FT   CDS_pept        62169..62678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0065"
FT                   /product="tryptophan transport protein"
FT                   /note="KEGG: aoe:Clos_0393 tryptophan transport protein;
FT                   SPTR: Tryptophan transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06859"
FT                   /db_xref="GOA:D9RZG1"
FT                   /db_xref="InterPro:IPR031360"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG1"
FT                   /protein_id="ADL06859.1"
FT                   /translation="MKLKDMILTSLLMAIGLVFHQITPPLVAGMKPDFLLTMLFVALFI
FT                   NPAPKNALLAGMVGGIFAALTTSFPGGQVANIADRIITAQVVALLIRRSRGVSLRIFVP
FT                   LTGLVGTILSGTVFLLAAMMVMGALPAAFPVLFTAVVLPTAAINSVVTGILYGLVTATG
FT                   KVVRKI"
FT   sig_peptide     62169..62252
FT                   /locus_tag="Toce_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            62848..63609
FT                   /locus_tag="Toce_0066"
FT   CDS_pept        62848..63609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0066"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2302 conserved hypothetical protein
FT                   contains S4-like domain; InterPro IPR002942; KEGG:
FT                   tte:TTE1597 hypothetical protein; PFAM: RNA-binding S4
FT                   domain protein; SMART: RNA-binding S4 domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06860"
FT                   /db_xref="GOA:D9RZG2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR040591"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG2"
FT                   /protein_id="ADL06860.1"
FT                   /translation="MDSGSEKMTEAKIRDIFNIAIKNGEKRAGNFLDPAEQQIAEAVAR
FT                   NFPGAGYYFEGGHSEAERKVLVAFPEYLEDQPFFLPIRAIRVIPKDPDEHPSHRDYLGA
FT                   VLGLGISRDKVGDIIVTKTGADIIVKEEVAEYIGLNLSRVGNVPVSVEEISLKEVATVE
FT                   RSYKEIKGTVASLRLDAIASLAFGISRSKMAPYIKGENVRLNFRTVKDPSAEVKEGDVI
FT                   SAARLGRAKVVEIGGSSKKGRIYVTVHRYTG"
FT   gene            63681..64292
FT                   /locus_tag="Toce_0067"
FT   CDS_pept        63681..64292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0067"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: dau:Daud_1727
FT                   phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR:
FT                   Phospholipid/glycerol acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06861"
FT                   /db_xref="GOA:D9RZG3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG3"
FT                   /protein_id="ADL06861.1"
FT                   /translation="MFYLLAKLILRIFFSFTGGVKADGISNVPKKGPLIIVSNHQSILD
FT                   PTVLMACISRRIHFLAAAYLFRIPVLNILLPMAGAIPVKSEKGDLASFKKALRILAKGG
FT                   VIALFPEGGVSPDGSLRPFKHGWAYLALKSGAPVLPVAVIGTRDVLPVGTYMPRRGRIE
FT                   VRVGECVAVQKKGRVRQEDFGELNMMMEGRLKSLLVGTRQ"
FT   sig_peptide     63681..63746
FT                   /locus_tag="Toce_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            64413..65168
FT                   /locus_tag="Toce_0068"
FT   CDS_pept        64413..65168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0068"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="COGs: COG1583 Uncharacterized protein predicted to
FT                   be involved in DNA repair (RAMP superfamily); InterPro
FT                   IPR010156:IPR002743; KEGG: dhd:Dhaf_3942 CRISPR-associated
FT                   protein Cas6; PFAM: protein of unknown function DUF57;
FT                   SPTR: CRISPR-associated protein Cas6; TIGRFAM:
FT                   CRISPR-associated protein Cas6; PFAM: CRISPR associated
FT                   protein Cas6; TIGRFAM: CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06862"
FT                   /db_xref="GOA:D9RZG4"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG4"
FT                   /protein_id="ADL06862.1"
FT                   /translation="MRVRIHFEPVTLGTSIYYPYYLQTALYSLLDGELGTWMHDKGLVL
FT                   EKRRLKPICFSRLMGEYKLDRERGIIYFPKGAALVVTSPISEICQSLLTGLLKRGEIIL
FT                   GKSSFPVSKVEIADPKVSGSSILVRTLSPITVYSTMLKFDGSKYTCYFSPKDSEFVSLC
FT                   RDNLVRKARALGWEENQDFELNIEFKGDPKTNMVKFKNNFIKGYSGYLMISGPTRYLKL
FT                   ALDWGLGAKNSAGFGCLEITGGGNHQDRI"
FT   gene            65208..67267
FT                   /pseudo
FT                   /locus_tag="Toce_0069"
FT   gene            67292..68242
FT                   /locus_tag="Toce_0070"
FT   CDS_pept        67292..68242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0070"
FT                   /product="CRISPR-associated protein, Csh2 family"
FT                   /note="COGs: COG3649 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR006482; KEGG:
FT                   pth:PTH_1918 hypothetical protein; PFAM: CRISPR-associated
FT                   protein TM1801; SPTR: Uncharacterized protein; TIGRFAM:
FT                   CRISPR-associated protein, CT1132 family; PFAM: Family of
FT                   unknown function (DUF694); TIGRFAM: CRISPR-associated
FT                   protein, CT1132 family; CRISPR-associated protein, Csh2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06863"
FT                   /db_xref="GOA:D9RZG5"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG5"
FT                   /protein_id="ADL06863.1"
FT                   /translation="MPEIPRTGEILFIKCVKDGIPNRDPLNDSDARRIFGEDDGRISLS
FT                   DVSIKRDVRDYIQHRFPDGGPDKKYHIFVRQEKGENGKLRDRKELARKIIEDVSGEDSP
FT                   DKKKTLMSAAFDVRVFGAVYSVEKESFNQTGPVQFGWAHSLHPVETRYVQGTVVIPSED
FT                   ASKGQGSIWTTYIVPFAVFCMPGVINQSIANETGATRDDIELLLEALWKGTLHRQARGR
FT                   GIQQPCFLLHVEYSDPFFRIGYLEDYISLEPGREAWLGGNPPTSLEQVRLNVDRLAEVL
FT                   DPNGEFGNKIERIRYWVNPALTISCELPGTREKIW"
FT   gene            68281..68979
FT                   /locus_tag="Toce_0071"
FT   CDS_pept        68281..68979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0071"
FT                   /product="CRISPR-associated protein Cas5"
FT                   /note="InterPro IPR013422; KEGG: CRISPR-associated protein
FT                   Cas5; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   CRISPR-associated protein Cas5; PFAM: CRISPR-associated
FT                   protein (Cas_Cas5); TIGRFAM: CRISPR-associated protein
FT                   Cas5, Hmari subtype; CRISPR-associated protein Cas5,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06864"
FT                   /db_xref="GOA:D9RZG6"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG6"
FT                   /protein_id="ADL06864.1"
FT                   /translation="MKLLVFELRGDIAHFRRPDGIVTHPTYPAMPRTVLCGLIASILGK
FT                   SVLDGENWMGYSILSPVRTVTQEMSMLGKGWMGNSGDYFNRLTSIQLIVNPHYRVYYAG
FT                   DHFETLVEMIRERRSVFHTYLGSAFCLTFPRFTGVIDAEEISPAPGDILTAITIVPTNI
FT                   VERLITETGERYIPMRGARYTVDRDRNFKGTLNFIIEESGRPIKFRTRDSAGSVNYRIL
FT                   KVENGVICLW"
FT   gene            68973..71408
FT                   /locus_tag="Toce_0072"
FT   CDS_pept        68973..71408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0072"
FT                   /product="CRISPR-associated HD domain protein"
FT                   /note="COGs: COG1203 helicase;
FT                   InterProIPR006483:IPR006474:IPR006935:IPR001650:IPR 014001;
FT                   KEGG: pth:PTH_1916 helicases; PFAM: type III restriction
FT                   protein res subunit; helicase domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR:
FT                   Predicted helicases; TIGRFAM: CRISPR-associated HD domain
FT                   protein; CRISPR-associated helicase Cas3; PFAM: DEAD/DEAH
FT                   box helicase; TIGRFAM: CRISPR-associated helicase Cas3"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06865"
FT                   /db_xref="GOA:D9RZG7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG7"
FT                   /protein_id="ADL06865.1"
FT                   /translation="MVIPFRECVARPKSGDGNPNLLTDHLFAVAKFMGDPKGGDESRLR
FT                   FLAGLCHDVGKATKRWQMYILSKEEGRVVASGGSHSPLGSMIFFVCSEQLVTKDLPRRF
FT                   REYLITQLTLDIAGHHGSIKNIDPAWPPWEEALLSAEGVYPYETVDLDGFFDFVREYFP
FT                   EITLTSRSFADRLQGIDRRWAVVADKALGYAKRYIDNSADRDSAAAGLIMRDRTSAMIS
FT                   ADRFHAAGLNFAFFHPEEARVAINNLAEECSRLQKNAAPETLRIVKLRNDHQKEALETY
FT                   RTFPDRLIYSLELATGLGKTLTALRIALEAVASGKCSRVIYVAPYISILSQATNVIREA
FT                   TGISDIIEHHHLSFLDIDYEHLRSEEDGAFLIDSWQSKIVTTTFNQFFLALFPTKAQHT
FT                   VRIQALNNAFVIIDEPQIIEPKAWAAFLKTLEAAAKRLHFQSILCTATLPHASDYLNEE
FT                   YMCLSRGDSLIPRYIIKTLEGKWDAQTLAELAVKKLMEKGSVAVILNTVADAARVYMAV
FT                   KDLILRGYFENITGIDIFNLTGCMTPLHKSAWISRIKDSLRRGKKCIVVCTQILEAGVD
FT                   LSFRCVIRARPVIPSVIQAAGRGNRHGEGDPAEVLVVDFVRDDGEDSRKYVYKNPIFRE
FT                   VTDEQLEICKEFSEKDSREIIENFYREAFKRNPPTRKMQLIYEAAMGQWSRLKEIEPFE
FT                   GDYPKVMVFVPRVFKGSGGPDIPEIIQRAMKYFGISGVSDIYQRYLEKGFWKSLSFRDK
FT                   KLFMALIEQFCVCVSVKRADSIVRIPEGAFIGSLVDDRIYSEDTGMALAEDSTEFRMF"
FT   gene            71422..71952
FT                   /locus_tag="Toce_0073"
FT   CDS_pept        71422..71952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0073"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /note="COGs: COG1468 RecB family exonuclease; InterPro
FT                   IPR013343; KEGG: pth:PTH_1915 endonuclease; SPTR: RecB
FT                   family exonuclease; TIGRFAM: CRISPR-associated protein
FT                   Cas4; manually curated; PFAM: Domain of unknown function
FT                   DUF83; TIGRFAM: CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06866"
FT                   /db_xref="GOA:D9RZG8"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG8"
FT                   /protein_id="ADL06866.1"
FT                   /translation="MLLREGLKVLNEEINITGTLVWYYFICPRQVWLMSHNINPDEDDE
FT                   NVAIGRFLHQESYARERKEISFHGGKVDVLGTREGQLVIAEIKKSSKAERSAKMQLAFY
FT                   LFELRKLGIEAKGELRYLEEKRKEQIVLDEQLTREVENAITRILKLMYEPVPPKPEKIR
FT                   WCSNCAYREFCWA"
FT   gene            72005..72997
FT                   /locus_tag="Toce_0074"
FT   CDS_pept        72005..72997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0074"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="COGs: COG1518 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR019858:IPR002729;
FT                   KEGG: tpd:Teth39_0134 CRISPR-associated Cas1 family
FT                   protein; PFAM: protein of unknown function DUF48; SPTR:
FT                   CRISPR-associated protein Cas1; TIGRFAM: CRISPR-associated
FT                   protein Cas1; PFAM: CRISPR associated protein Cas1;
FT                   TIGRFAM: CRISPR-associated protein Cas1, HMARI/TNEAP
FT                   subtype; CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06867"
FT                   /db_xref="GOA:D9RZG9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZG9"
FT                   /protein_id="ADL06867.1"
FT                   /translation="MKKAIYIFSSGELKRKDNTLYLETEDRKNYIPVENTSEIYIFGEV
FT                   NINKRFLEFASQNQIIIHFFNHYDYYVGSFYPREFLNSGYMILKQAEYYLDKEKRLTIA
FT                   REFVRGAVKNILQVIRYYINRGKDLVKIDERIRELEGRIDDFNEIDELMAIEGNIRECY
FT                   YSSFDKILQNQDFKFCKRTTRPPKNNLNSLISFGNSMIYTIVLSEIYKTHLDPRIGFLH
FT                   ATNFRRFTLNLDVAEIFKPIIVDRVILTLIGRKVITKDDFEQDSEGLIIKEKAKREFIK
FT                   ELEEKLSTTFKHRQIGKNVSYRRLIRLELYKLEKHLMGEQEYSAFVAGW"
FT   gene            73019..73282
FT                   /locus_tag="Toce_0075"
FT   CDS_pept        73019..73282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0075"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /note="COGs: COG1343 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR021127; KEGG:
FT                   tit:Thit_2277 CRISPR-associated protein Cas2; SPTR:
FT                   CRISPR-associated protein Cas2; TIGRFAM: CRISPR-associated
FT                   protein Cas2; PFAM: CRISPR associated protein Cas2;
FT                   TIGRFAM: CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06868"
FT                   /db_xref="GOA:D9RZH0"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH0"
FT                   /protein_id="ADL06868.1"
FT                   /translation="MFIILVYDVGEKRVAKVLKICRKYLTWVQNSVFEGEITESAYKKL
FT                   KLELKRAIVEDEDSVIFYILRTIKYSDREMLGRKKGGEEIFL"
FT   repeat_region   73465..78148
FT                   /note="CRISPR"
FT   gene            78250..78561
FT                   /locus_tag="Toce_0076"
FT   CDS_pept        78250..78561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0076"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: swo:Swol_2510 transposase
FT                   IS3/IS911; PFAM: transposase IS3/IS911 family protein;
FT                   SPTR: Transposase IS3/IS911; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06869"
FT                   /db_xref="GOA:D9RZH1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH1"
FT                   /protein_id="ADL06869.1"
FT                   /translation="MKKKRYDREFKEQVVRECQEVGNIALVARGHGLSKNTVYNWLQAT
FT                   RKNGSVIPLPRDVNQRLLEAENRLESLARENDQLKRLVAEKELELAILRELRDRVNPQ"
FT   gene            78591..79515
FT                   /pseudo
FT                   /locus_tag="Toce_0077"
FT   gene            complement(79808..81028)
FT                   /locus_tag="Toce_0078"
FT   CDS_pept        complement(79808..81028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0078"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="COGs: COG3547 Transposase and inactivated
FT                   derivatives; InterPro IPR003346; KEGG: tit:Thit_1358
FT                   transposase IS116/IS110/IS902 family protein; PFAM:
FT                   transposase IS116/IS110/IS902 family protein; SPTR:
FT                   Transposase IS116/IS110/IS902 family protein; PFAM:
FT                   Transposase IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06870"
FT                   /db_xref="GOA:D9RZH2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH2"
FT                   /protein_id="ADL06870.1"
FT                   /translation="MDVVYSHVCGLDVHKKSVVACVITPDGKEIRSFSTMTDDLIALKE
FT                   FIKNKGCTVVAMESTGSFWKPIYNLLELENINILLVNAKHIKNVPGRKTDVKDAEWIAS
FT                   LLRHGLLKGSFVPDREQRELRELVRYRHSLVEERSRELNRIQKVLEGANIKLSSVVSDI
FT                   NGMSSHSILEALISGVDDPEILAELSHGKLKNKKEDLKRALKGFINYHQRKMLEIQLRH
FT                   IDYLDEEIERLDEEIKNRMLPFEEDLALLDTIPGVGRRNAEQIIAEIGTNMDQFPSAAH
FT                   LCSWAGLCPGQNESAGKRKSARTRKGNKKLRSALVEAARAASRAKDTYLSSQYHRIAAR
FT                   RGSNRAAVAVANSILTIVYHILKRRQPYIELGPNFYEEKRRNMVIRQSLKKLESLGLKV
FT                   TVETMVS"
FT   gene            81597..82370
FT                   /locus_tag="Toce_0079"
FT   CDS_pept        81597..82370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0079"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="COGs: COG1583 Uncharacterized protein predicted to
FT                   be involved in DNA repair (RAMP superfamily); InterPro
FT                   IPR010156:IPR002743; KEGG: tpd:Teth39_0121
FT                   CRISPR-associated Cas family protein; PFAM: protein of
FT                   unknown function DUF57; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   CRISPR associated protein Cas6; TIGRFAM: CRISPR-associated
FT                   protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06871"
FT                   /db_xref="GOA:D9RZH3"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH3"
FT                   /protein_id="ADL06871.1"
FT                   /translation="MRMKLTFNSESPVALPIHYNHIIQGMIYSNLTQEFAEFMHEDGFP
FT                   WGKRRFKLFTFSRLEGKFRMVEGGRIEFEPPFSFIVSSPLERFLRELAGGLLKNDDLSL
FT                   AGRRVVLENVTVHAAVEDHDLGDRIKINMLSPVVAYKTLVEGGKKRTLYLTPLQEEFGE
FT                   LLKNNLLKKYAVLTGQEPGERKFEIKPAFPLSEKHCKIIKYKDVIIKGWMGVYTLRGDP
FT                   ALLKIAYDAGLGSKNSQGFGCFEILEGLKRRSGAI"
FT   gene            complement(82600..82935)
FT                   /locus_tag="Toce_0080"
FT   CDS_pept        complement(82600..82935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hor:Hore_11230 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06872"
FT                   /db_xref="GOA:D9RZH4"
FT                   /db_xref="InterPro:IPR035287"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH4"
FT                   /protein_id="ADL06872.1"
FT                   /translation="MNLKQKLDELCTWVGIVGWVTTIAGAIEAIIGLFAYVIGALPGVI
FT                   TLILGIKLLGARKYAKSIALSQEYNEQDMVLLIKELTAYFKIQGLFIIIGFSAAIIVAL
FT                   SGFLLYQ"
FT   gene            83249..84472
FT                   /locus_tag="Toce_0081"
FT   CDS_pept        83249..84472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0081"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="COGs: COG3547 Transposase and inactivated
FT                   derivatives; InterPro IPR003346; KEGG: pth:PTH_2606
FT                   transposase; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; SPTR: Hypothetical transposase; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06873"
FT                   /db_xref="GOA:D9RYI8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYI8"
FT                   /protein_id="ADL06873.1"
FT                   /translation="MFYGGIDVAKHSHEVCLVNDSGDIVLKMHLDNNHKGMNKLLQALE
FT                   RLGLKPDDVKFCLEATGHYWLPIYCYLTNQGFELHVINPIQSDALRNLYVRKTKTDQKD
FT                   ALLLADLLRLGRAPETRLPSETTLKLQSLSRLRFEFVRQVGGLKNRVLGILDRIFPEYP
FT                   DCFSDVFIRTSRELLKSYPEPEELAEVDLSELSAFLKEHSRGRFGEERAKKIQSLAKGT
FT                   FGITMALDAFTLQLRLLVEQIEFIEEQIKVIEDAINEVMEELRPSKDTPYRHVIETIPG
FT                   IGPVLAAAIIGEIGDISRFPNPRALVAYAGLDATVRASGLFEGTRNRMSKRGSPVLRNS
FT                   LWLAAVSARRFNPELRAYYEQKRSQGKHSNVATGAVARKLVHLIYSLWKDNRPYDPDYQ
FT                   WSPPGKNA"
FT   gene            84877..85107
FT                   /locus_tag="Toce_0082"
FT   CDS_pept        84877..85107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001455; KEGG: chy:CHY_0625 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06874"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH6"
FT                   /protein_id="ADL06874.1"
FT                   /translation="MTEYLIDSLGDMCPVPNLKVQAKIKKLRPGDRIVILTDHSCAVTT
FT                   IVDEMKRKRLKTKVEEVENGVWRVVISMAAR"
FT   gene            complement(85104..86006)
FT                   /locus_tag="Toce_0083"
FT   CDS_pept        complement(85104..86006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0083"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119; KEGG: chy:CHY_0628 LysR family
FT                   transcriptional regulator; PFAM: LysR substrate-binding;
FT                   regulatory protein LysR; SPTR: Transcriptional regulator,
FT                   LysR family; PFAM: Bacterial regulatory helix-turn-helix
FT                   protein, lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06875"
FT                   /db_xref="GOA:D9RZH7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH7"
FT                   /protein_id="ADL06875.1"
FT                   /translation="MNINLLKSFIAIAETQSLSRAAERLFVTQPALSQQIKQLENHFSV
FT                   QLIERTNRGILLTEAGRILYDYASRIVSIYEDLEKNMEDFRASISGTLIVGASSIVGGY
FT                   AVPCSIFIFKEKYPETNIKLKVGNRKYILEELRDGAIDVAIIEGEKPIGNFVSSEIASD
FT                   EMVVIAPNREPWNGKDTLSPEEFLSQPIIMREDGSGTRQMIEKCLMQAGIDKSRLNIVM
FT                   ELSSADSIKAAVEAGHGISIMPRLAVRKELYNKTLVALKIEGVPLVQKIHLAYKREKVK
FT                   SQAAKAFIKFMHTPNRGFC"
FT   gene            86124..86765
FT                   /locus_tag="Toce_0084"
FT   CDS_pept        86124..86765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0084"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: tex:Teth514_0045 protein
FT                   of unknown function DUF395, YeeE/YedE; PFAM: protein of
FT                   unknown function DUF395 YeeE/YedE; SPTR: Putative
FT                   uncharacterized protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06876"
FT                   /db_xref="GOA:D9RZH8"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH8"
FT                   /protein_id="ADL06876.1"
FT                   /translation="MKESTITRRKNQLPYAMALLLTLVIFGIYLSRAGKILTVRWIFGI
FT                   AFGFVLQRSRFCFTAAVRDPILTGNTSLFRAVIIAIAVAMVGFSSIQFAAHLSGYPVPG
FT                   MIKPAGVHTLLGGIIFGIGAVLSGGCASGTLMRVGEGHLLNLIALVFFIAGSAAGAYHF
FT                   GWFKEHIIKSARPVFLPDLMGWGAAFFGQLALLFILYRLALWWDYKSRAQ"
FT   sig_peptide     86124..86225
FT                   /locus_tag="Toce_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            86790..87344
FT                   /locus_tag="Toce_0085"
FT   CDS_pept        86790..87344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0085"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: tit:Thit_0078 protein of
FT                   unknown function DUF395 YeeE/YedE; PFAM: protein of unknown
FT                   function DUF395 YeeE/YedE; SPTR: Putative uncharacterized
FT                   protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06877"
FT                   /db_xref="GOA:D9RZH9"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZH9"
FT                   /protein_id="ADL06877.1"
FT                   /translation="MKNMEFYKEKLKRFADVILKEPFPYWFGAIVLGILNVCLLAVSGE
FT                   PWRITSYFAHWGAWVARAFGARPEFWAFYGERENAAALADGFLRDGGSVQNLGIIAGAM
FT                   LAALLASQFRFRKIKSYKQVIGAVIGGFLMGYGARLSFGCNIGALFSGISSMSLHGWIF
FT                   MAGMLAGAYLGSRLLIKFFLY"
FT   gene            87455..90004
FT                   /locus_tag="Toce_0086"
FT   CDS_pept        87455..90004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0086"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0493 NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductase; InterPro
FT                   IPR013027:IPR004017:IPR000759:IPR017900; KEGG: vpa:VP1199
FT                   putative glutamate synthase, small chain; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; protein of unknown function DUF224
FT                   cysteine-rich region domain protein; SPTR: Pyridine
FT                   nucleotide-disulphide oxidoreductase family protein; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase;
FT                   Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06878"
FT                   /db_xref="GOA:D9RZI0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI0"
FT                   /protein_id="ADL06878.1"
FT                   /translation="MYPAEVLEKMKEIVDNCMGDAPAYCVATCPMHTDARGYIKLISEG
FT                   RYKEAIKLIREKLFLPATLGRICAHPCEQKCKRNEVGHQPMSIAALKRFAAEYDDPSDW
FT                   DLSMEPEKDIKIAVIGSGPAGAQAAIDLRRKGYKVTIFEKLPVAGGMLRVGIPEYRLPR
FT                   DILEKEYSYLTKLGIEIRLNTEVGKDVAFGDIRDNYDAVLIAVGAHRSVMLPVPGIDLK
FT                   GVIPAVDFLREVSMTRKYPVGKRVAVIGGGNVAMDVARSLIRVGAKKVDVFCLEKREQM
FT                   PAHSWEVEEAEEEGVVIHNGWGPKEIVGEDGKVKKIVFKACESVFDKEGRFNPCYDESK
FT                   LYEIEADNVVLAVGQTADSSFLADTGIELLKNGKVKADPVTLETSLKGVFAAGDAVGRP
FT                   LFAIEAMAEGRKAAVSIDRYLKGEDLRAGREFEGAYETWLEKDVSAEQFLPRVQTMKLS
FT                   PEERIKGFMEVDLGFTEEMARKEAERCLQCECRLCVKECLMLQDFTHCPKELFKEILDT
FT                   GKVNPLVPYSCNMCNKCTLECPKEFRLADRFSEIRKELVKQGIGPLKQHRPILMHQKFS
FT                   FSRIFNVTLPDKKAGFTRRIFYPGCSLPSYNPEAVGRIYEYLKEKLPGTGAILKCCGKP
FT                   TKALGQEELFKQRSAMVVEEVRRLGAEEVITACQSCYKTLSEYLPKHIPGIKVRSLWVV
FT                   LKEIGLPEKARGIAKNSGMTVAIHDSCVTRDVPEIHDAVRFIVSELGYGIEELPNSRGN
FT                   TRCCGYGGMVVPANPELAKRVMQRRANEAKCEYIATYCAACRASMVMGGKKGLHLLDLI
FT                   FGGDWRGKETPGVDSTLQSWSKRWKTKKILTRIANKK"
FT   gene            90024..90980
FT                   /locus_tag="Toce_0087"
FT   CDS_pept        90024..90980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0087"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG2897 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763:IPR001307; KEGG: ttr:Tter_1312 rhodanese
FT                   domain protein; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein; SPTR: Thiosulfate
FT                   sulfurtransferase; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06879"
FT                   /db_xref="GOA:D9RZI1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI1"
FT                   /protein_id="ADL06879.1"
FT                   /translation="MRKIVALALILLLAVSLAACSQQKSATAPAKFLTGKEKGYANPEA
FT                   IITPQELKELIDKNAVKIIDARPEDRYAKEHIPGAVRAWRNEYNDPTHKYEGMRATPEQ
FT                   FAQLMSKLGIANGDLVVVYGDAEKHSPADAARVWWLFKLYGDNKVRILDGGIEAWKAAG
FT                   FETTKELPQVTETKYEVKVDTSLLAEVEDVLAGQNNPDVIILDTREEAEFLGKQKVKGA
FT                   ARAGRIPGAVWLYWGDALNEDKTLKSYDELKKLYEEKGVTPDKTVIPYCQSAVRSAHAT
FT                   FVMTELLGYKNVKNYDGSWVEWSQRTDLPIETGEPKN"
FT   sig_peptide     90024..90086
FT                   /locus_tag="Toce_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            91044..91757
FT                   /locus_tag="Toce_0088"
FT   CDS_pept        91044..91757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0088"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG0398 conserved hypothetical protein;
FT                   InterPro IPR015414; KEGG: vfi:VF_A0098 inner membrane
FT                   protein; PFAM: SNARE associated Golgi protein; SPTR:
FT                   Putative membrane protein; PFAM: SNARE associated Golgi
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06880"
FT                   /db_xref="GOA:D9RZI2"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI2"
FT                   /protein_id="ADL06880.1"
FT                   /translation="MSQKVVRMHGSGKDGRMKLLITVACIAVVAFVLKKLGVVQYLSLE
FT                   NTAKLKDWIAGYGALGPVIYIALFVTACIFFLPGLPIGVLGGVAFGPVKGALFASIGAT
FT                   LGATAAFLIARYAARSMVESWVEKNPQLKKLDEGVRQQGWRMLMITRLVPIFPFNLQNY
FT                   AYGLTDIPLLTYIVVSFLCMLPGTIAYTFAGGTLTSGGDIKKILTYLGIAAVFFVMLSL
FT                   IPGWIRKKHGGNLGI"
FT   gene            91770..92366
FT                   /locus_tag="Toce_0089"
FT   CDS_pept        91770..92366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0089"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="InterPro IPR000462; KEGG: amt:Amet_3296 CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; SPTR: CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06881"
FT                   /db_xref="GOA:D9RZI3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI3"
FT                   /protein_id="ADL06881.1"
FT                   /translation="MLDTGARKFFQPYFTKLARMLVWLGLTPNAVTAAAFAMGLLGAAA
FT                   LYFDLREEALVLLWLSGLADVLDGTVARLTGRSSPFGALLDLIFDRIVEMGYITVMAAR
FT                   MPEARMASIFLLCSIIFSFSVFLASGALISKKTEKAFYYQPGLAERTETFLVFSLAILM
FT                   PQSTALIFNIFTAMIVFTGIQRMAEVYGYLKKLQG"
FT   sig_peptide     91770..91868
FT                   /locus_tag="Toce_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            92369..93625
FT                   /locus_tag="Toce_0090"
FT   CDS_pept        92369..93625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0090"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG4134 ABC-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR006059; KEGG:
FT                   amt:Amet_3295 putative ABC transporter solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Extracellular solute-binding protein, putative;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06882"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR027020"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI4"
FT                   /protein_id="ADL06882.1"
FT                   /translation="MVRKALIIVLVAVLVVAAGLAGCDTKEVKDTGDIQKKSWEQILAE
FT                   ARGTTVNFYGWGGDQRINKWLDEVVAPRLEDKYGIKLNRVGMDIDEILNKLLGEKQAGR
FT                   EKGSIDVVWINGENFYTARKNGLLFGPFTSMLPNFQKYVNPDDPEVKNDFGYPIEGYEA
FT                   PYGRAQLVLTYDSTRLPESEVPKDHKALLELAKKYPGRITYPAPPDFTGSAFVRNIICD
FT                   VIGRDKLEGLDPGDKKAVEEAISPAIEYLRELKLYLWKNGESYPATLAQLNNMFADGEV
FT                   LISMDYAPYAAAGKVKTGEFPPTVRSFVFEKGTLGNTHYLAIPFNAPNKAAALVFINYI
FT                   LSPEVQASKNDPANWGDLPVIDFDRLSTEERKLFEDIKLGEAALPGDYLQAHRLAEPDA
FT                   SLIPVIEEIWVEKVLKEGK"
FT   sig_peptide     92369..92434
FT                   /locus_tag="Toce_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            93627..94484
FT                   /locus_tag="Toce_0091"
FT   CDS_pept        93627..94484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0091"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   amt:Amet_3294 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06883"
FT                   /db_xref="GOA:D9RZI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI5"
FT                   /protein_id="ADL06883.1"
FT                   /translation="MNGERLRPYVMLAPVLLVEAWLIFTGIHTAFEQSLGHFPAAGLSG
FT                   YSLKFYIAVLKNPDFLKSLVFSFYVAFVSSALAVILGIFLAVLLVHSPRKENLSNYLYR
FT                   LPIIVPHTIAVLLVLSILSSSGILPRLLYALGLLSAENAFPGMVFDRAGIGVILTYLWK
FT                   GTPFATFMVYTILKNTNPGLFEAALSLGAGRWEAFYYVVLPLLKPAVIPSFLFLFAYAF
FT                   GSWEVPYLIGPTHPRALPVLAYTYYVSPELSARPYAMAVNMVMVAVSFILIYIYSRQMA
FT                   RAGW"
FT   gene            94486..95286
FT                   /locus_tag="Toce_0092"
FT   CDS_pept        94486..95286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0092"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1177 ABC-type spermidine/putrescine
FT                   transport system permease component II; InterPro IPR000515;
FT                   KEGG: amt:Amet_3293 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06884"
FT                   /db_xref="GOA:D9RZI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI6"
FT                   /protein_id="ADL06884.1"
FT                   /translation="MERRFVNLLLHAAIGVMIFPMAVLVLWAFAREWPWPHLFPTGFSV
FT                   RGWVHLLNPCTGVLPVLLYSVLLSSVVAFLTVIFSLPAARALAFHEFRGKRAIEIFVLS
FT                   PMVIPTTAIAMGIHVNFIRIGLADTFWGVVLAHLLLCLPYGIKILTGVFEALGDRIEQQ
FT                   ARVLGAGWLETYIYVTLPLISPGLVTAGIMAFVVSFSQYFLTFLIGGGRVVTFSMLLFP
FT                   FIQGGDRHLSAVFSLAFIGTVLIWVFALEALVKRWVKKGQYFYT"
FT   sig_peptide     94486..94575
FT                   /locus_tag="Toce_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            95305..96336
FT                   /locus_tag="Toce_0093"
FT   CDS_pept        95305..96336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0093"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR013611:IPR003593:IPR017871; KEGG:
FT                   amt:Amet_3292 ABC transporter related; PFAM: ABC
FT                   transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase; SPTR: ABC transporter related;
FT                   PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06885"
FT                   /db_xref="GOA:D9RZI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI7"
FT                   /protein_id="ADL06885.1"
FT                   /translation="MAEIRVENVSKAFGGEKIIKDISFEVAGGQLLSLLGPSGAGKTTL
FT                   LKIIAGLLKPDAGEIYFDGVPVVKVPVEKRGAVLVFQDYLLFPHMTVEQNVAFGLRMAG
FT                   VPRYKRARIVAEMLALVDMKGYEHKYPHELSGGQKQRVALARALAVKPRVLLLDEPFSN
FT                   LDPRLRESMREFTRDLQRRMEMTTILVTHDWEEAFMMSDRIAVLIDGSIKQVGTPEEVY
FT                   FRPASLEVAEFLGDKKNYVKGMVKNGVFFCPLGNLPAPQAADGDYTAVIRPEHVRISPG
FT                   GERAGWTICDTRFAGGCVYYRVFREGLSLLCAADNTVIYRPGEKVDVSVDFSKAILFRT
FT                   GFD"
FT   gene            96442..96762
FT                   /locus_tag="Toce_0094"
FT   CDS_pept        96442..96762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100065379 hephaestin; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06886"
FT                   /db_xref="GOA:D9RZI8"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI8"
FT                   /protein_id="ADL06886.1"
FT                   /translation="MKKWIRAMLLSLLGYILMEAGRSFNREVKGKGKTRVDLSPLYLAG
FT                   ILLVLMAAGVVLLELWPLIALGGLAWYLYKSRKKIPDTGRKGEDGSIDMEYDERTGTWK
FT                   RS"
FT   sig_peptide     96442..96516
FT                   /locus_tag="Toce_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            96835..98001
FT                   /pseudo
FT                   /locus_tag="Toce_0095"
FT   gene            complement(98004..101189)
FT                   /locus_tag="Toce_0096"
FT   CDS_pept        complement(98004..101189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0096"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0587 DNA polymerase III alpha subunit;
FT                   InterProIPR004805:IPR004013:IPR011708:IPR004365:IPR
FT                   003141:IPR002226; KEGG: adg:Adeg_0434 DNA polymerase III,
FT                   alpha subunit; PFAM: DNA polymerase III alpha subunit; PHP
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; PRIAM: DNA-directed DNA polymerase;
FT                   SMART: phosphoesterase PHP domain protein; SPTR: DNA
FT                   polymerase III, alpha subunit; TIGRFAM: DNA polymerase III,
FT                   alpha subunit; PFAM: Bacterial DNA polymerase III alpha
FT                   subunit; PHP domain; OB-fold nucleic acid binding domain;
FT                   TIGRFAM: DNA-directed DNA polymerase III (polc)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06887"
FT                   /db_xref="GOA:D9RZI9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZI9"
FT                   /protein_id="ADL06887.1"
FT                   /translation="MAFCHLHVHSEYSLLDGLCRLPLLVKKAAELAMPALALTDHGGLY
FT                   GMVPFYRLCLEAGIKPILGCEVYVVEDVTCRWGKESFHHLVLLSENQEGFKNLLSLVTR
FT                   SHVDGFYYRPRVDKKLLASHAKGLIALSGCIRGQVADLILRGDVKAAEEAAKEYADIFG
FT                   RDNFFLELQYHGLAAEKKANFWMRSIAERLGIGLVATNDVHYLQPSDAGTHRVLLAVQT
FT                   LSALGEAASLPGNQHYLKSPAEMEALFREIPGALENTVAIAERCDVRLPLGGTKLPEIA
FT                   LPEGVSADDYLRKLCFQGAAARYGRPLPQEVKDRLNYELSVIKKTGYAGYFLIVKDIVD
FT                   FARKRGIIVGAGRGSAAGSLAAYVLGITDVDPLKYGLIFERFLNPERISPPDIDIDLCH
FT                   LGRREVLEYIRHRFGRERIAHVGAFSTLQARAALRDTGRALGLAYEKIDAACSRIPYSH
FT                   INLEDALKESPHLSSLVKNDAGVRRAFAIARKLQGLPRHMTQHSAGVAIADRPLTEYVP
FT                   LQRASGEEIITQADMYALEELGLVKIDLLGLRFLTVIGETLKLVRDRYGIDMKPEEIPL
FT                   DDEKTYMVLARGDTGGCFQLESGGMRKMLRRIKPKNIEDLSAVLALYRPGPLKSGMAEE
FT                   FIARRQGIKPVSYIHPALEPVLRDTYGVFVYQEQLMQAACLISGYTPGEADLLRRAIAK
FT                   KKKDEIEREKPRFLKRAVERGIDEKTAGELFATLEAFGDYGFNKSHSISYAVMAYRTVY
FT                   LREHFPLEYFASLFNLYMDTPSRLQLYLCEARRREIRLLLPDINMSGAGFVPEGGPHQR
FT                   AIRAGLALIKNLGPRGMEEILQAREDCPFTGFFDFCRRVDRRVINARALESLVFSGAFD
FT                   SFGIPRPALIISLKWMLSGCSGRPQNQLCLLNENPDVEALAADLSVADFTPSQKMAQEM
FT                   MSMGYYITAHPMEFIKGRPEETCTHTASDVEEIGEKQRVRISGILLDLRSGRTRSGERM
FT                   LFARLEDLTGSVELVIFPRQLRLFAPWIYVGSVVLVEGWVDLNDDGHRTVVAEEIRPLT
FT                   GCDLTTSREGRCP"
FT   gene            101353..101766
FT                   /locus_tag="Toce_0097"
FT   CDS_pept        101353..101766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0159 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06888"
FT                   /db_xref="GOA:D9RZJ0"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ0"
FT                   /protein_id="ADL06888.1"
FT                   /translation="MVQRVGYGVAAGLISALISLVFNTRLAGAVKEEAVTLGAPVLEEI
FT                   IKTGLAALLGGDILSSHVAFGAVEAFYDAARSWSRRSCLAGALALLSHAFFGAAAVMTA
FT                   DRSGNLAAGIFISALLHIGWNGWVMGNRVQSKK"
FT   gene            101812..102720
FT                   /locus_tag="Toce_0098"
FT   CDS_pept        101812..102720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0098"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /note="COGs: COG5401 Spore germination protein; InterPro
FT                   IPR019606; KEGG: adg:Adeg_1491 lipoprotein LpqB, GerMN
FT                   domain protein; PFAM: Lipoprotein LpqB, GerMN domain; SPTR:
FT                   Spore germination protein-like protein; PFAM: Sporulation
FT                   and spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06889"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ1"
FT                   /protein_id="ADL06889.1"
FT                   /translation="MMKKITAVCLLLCLLAILAACMPGKRTARINLYYNNEDNSEILVE
FT                   ERTVQMPRGKTLSQVAVEELLKGPTKEGLKSNIPKGTRLLELKVDNKQATVNFSKEFAR
FT                   FPGVMAESFVVISVVNTLADLPEIEKVLILVEGKELIAPSGNPYGPLGRYDIEKINRDL
FT                   NKVAVTLYFTGENAMYLEPEVREVQKDGRPLEQIVVEELIKGPTKPGLFRTIPEGTKLL
FT                   SIEVKDGIAYVNFSKEFKENHWGGSTGEAHTINSVVNSLTELPGIEKVQFLIEGKKEDT
FT                   LAGHMIFDEPFSRNENIIKKE"
FT   sig_peptide     101812..101895
FT                   /locus_tag="Toce_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            102939..106472
FT                   /locus_tag="Toce_0099"
FT   CDS_pept        102939..106472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0099"
FT                   /product="transcription-repair coupling factor"
FT                   /note="COGs: COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase);
FT                   InterProIPR004576:IPR003711:IPR011545:IPR001650:IPR
FT                   005118:IPR014001:IPR014021; KEGG: tte:TTE2565
FT                   transcription-repair coupling factor; PFAM: transcription
FT                   factor CarD; DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; TRCF domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR:
FT                   Transcription-repair coupling factor-superfamily II
FT                   helicase; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: Helicase conserved C-terminal domain; TRCF domain;
FT                   CarD-like/TRCF domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   transcription-repair coupling factor (mfd)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06890"
FT                   /db_xref="GOA:D9RZJ2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ2"
FT                   /protein_id="ADL06890.1"
FT                   /translation="MDIDFLSREITEFNKLAGDLEKGLSGLFAYGLSDSQRAFLIAAVR
FT                   KRFPKPVLVVTADSLDARKLADDLAYFLGTEDVEMFPASSVIPYETAARSPELTAQRLK
FT                   VMESLVTGKQPVVVSPLQALTNRMMPPDVVKKFTIKLRVGDSIPLEEAVLKLSFMGYER
FT                   VDTVEGRGQFAVRGGILDVYPLTAENPYRMEFFGDEVDSIREFSVEDQRSMDKLEEVFI
FT                   FPAREVVFDRETAKNAAISIARELEDRKKAFELTGSAQIAAQLEEKILEHIEKLENGQF
FT                   FESAQHYISHFYSNLSALTDYFTLPPLVILVEPGKIVESTKNSAFEIEETYKGLLEKGE
FT                   VLPSVSEMYFTPFDILENLRKSKTVYISMLPRIPGEFEIGGLYSFQFRSVTSFHGKVDL
FT                   LAEEVAHFKKKGYRVVILSGTGERGKHLSRTLREKALDAAFYGTLGDELLPGQVVITPG
FT                   SLEKGFQIPEIKFALISDLDVYGQPKIKQKRPKVRAGGKRITSIDELSAGDYVVHITHG
FT                   IGRYLGIETLEVEGHKKDYFAIQYAGGDKLYVPTDQVEMLHKYVGPEDRPPKLNKLGSS
FT                   EWAKAKTRVKESVKEMAKELLELYAARQAMKGFAFSPDTVWQKEFEDLFPYEETPDQLT
FT                   AIEEVKRDMESDKCMDRLLCGDVGYGKTEVALRAAFKAVMDAKQVAVLVPTTILAEQHY
FT                   RTFSERFAPFPVRVEVISRFKSKAEQKAIIKDLKNGAIDIIIGTHRLLQKDVKFKDLGL
FT                   LIIDEEQRFGVSHKEKIKQLKKNVDVLTMTATPIPRTLHMAMTGIRDMSVMETPPENRY
FT                   PIQTYVVEYSDSLIRDAIMRELSRGGQVYYVYNRVNTIYEEAKRLSALVPEARIAVAHG
FT                   QMHENELEEVMMDFYEHRYDVLVCTTIIETGLDIPNVNTLIVISADRFGLSQLYQLRGR
FT                   VGRSSTQAFAYFTYKKDKTLSEAAEKRLAAIRDFTEFGAGFKIALRDLEIRGAGNILGT
FT                   EQHGHMMTVGYDLYCKLLAEAVRELRSEPEPEEVQPVIDLKLSAYIGDDYIPNAAQKID
FT                   IYRRIAAVETLEEADDLEEEIEDRFGDIPEPTRNLLFVARLKVLAKKLKLSSIIQQNDI
FT                   ITFKFQSANALSPEQFFALSAAFQNRVNFLGTTVPAFTFKVRNLSGYKLFLRIQKLLEE
FT                   MVEFLQLPSNE"
FT   gene            106541..107107
FT                   /locus_tag="Toce_0100"
FT   CDS_pept        106541..107107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0100"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="InterPro IPR014213:IPR006339:IPR007159; KEGG:
FT                   pth:PTH_0119 regulators of stationary/sporulation gene
FT                   expression; PFAM: SpoVT/AbrB domain protein; SPTR:
FT                   Regulators of stationary/sporulation gene expression;
FT                   TIGRFAM: stage V sporulation protein T; transcriptional
FT                   regulator, AbrB family; PFAM: SpoVT / AbrB like domain;
FT                   TIGRFAM: looped-hinge helix DNA binding domain, AbrB
FT                   family; stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06891"
FT                   /db_xref="GOA:D9RZJ3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ3"
FT                   /protein_id="ADL06891.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDREGEVI
FT                   LKKYSPIGELAEFAKEYTEALHDSLGHIACIADRDAIIAVSGTPKKELMDKPLSSSMEA
FT                   ILEERKPVLIARTNEKEYVRITADDEDGKVRYTSQVIVPIIADGDPIGAVILLTKDPNV
FT                   AMGELELKVAETAAGFLSRQMNIYQ"
FT   gene            complement(107171..108739)
FT                   /locus_tag="Toce_0101"
FT   CDS_pept        complement(107171..108739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0101"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="COGs: COG1866 Phosphoenolpyruvate carboxykinase
FT                   (ATP); InterPro IPR001272:IPR015994; KEGG: tte:TTE1783
FT                   phosphoenolpyruvate carboxykinase; PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); SPTR:
FT                   Phosphoenolpyruvate carboxykinase [ATP]; TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   Phosphoenolpyruvate carboxykinase; TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06892"
FT                   /db_xref="GOA:D9RZJ4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ4"
FT                   /protein_id="ADL06892.1"
FT                   /translation="MDNLKFPLLANLRKVHFNLPVPRLVEEAVTRGEGVLASNGALIVR
FT                   TGKYTGRSPNDKFIVDEPSVRDEIWWGNNRPFPPDKFDALLRRMAAYLQNRDVFVFDGF
FT                   VGADPKYRMPLRVVTEYAYQNFFSRQLFIRASGEELKDFQPEITVISAPGFKAQPEIDG
FT                   TNSEAFIILSLEKRMVLIGGTFYSGEIKKSVFTLLNYIMPKAGVLSMHCSANMGRDGST
FT                   ALFFGLSGTGKTTLSADPERLLIGDDEHGWSNEGIFNFEGGCYAKCINLSREMEPQIYD
FT                   AIKFGAVLENVVYDEATREPDYKSDAITENTRAAYPVDYIPGAVIPGIGGHPRTVIFLT
FT                   ADAFGVLPPIARLSIEQATYYFISGYTSKLAGTERGITEPQATFSACFGAPFLPLSPIT
FT                   YAELLGEKIKKYKAEVFLVNTGWSGGPYGVGQRMELTYTRAMVRAALSGKLSDIEYEQD
FT                   PVFGLMIPRACPGVPPEILNPKNTWHDKKAYDETVRKLARNFADNFKKFSSQWPHAAAA
FT                   GPRLV"
FT   gene            109056..110663
FT                   /locus_tag="Toce_0102"
FT   CDS_pept        109056..110663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0102"
FT                   /product="stage V sporulation protein B"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; InterPro
FT                   IPR014249:IPR002797; KEGG: amt:Amet_0163 polysaccharide
FT                   biosynthesis protein; PFAM: polysaccharide biosynthesis
FT                   protein; SPTR: Polysaccharide biosynthesis protein;
FT                   TIGRFAM: stage V sporulation protein B; PFAM:
FT                   Polysaccharide biosynthesis protein; TIGRFAM: stage V
FT                   sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06893"
FT                   /db_xref="GOA:D9RZJ5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ5"
FT                   /protein_id="ADL06893.1"
FT                   /translation="MTEKRNSFLKGAIILTAAGFLVKILGAVYRIPLAMMIKDEGMGLY
FT                   QMAYPIYVTLLAVSTAGLPTAISKMVAGDVAVKRYRNAYKVFKVSLIILTLVGAVLTVA
FT                   LMLSARVLSEKVLGNPKAFYPLISISPAIFFVSVMSCFRGFFQGMQDMTPSAMSQIIEQ
FT                   VGRVVTVFVLATLLLPKGVEYAAAGAAFGPVVGAIAGLLLLVAVYRKRKRDLFDSFGAG
FT                   SDAELENPVHIAWRLFAFAIPITLGGLIIPVMNLADAAIVTRRLQDAGFSVTRATELYG
FT                   QLTGMAAPLINLPAVMTMSLAASLVPAISEAVALKNARMVASRAETAVRVTFMFALPAA
FT                   MGLFILAEPVSEMLYKNPQAGIPLSILSWGIIFLALQQTTTGVLQGMGKTGIPVTNLAV
FT                   GALFKVFLNYTLTAIPVINIKGAALGTVVGYLISSLLNFVSSMKWTGMALDVKRMIVKP
FT                   LLATAVMGGVVYYCYEAMSAAGTGNSAATLAAVGMGAFIYPLLLLAMGGLGEEELSLIP
FT                   GGSRVIRWLQKMGVIRRR"
FT   gene            110671..111456
FT                   /locus_tag="Toce_0103"
FT   CDS_pept        110671..111456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0103"
FT                   /product="MazG family protein"
FT                   /note="COGs: COG3956 Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain; InterPro IPR011551:IPR004518;
FT                   KEGG: tpd:Teth39_0248 MazG family protein; PFAM: MazG
FT                   nucleotide pyrophosphohydrolase; SPTR: MazG family protein;
FT                   TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase domain; TIGRFAM: MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06894"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ6"
FT                   /protein_id="ADL06894.1"
FT                   /translation="MRYSMKDLINIMARLRGEHGCPWDKAQTHETLKPFLLEEAYEVID
FT                   AIDGGDPGELSEELGDLLLQIVFHSRIAEENGRFCFDDVVDGICKKMVRRHPHIFGDLK
FT                   VSGTADVLKNWEDIKKEEKEVKSYAETMDKVPETFPALMRAYKVQEKAARVGFDWENVD
FT                   GALEKVYEELQELKEVYKSGNGEKIREEIGDLLFAVVNVARFLSVNPELALREATRKFI
FT                   RRFKYVEEAATKIDKKLHEMTLEDMDRLWNEGKIKEKKL"
FT   gene            111544..111819
FT                   /locus_tag="Toce_0104"
FT   CDS_pept        111544..111819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0104"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119:IPR020816; KEGG: ate:Athe_0648
FT                   histone family protein DNA-binding protein; PFAM: histone
FT                   family protein DNA-binding protein; SMART: histone family
FT                   protein DNA-binding protein; SPTR: Histone family protein
FT                   DNA-binding protein; PFAM: Bacterial DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06895"
FT                   /db_xref="GOA:D9RZJ7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ7"
FT                   /protein_id="ADL06895.1"
FT                   /translation="MNKAELVSVMAEKSGLTKKDSEKALNAFIEAVSEALSKRDKVQLV
FT                   GFGTFEVRERSQRKGRNPQTGEEIDIPAASIPAFKAGKALKDSINK"
FT   gene            111951..112922
FT                   /locus_tag="Toce_0105"
FT   CDS_pept        111951..112922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0105"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="COGs: COG2385 Sporulation protein and related
FT                   protein; InterPro IPR013486:IPR013693; KEGG: aoe:Clos_2635
FT                   SpoIID/LytB domain-containing protein; PFAM: Stage II
FT                   sporulation D domain protein; SPTR: SpoIID/LytB domain;
FT                   TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation protein; TIGRFAM: SpoIID/LytB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06896"
FT                   /db_xref="GOA:D9RZJ8"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ8"
FT                   /protein_id="ADL06896.1"
FT                   /translation="MRHKILKVQALIIIVAILLSGCAVRRPDDKKPLVPKIPDKISRGE
FT                   GREPQLTVYEVQTKTRKKMNLEDYVAGVVAGEMENNWPVEALAAQAILARTYVLEFVTD
FT                   KGESKYGDADISTDFEEAQAWNPSKINDRVKKAVQMTRGKVITYRGKYVKAWFHSHSGG
FT                   MTATPKEGLNYKEEEPPYITIVKSPDENAGPEGKRTWSATFTKEELRRAIKEKLGQDTG
FT                   SIDEVSVVERGPSGRATKIKIGNATVPAPDLRTALDPMRMRSTLLTSLRIEGEKVIMEG
FT                   KGFGHGVGLSQWGAHVLARQGKSPEEIIKYYFKGVDIVKLWD"
FT   gene            112992..113273
FT                   /locus_tag="Toce_0106"
FT   CDS_pept        112992..113273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0106"
FT                   /product="sporulation protein YabP"
FT                   /note="InterPro IPR012504; KEGG: nth:Nther_0072 sporulation
FT                   protein YabP; PFAM: YabP family protein; SPTR: Sporulation
FT                   protein YabP; TIGRFAM: sporulation protein YabP; PFAM: YabP
FT                   family; TIGRFAM: sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06897"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZJ9"
FT                   /protein_id="ADL06897.1"
FT                   /translation="MDEKKSTKHRLTLQDREILEIDGVLNVEKFTDEDIILSTEKGMLN
FT                   IKGEKMHMKQLNLDQGLIVVEGFVKMLAYTEEASAAEKGKGLLNRLFR"
FT   gene            113304..113741
FT                   /locus_tag="Toce_0107"
FT   CDS_pept        113304..113741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0107"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="InterPro IPR014242:IPR019074; KEGG: cth:Cthe_2660
FT                   hypothetical protein; PFAM: Spore cortex biosynthesis
FT                   protein, YabQ-like; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: spore cortex biosynthesis protein YabQ; PFAM:
FT                   Spore cortex protein YabQ (Spore_YabQ); TIGRFAM: spore
FT                   cortex biosynthesis protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06898"
FT                   /db_xref="GOA:D9RZK0"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK0"
FT                   /protein_id="ADL06898.1"
FT                   /translation="MNTVEVDTQLIFLAGALASGAVAGLAFDVYRRLRNYWRPGPFLTA
FT                   LGDLAYWALTAAITFYVTYRINYGQVRGYLFLGFGVGLLLYITAVSPRVIRIFLILERT
FT                   FSKIFILPGKVFRRITGFKAVRLVKRILSDARRVFSKIKKG"
FT   sig_peptide     113304..113381
FT                   /locus_tag="Toce_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            113805..114092
FT                   /locus_tag="Toce_0108"
FT   CDS_pept        113805..114092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0108"
FT                   /product="Septum formation initiator"
FT                   /note="InterPro IPR007060; KEGG: tye:THEYE_A1003 septum
FT                   formation initiator family protein; PFAM: Septum formation
FT                   initiator; SPTR: Septum formation initiator family protein;
FT                   PFAM: Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06899"
FT                   /db_xref="GOA:D9RZK1"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK1"
FT                   /protein_id="ADL06899.1"
FT                   /translation="MGGKKQFKLGRIIFVLFLVYFVYTFTVQQFKINELRRQELELSQK
FT                   MNQLAEERKRLEKEIELLNTKSYIEKLARDQLGLVKPGEILYKISPSRDD"
FT   gene            114171..114548
FT                   /locus_tag="Toce_0109"
FT   CDS_pept        114171..114548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0109"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="COGs: COG1098 RNA binding protein (contains
FT                   ribosomal protein S1 domain); InterPro IPR003029; KEGG:
FT                   pth:PTH_0189 RNA binding protein; PFAM: RNA binding S1
FT                   domain protein; SPTR: Predicted RNA binding protein; PFAM:
FT                   S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06900"
FT                   /db_xref="GOA:D9RZK2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK2"
FT                   /protein_id="ADL06900.1"
FT                   /translation="MPVDVGQIVEGKVTGITRFGAFVELPDGATGLVHISEVADGYVKD
FT                   VRDYLNCNDVVKVKVIAISEDGKISLSIRKTRENQRHRRMNNLSFEEKLARFLKESEER
FT                   QQDLKRYESKKGSGGYKRRAY"
FT   gene            114645..115556
FT                   /locus_tag="Toce_0110"
FT   CDS_pept        114645..115556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0110"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="COGs: COG0248 Exopolyphosphatase; InterPro
FT                   IPR003695; KEGG: tit:Thit_2128 Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase; SPTR: Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06901"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK3"
FT                   /protein_id="ADL06901.1"
FT                   /translation="MKAAVIDLGSNSVRLLVAEVGGGKVTPVLKDLVTTRLGEGVADKG
FT                   MLSQKSMDSTLEAVIEFKKRALSAGCERITAIATSAVREAKNGWEFMELIKQRAGIEVR
FT                   ILSGREEGELSFLGAKEGLGLKERALVIDIGGGSTELAFGCEKVQLSVSLPMGAVRWTR
FT                   SFLKSDPPEAKEITALREEARSLLSDFKNRFESMKSPGGVTAVGVGGTLTSLAAISLEL
FT                   KEYHWSKVHGCVLALKAMEEIAGRLCRLPSPKRKEIAGLAADRADIIPAGALIALEIMR
FT                   FLELGSITVSESDLMEGILLTN"
FT   gene            115753..119382
FT                   /locus_tag="Toce_0111"
FT   CDS_pept        115753..119382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0111"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit;
FT                   InterProIPR010243:IPR007644:IPR007642:IPR007645:IPR
FT                   019462:IPR007120:IPR007641:IPR007121; KEGG: cth:Cthe_2724
FT                   DNA-directed RNA polymerase subunit beta; PFAM: RNA
FT                   polymerase Rpb2 domain 6; RNA polymerase beta subunit; RNA
FT                   polymerase Rpb2 domain 2; RNA polymerase Rpb2 domain 3;
FT                   DNA-directed RNA polymerase, beta subunit, external 1
FT                   domain; RNA polymerase Rpb2 domain 7; SPTR: DNA-directed
FT                   RNA polymerase; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; manually curated; PFAM: RNA polymerase Rpb2,
FT                   domain 3; RNA polymerase Rpb2, domain 6; RNA polymerase
FT                   beta subunit external 1 domain; RNA polymerase Rpb2, domain
FT                   2; RNA polymerase beta subunit; RNA polymerase Rpb2, domain
FT                   7; TIGRFAM: DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06902"
FT                   /db_xref="GOA:D9RZK4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK4"
FT                   /protein_id="ADL06902.1"
FT                   /translation="MVRPVKVGGRTRWSFAKIEEVRDLPYLLEIQKNSYEWFLKEGLRE
FT                   VLQEFSPIEDFTGNMVLEFLDYSLDNNPKYSVDECKERDVTYAVPLKVRVRLINKETGE
FT                   VKEQDVFMGDFPLMTENGTFIINGAERVIVSQLVRSPGVYFDRQIDKNGRALYMGTIIP
FT                   NRGAWLEMETDSNEVIYVRVDRTRKIPITVLLRALGYGTNAQIIELLGEDEKILRTLEK
FT                   DNTENQEEALLEIYKRLRPGEPPTVENARALLESLFFDPKRYDLANVGRYKFNKKLRLR
FT                   NRIVGKIAAENVEDPNTGEIILKKGEKITRKTAETLESLRINEIKVMVDEDRVVKVIAN
FT                   GYNDGDGPDVFPTEKYITVEDIVASINYLLNLSYGIGDVDDIDHLGNRRVRSVGELLQN
FT                   QFRIGLARMERVVKERMTIQDVDAITPQGLINIRPLVAAIKEFFGSSQLSQFMDQTNPL
FT                   AELTNKRRLSALGPGGLSRERAGFEVRDVHYSHYGRMCPIETPEGPNIGLISSLSTYAR
FT                   VNQYGFIETPYRKVDKERGVVTNEVEYLTADEEEEFIIAQANVPLDEEGRFVQKRVTAR
FT                   YKDDIVVVPAEEVDYMDVSPKQLVSVATALIPFLEHDDANRALMGANMQRQAVPLITTE
FT                   APLVGTGIEWKAALDSGVMIVAKNSGVVERVTAREIVIRRDSDNGLDVYKVHKFMRSNQ
FT                   GTCINQRPIVKKGDRVEAGQPIADGPSTDHGELALGKNVLVAFMPWEGYNYEDAILISE
FT                   RLVRDDVFTSIHIEQYEAEARDTKLGPEEITRDIPNVGEDALKDLDERGIIRIGAEVRA
FT                   GDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEYGIVVDVKVFSREN
FT                   GDELPPGVNQLVRVYIAQKRKISEGDKMAGRHGNKGVISRILPVEDMPYLPDGTPVDIV
FT                   LNPLGVPSRMNIGQVLETHLGWAAKALGWHVATPVFDGATEEEIFECLRKAGLPEDGKI
FT                   ELRDGRTGEPFDKKVTVGYMYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQR
FT                   FGEMEVWALEAYGASYTLQELLTVKSDDVMGRVKTYEAIVKGENVPEPGIPESFKVLIK
FT                   ELQSLCLDVKILSEDAQEIEIKDADEYEETETLDVNMEGLEDQGETPVKEEEPDEDLEE
FT                   EEPEEDIYEELSEEDRELTRDLGLDEEDFNGQFDFDESEIEDY"
FT   gene            119461..123015
FT                   /locus_tag="Toce_0112"
FT   CDS_pept        119461..123015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0112"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit;
FT                   InterProIPR012754:IPR007080:IPR000722:IPR007066:IPR
FT                   007083:IPR007081:IPR006592; KEGG: tit:Thit_1982
FT                   DNA-directed RNA polymerase, beta' subunit; PFAM: RNA
FT                   polymerase Rpb1 domain 1; RNA polymerase alpha subunit; RNA
FT                   polymerase Rpb1 domain 3; RNA polymerase Rpb1 domain 4; RNA
FT                   polymerase Rpb1 domain 5; SMART: RNA polymerase I subunit A
FT                   domain protein; SPTR: DNA-directed RNA polymerase; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta' subunit; PFAM: RNA
FT                   polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain 4;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   3; RNA polymerase Rpb1, domain 5; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta' subunit, predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06903"
FT                   /db_xref="GOA:D9RZK5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK5"
FT                   /protein_id="ADL06903.1"
FT                   /translation="MLELNFFDSIKIGLASPEQIREWSKGEVKKPETINYRTLKPEKQG
FT                   LFCERIFGPVKDWECHCGKYKRVKYKGVICDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WFLKGIPSRIGLMLDMSPRSLEKVIYFASYIVIDPGNTPLAKKQLLTEKEYREYREKYG
FT                   NAFRAGMGAEAIKELLEEIDLEKLSKELRAELKEANGQKKVRILRRLEVVEAFRKSGNR
FT                   PEWMILEVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIV
FT                   RNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKLYQCGLPKEMALELFKPFVMKKLVEDGHAHNIKSAKRMVERVKPEVWD
FT                   VLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLSTNNMLKPADGKPVVTPTQDMVLGAYYLTIERDGEKGEGKYFS
FT                   SPEEVLLAYSMGEVSLHAKINVRITKEIDGKKRSKIVKTTPGRIIFNECIPQDLGFVDR
FT                   TKEENLFEPELNTLVDKGKLAEIVERCYKKHGTTVTAQVLDRIKATGFHYATKAGITIG
FT                   ITDIEIPADKEKILSEAEEKVDQVELMYRRGLISDEERYEKVIEIWADATERVTESLMN
FT                   SLDRLNPVYMMANSGARGNKQQIRQLAGMRGLMADTAGRIIDLPIKANFREGLTVLEYF
FT                   ISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRELDCGTTEGITVRAIMDGKEVI
FT                   EPLKERIDGRYALEDVVDPNTGEVLVRADEMITDTIADRIIAAGIKEVKIRSVLTCRTR
FT                   HGVCAKCYGKNLATGRPVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGIAGHDITQGLP
FT                   RVEELFEARRPKGQAVITENSGIVRILDTKKKREVEVTSDDGEIRVYQIPYGARLTVEN
FT                   GSRVEAGDSLCEGPINPHDILRIKGVRGVQTYLLQEVLKVYRMQGVDINDKHIEIIIRQ
FT                   MLRKVKVEDPGDTELLPGELIDIFEFEEINERAKQEGRKPAEARRVLLGITKASLATDS
FT                   FLSAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTGMKRYRGIKIYVEGQE
FT                   PGAENQPPAEGANAPEEA"
FT   gene            123107..123355
FT                   /locus_tag="Toce_0113"
FT   CDS_pept        123107..123355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0113"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="InterPro IPR004038:IPR000948; KEGG: sth:STH3081
FT                   ribosomal protein L7AE family protein; PFAM: ribosomal
FT                   protein L7Ae/L30e/S12e/Gadd45; SPTR: Ribosomal protein L7AE
FT                   family; PFAM: Ribosomal protein L7Ae/L30e/S12e/Gadd45
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06904"
FT                   /db_xref="GOA:D9RZK6"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK6"
FT                   /protein_id="ADL06904.1"
FT                   /translation="MLNKLKSAPKKTVGTKQTLKAVERDQAAVVFIAQDAEEHVVSGLK
FT                   ELCQQKGVEVVPVATMKELGEACGIDVGAASAAILNQ"
FT   gene            123418..123792
FT                   /locus_tag="Toce_0114"
FT   CDS_pept        123418..123792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0114"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COGs: COG0048 Ribosomal protein S12; InterPro
FT                   IPR006032:IPR005679; KEGG: cno:NT01CX_1110 30S ribosomal
FT                   protein S12; PFAM: ribosomal protein S12/S23; SPTR: 30S
FT                   ribosomal protein S12; TIGRFAM: ribosomal protein S12;
FT                   PFAM: Ribosomal protein S12; TIGRFAM: ribosomal protein
FT                   S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06905"
FT                   /db_xref="GOA:D9RZK7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK7"
FT                   /protein_id="ADL06905.1"
FT                   /translation="MPTINQLVRRGRQKVQHKSKSPALKGCPQKRGVCTVVKTTTPKKP
FT                   NSALRKIARVRLTNGVEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDA
FT                   AGVANRKQGRSLYGAKKPKS"
FT   gene            123810..124283
FT                   /locus_tag="Toce_0115"
FT   CDS_pept        123810..124283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0115"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="COGs: COG0049 Ribosomal protein S7; InterPro
FT                   IPR005717:IPR000235; KEGG: ate:Athe_0808 ribosomal protein
FT                   S7; PFAM: ribosomal protein S7; SPTR: 30S ribosomal protein
FT                   S7; TIGRFAM: ribosomal protein S7; PFAM: Ribosomal protein
FT                   S7p/S5e; TIGRFAM: ribosomal protein S7,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06906"
FT                   /db_xref="GOA:D9RZK8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK8"
FT                   /protein_id="ADL06906.1"
FT                   /translation="MPRKGHVARRDVPEDPIYKSKLVTKLINKLMYDGKKSVAQKACYG
FT                   AFEIIREKTGKDPLEVFQEALKNVMPVLEVRPRRVGGATYQVPIEVPEHRRLSLGIRWL
FT                   VEYARQRTDKKTIREKLAAEIMDAANGTGGAVKKKDETHRMAEANRAFAHYRW"
FT   gene            124342..126408
FT                   /locus_tag="Toce_0116"
FT   CDS_pept        124342..126408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0116"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase);
FT                   InterProIPR004540:IPR005225:IPR000795:IPR004161:IPR
FT                   005517:IPR000640; KEGG: ate:Athe_0809 translation
FT                   elongation factor G; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain IV; elongation factor G domain
FT                   protein; SPTR: Elongation factor G; TIGRFAM: translation
FT                   elongation factor G; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   Elongation factor G, domain IV; TIGRFAM: translation
FT                   elongation factor EF-G; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06907"
FT                   /db_xref="GOA:D9RZK9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZK9"
FT                   /protein_id="ADL06907.1"
FT                   /translation="MPRQIPLDRLRNIGIMAHIDAGKTTTTERILFYTGKVHKLGEVHE
FT                   GTAVMDWMEQEQERGITITSASTTCYWKDHQINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VFCAKGGVEPQSETVWRQADKYMVPRIAYVNKMDIMGADFYNVIKQIKERLGANPVPVQ
FT                   IPIGSEDTFRGIVDLVGMKAYIYTNDLGTDIQVTEIPDEIRDKAEEYREKMLESLSDVN
FT                   EEIMEKFLEGQEISEAELKAAIRKACVEVKAVPVLCGSSYRNKGVQLLLDAIIDYLPSP
FT                   LDIPAVKGIDPETGEEIERQPSDDEPFSALAFKIMSDPYVGKLTYFRIYSGTLKAGSYV
FT                   YNSTKNKKERIGRILRMHANHRQEMEEAMTGEIVAAVGLKDTTTGDTLCAEEKPIVLES
FT                   MQFPEPVISVAIEPKTKADQEKMGIALQRLAEEDPTFRTYTDQETGQTIISGMGELHLE
FT                   IIVDRMFREFKVQANVGKPQVAYKETIRKAVKAEGKYIRQTGGRGQYGHVWLEIEPLEP
FT                   GKGYEFVNKIVGGVIPKEYIPAVDAGVREALQNGVLAGYPVVDVKVTLFDGSYHEVDSS
FT                   EMAFKIAASMAFKEAMKKAEPVLLEPIMKVEVTVPEEYMGDVIGDLNSRRGHIEGIEPR
FT                   SGAQVVRGYVPLAEMFGYATDLRSKTQGRGTYVMQFSHYAEVPKNIAESIINK"
FT   gene            126428..127630
FT                   /locus_tag="Toce_0117"
FT   CDS_pept        126428..127630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0117"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors;
FT                   InterProIPR004541:IPR005225:IPR000795:IPR004161:IPR 004160;
FT                   KEGG: mta:Moth_2462 elongation factor Tu; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; elongation factor Tu domain protein; SPTR:
FT                   Elongation factor Tu; TIGRFAM: translation elongation
FT                   factor Tu; small GTP-binding protein; PFAM: Elongation
FT                   factor Tu domain 2; Elongation factor Tu C-terminal domain;
FT                   Elongation factor Tu GTP binding domain; TIGRFAM: small
FT                   GTP-binding protein domain; translation elongation factor
FT                   TU"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06908"
FT                   /db_xref="GOA:D9RZL0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL0"
FT                   /protein_id="ADL06908.1"
FT                   /translation="MAKQKFERTKPHVNVGTIGHVDHGKTTLTAAITRTLSSSGLANFV
FT                   AYDQIDKAPEERERGITIATAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLELVEMEVRELLSSYEF
FT                   PGDEIPVVAGSALKALECGCGKRECEWCGKIWQLMDAVDEYIPTPERDADKPFLMPVED
FT                   VFTITGRGTVVTGRVERGTLKVGDEVEIVGLAPEKKKTVVTGVEMFRKILDQAVAGDNI
FT                   GALLRGVDRDEVERGMVIAKPGSIHPHTKFKGQVYVLKKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGVIKLPEGTEMVMPGDNVVMEIELIAPIAIEEGLRFAIREGGRTVGAGVVTEII
FT                   E"
FT   gene            127672..127980
FT                   /locus_tag="Toce_0118"
FT   CDS_pept        127672..127980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0118"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="COGs: COG0051 Ribosomal protein S10; InterPro
FT                   IPR005731:IPR001848:IPR018268; KEGG: aac:Aaci_2712
FT                   ribosomal protein S10; PFAM: ribosomal protein S10; SPTR:
FT                   Ribosomal protein S10; TIGRFAM: ribosomal protein S10;
FT                   PFAM: Ribosomal protein S10p/S20e; TIGRFAM: ribosomal
FT                   protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06909"
FT                   /db_xref="GOA:D9RZL1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL1"
FT                   /protein_id="ADL06909.1"
FT                   /translation="MARQKIRIRLKSYDSGILDQSAQKIVETAKRTGAKVSGPIPLPTD
FT                   RTLITILRAPHKYKDSREQFETRTHKRLIDIHEPTPKTVDALMRLDLPAGVDIEIKL"
FT   gene            128004..128633
FT                   /locus_tag="Toce_0119"
FT   CDS_pept        128004..128633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0119"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="COGs: COG0087 Ribosomal protein L3; InterPro
FT                   IPR019927:IPR000597:IPR019926; KEGG: tpd:Teth39_0374 50S
FT                   ribosomal protein L3; PFAM: ribosomal protein L3; SPTR: 50S
FT                   ribosomal protein L3; TIGRFAM: 50S ribosomal protein L3;
FT                   PFAM: Ribosomal protein L3; TIGRFAM: 50S ribosomal protein
FT                   L3, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06910"
FT                   /db_xref="GOA:D9RZL2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL2"
FT                   /protein_id="ADL06910.1"
FT                   /translation="MAGKAILGIKLGMTQIFDEAGQAVPVTVVEAGPCVVMQKKTPEID
FT                   GYSALKVGFVDVKEHRLTKPVLGQFRKYQLKPKKYIRELKIDEVDKYNVGDEIKVDIFK
FT                   PGERVDVTGISIGKGFAGGVKRWNFNRGPMSHGSMYHRRPGSGGATDPERVFKGKKMPG
FT                   HLGHERVTVQNLEIVKVDPERNLLLIKGSVPGTKKSLLYIKSTVKS"
FT   gene            128661..129287
FT                   /locus_tag="Toce_0120"
FT   CDS_pept        128661..129287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0120"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="COGs: COG0088 Ribosomal protein L4; InterPro
FT                   IPR002136; KEGG: aoe:Clos_0493 50S ribosomal protein L4;
FT                   PFAM: ribosomal protein L4/L1e; SPTR: Ribosomal protein
FT                   L4/L1e; PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06911"
FT                   /db_xref="GOA:D9RZL3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL3"
FT                   /protein_id="ADL06911.1"
FT                   /translation="MPKVALYNMQGQQVGEVELSDSVFGVEVKPEVMHQVVLNYLANQR
FT                   VGTASTKTRAEVRGGGRKPWRQKGTGRARHGSIRSPLWRKGGIVFGPKPRSYKYTLPKK
FT                   LKRLALKSALSAKVRDNEIIVLDRLTMEAPKTKEMVKVLSNLKADTKSLIVLDASDVNV
FT                   VKSARNIPGVTTTTVNTLNVYDILNHDKLIMTMDAVKRVEEVYAG"
FT   gene            129284..129574
FT                   /locus_tag="Toce_0121"
FT   CDS_pept        129284..129574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0121"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="COGs: COG0089 Ribosomal protein L23; InterPro
FT                   IPR013025:IPR001014; KEGG: aoe:Clos_0494 50S ribosomal
FT                   protein L23; PFAM: Ribosomal protein L25/L23; SPTR: 50S
FT                   ribosomal protein L23; PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06912"
FT                   /db_xref="GOA:D9RZL4"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL4"
FT                   /protein_id="ADL06912.1"
FT                   /translation="MKDPHDIIIRPWITEKSMAMKENRKYTFVVHPDANKTEIKNAVEA
FT                   IFGVKVEKVNTMNMRGKKKRMGLSEGKRPDWKKAIVTLKKDSKAIEFFESL"
FT   gene            129611..130438
FT                   /locus_tag="Toce_0122"
FT   CDS_pept        129611..130438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0122"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171:IPR005880; KEGG: cth:Cthe_2906 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: Ribosomal
FT                   protein L2; TIGRFAM: ribosomal protein L2; PFAM: Ribosomal
FT                   Proteins L2, RNA binding domain; Ribosomal Proteins L2,
FT                   C-terminal domain; TIGRFAM: ribosomal protein L2,
FT                   bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06913"
FT                   /db_xref="GOA:D9RZL5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL5"
FT                   /protein_id="ADL06913.1"
FT                   /translation="MGIKKFKPTSPGIRFMTVSTFEEITKKEPEKSLVEILKSKAGRNA
FT                   QGRITARHRGGGHKRKYRIIDFKRDKDGVPAKVAAIEYDPNRSARIALLHYRDGEKRYI
FT                   LAPVGLKVGDIVESGPNADIKPGNALPLASIPVGTIVHNVELYPGKGGQLVRAAGAAAQ
FT                   LMAKENGLATLRLPSGEMRMVPVECRATVGQVGNLEHENISIGKAGRSRWLGRRPHVRG
FT                   SAMNPIDHPHGGGEGKAPIGRKHPVTPWGKPTLGYKTRKKNKPSDKFIVKRRK"
FT   gene            130460..130744
FT                   /locus_tag="Toce_0123"
FT   CDS_pept        130460..130744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0123"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="COGs: COG0185 Ribosomal protein S19; InterPro
FT                   IPR002222:IPR005732:IPR020934; KEGG: cth:Cthe_2907 30S
FT                   ribosomal protein S19; PFAM: ribosomal protein S19/S15;
FT                   SPTR: Ribosomal protein S19; TIGRFAM: ribosomal protein
FT                   S19; PFAM: Ribosomal protein S19; TIGRFAM: ribosomal
FT                   protein S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06914"
FT                   /db_xref="GOA:D9RZL6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL6"
FT                   /protein_id="ADL06914.1"
FT                   /translation="MGRSVKKGPFVDPKLLKKIRAMNEKREKKVIKTWSRDSTIIPEMV
FT                   GHTIAVHDGRKHVPVYITEDMVGHKLGEFAPTRTFRGHGDHTEKSTALK"
FT   gene            130770..131108
FT                   /locus_tag="Toce_0124"
FT   CDS_pept        130770..131108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0124"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR005727:IPR001063:IPR018260; KEGG: tte:TTE2287 50S
FT                   ribosomal protein L22; PFAM: ribosomal protein L22/L17;
FT                   SPTR: 50S ribosomal protein L22; TIGRFAM: ribosomal protein
FT                   L22; PFAM: Ribosomal protein L22p/L17e; TIGRFAM: ribosomal
FT                   protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06915"
FT                   /db_xref="GOA:D9RZL7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL7"
FT                   /protein_id="ADL06915.1"
FT                   /translation="MEARAQARYVRIAPRKVRIVLDLIRGKKLDEALSILQFTPKRASK
FT                   IVEKLIRSAAANAENNHNMNPDALYVYKCYADQGPTLKRFRARAMGRAAMIRKRTSHIT
FT                   VVLREKEG"
FT   gene            131112..131804
FT                   /locus_tag="Toce_0125"
FT   CDS_pept        131112..131804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0125"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="COGs: COG0092 Ribosomal protein S3;
FT                   InterProIPR005704:IPR008282:IPR004044:IPR001351:IPR
FT                   004087:IPR004088; KEGG: cth:Cthe_2909 SSU ribosomal protein
FT                   S3P; PFAM: ribosomal protein S3- domain protein; Ribosomal
FT                   protein S3 domain; KH type 2 domain protein; SMART: KH
FT                   domain protein; SPTR: Ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: KH domain; Ribosomal protein
FT                   S3, C-terminal domain; Ribosomal protein S3, N-terminal
FT                   domain; TIGRFAM: ribosomal protein S3, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06916"
FT                   /db_xref="GOA:D9RZL8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL8"
FT                   /protein_id="ADL06916.1"
FT                   /translation="MGQKVHPHGLRIGIIRDWDSRWYSEKNFADLVLEDFNIRKHIKNK
FT                   FYTAGISRVEIERAANRIKVTIHTAKPGMVIGKGGAGVEELRKDLEAMTGKQISINVIE
FT                   IKNPDVEAQLVAENIAAQIERRISYRRAMKQAIARALKAGAKGIKTMVSGRLAGAEIAR
FT                   TEWYREGTIPLQKLRADISYGFAEAHTTYGRIGVKVWIYRGDVLPTRKQEKQVEGGEAN
FT                   VNAEAGQI"
FT   gene            131776..132210
FT                   /locus_tag="Toce_0126"
FT   CDS_pept        131776..132210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0126"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR000114:IPR016180:IPR020798; KEGG: tpd:Teth39_0381 50S
FT                   ribosomal protein L16; PFAM: Ribosomal protein L10e/L16;
FT                   SPTR: 50S ribosomal protein L16; TIGRFAM: ribosomal protein
FT                   L16; PFAM: Ribosomal protein L16p/L10e; TIGRFAM: ribosomal
FT                   protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06917"
FT                   /db_xref="GOA:D9RZL9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZL9"
FT                   /protein_id="ADL06917.1"
FT                   /translation="MLMPKRVKYRKQQRGTIRGKATRGTEVTYGEYGLQALEPAWITSS
FT                   QIEAARIAITRYIKRGGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLF
FT                   ELAGVSEEVAKEALTLASHKLPIKTKIVKREGLGGDENEG"
FT   gene            132200..132397
FT                   /locus_tag="Toce_0127"
FT   CDS_pept        132200..132397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0127"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="COGs: COG0255 Ribosomal protein L29; InterPro
FT                   IPR001854:IPR018254; KEGG: tpd:Teth39_0382 50S ribosomal
FT                   protein L29; PFAM: ribosomal protein L29; SPTR: Ribosomal
FT                   protein L29; TIGRFAM: ribosomal protein L29; PFAM:
FT                   Ribosomal L29 protein; TIGRFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06918"
FT                   /db_xref="GOA:D9RZM0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM0"
FT                   /protein_id="ADL06918.1"
FT                   /translation="MKAKQIRELSDQELVQKLKDLKGELFNLRFQSATGQLDNPKRIRE
FT                   VRKTIARIKTILTERERARA"
FT   gene            132428..132685
FT                   /locus_tag="Toce_0128"
FT   CDS_pept        132428..132685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0128"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="COGs: COG0186 Ribosomal protein S17; InterPro
FT                   IPR019984:IPR000266:IPR019979; KEGG: tpd:Teth39_0383 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17; SPTR:
FT                   30S ribosomal protein S17; TIGRFAM: 30S ribosomal protein
FT                   S17; PFAM: Ribosomal protein S17; TIGRFAM: 30S ribosomal
FT                   protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06919"
FT                   /db_xref="GOA:D9RZM1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM1"
FT                   /protein_id="ADL06919.1"
FT                   /translation="MEERPKRKVRTGVVVSNKMDKTIVVAVETLVRHPLYGKTIKRTKK
FT                   FKAHDENNQCQIGDVVKIMETRPLSKTKRWRLLEIVKRAE"
FT   gene            132711..133079
FT                   /locus_tag="Toce_0129"
FT   CDS_pept        132711..133079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0129"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR005745:IPR000218:IPR019972; KEGG: adg:Adeg_1514
FT                   ribosomal protein L14; PFAM: ribosomal protein L14b/L23e;
FT                   SPTR: 50S ribosomal protein L14; TIGRFAM: ribosomal protein
FT                   L14; PFAM: Ribosomal protein L14p/L23e; TIGRFAM: ribosomal
FT                   protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06920"
FT                   /db_xref="GOA:D9RZM2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM2"
FT                   /protein_id="ADL06920.1"
FT                   /translation="MIQVQTRLNVADNTGAKEIMCIRVLGGSNRKFAGIGDIIVASVKD
FT                   AAPDGIVKKGDVVKAVIVRTKAPKRRPDGSYIKFDENAAVIINDDLNPRGTRIFGPVAR
FT                   ELRDKNFMRIISLAPEVL"
FT   gene            133093..133416
FT                   /locus_tag="Toce_0130"
FT   CDS_pept        133093..133416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0130"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="COGs: COG0198 Ribosomal protein L24; InterPro
FT                   IPR003256:IPR005824:IPR005825; KEGG: ate:Athe_1734
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein; SPTR: Ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW motif; TIGRFAM: ribosomal
FT                   protein L24, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06921"
FT                   /db_xref="GOA:D9RZM3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM3"
FT                   /protein_id="ADL06921.1"
FT                   /translation="MAKVHVKKGDTVVVLSGKDRGKKGKVLKVLPKKGVAIVEGVNMAT
FT                   KHRRPSPKFPQGGIIHQEMPLNTSKLMVVCGKCGAPTRIGHTFLADGTKVRTCKKCGEV
FT                   IDK"
FT   gene            133440..133979
FT                   /locus_tag="Toce_0131"
FT   CDS_pept        133440..133979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0131"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132:IPR020929; KEGG: tit:Thit_1960 ribosomal protein
FT                   L5; SPTR: Ribosomal protein L5; PFAM: ribosomal L5P family
FT                   C-terminus; Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06922"
FT                   /db_xref="GOA:D9RZM4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM4"
FT                   /protein_id="ADL06922.1"
FT                   /translation="MPRLKEKYEKEVIPAMMNKFNYKNVMQVPRLEKVVLNMGISDAKE
FT                   NPKAVESATRDMAAIAGQKPVVTKARKSIASFKIRQGMPIGAKVTLRGDRMYEFLDKLF
FT                   NVALPRVRDFKGVSPDAFDGRGNYTLGIKEQLIFPEIDYDKIDKIRGMDITIVTTAETD
FT                   EEARELLKGLGMPFAR"
FT   gene            133995..134180
FT                   /locus_tag="Toce_0132"
FT   CDS_pept        133995..134180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0132"
FT                   /product="ribosomal protein S14"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR001209:IPR018271; KEGG: csc:Csac_2274 30S ribosomal
FT                   protein S14; PFAM: ribosomal protein S14; SPTR: 30S
FT                   ribosomal protein S14 type Z; PFAM: Ribosomal protein
FT                   S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06923"
FT                   /db_xref="GOA:D9RZM5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM5"
FT                   /protein_id="ADL06923.1"
FT                   /translation="MAKKSLIAKQKRPQKFSTRYYNRCKICGRPRAYLRKFGVCRLCFR
FT                   VLAHRGEIPGVRKASW"
FT   gene            134206..134604
FT                   /locus_tag="Toce_0133"
FT   CDS_pept        134206..134604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0133"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: adg:Adeg_1510 ribosomal protein S8; PFAM:
FT                   ribosomal protein S8; SPTR: Ribosomal protein S8; PFAM:
FT                   Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06924"
FT                   /db_xref="GOA:D9RZM6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM6"
FT                   /protein_id="ADL06924.1"
FT                   /translation="MAITDPIADMLTRIRNANDAGHPTVEIPCSKIKRAIAETLKEEGF
FT                   IQDYEVIEDGKQGIIKIHLKYGPNKEKVITGIKRISKPGLRIYVRKDQIPRVLGGLGIA
FT                   ILSTSKGIMTDKKARKEGVGGEVICYVW"
FT   gene            134629..135168
FT                   /locus_tag="Toce_0134"
FT   CDS_pept        134629..135168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0134"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR000702:IPR019906:IPR020040:IPR002358; KEGG: chy:CHY_2294
FT                   50S ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain; SPTR: 50S ribosomal protein L6; TIGRFAM:
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6; TIGRFAM:
FT                   ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06925"
FT                   /db_xref="GOA:D9RZM7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM7"
FT                   /protein_id="ADL06925.1"
FT                   /translation="MSRIGKKPIEIPKGVEVKIEGNIVTIKGPKGSITKEFHKDMQILQ
FT                   EDGKIIVKRPSDDKNHKALHGLTRSLLANMVNGVVNGYEKSLMLEGVGYRASKQGNKLV
FT                   LTVGFSHPVEIEAPKGIEFEVPAQNKIIVRGIDKELVGITAANIRKVKEPEPYKGKGIR
FT                   YENEVVRRKVGKAGAK"
FT   gene            135189..135554
FT                   /locus_tag="Toce_0135"
FT   CDS_pept        135189..135554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0135"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR004389:IPR005484; KEGG: tit:Thit_1956 ribosomal protein
FT                   L18; PFAM: ribosomal protein L18P/L5E; SPTR: Ribosomal
FT                   protein L18; TIGRFAM: ribosomal protein L18; PFAM:
FT                   Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein L18,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06926"
FT                   /db_xref="GOA:D9RZM8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM8"
FT                   /protein_id="ADL06926.1"
FT                   /translation="MIKKEPRNLARKRRHLRIRKKVFGTAERPRLNVFRSLKHIYAQII
FT                   NDEEGRTLVAASTLDPAIRDSVKGCNVEAAEKVGELIAKRALEKGITKVAFDRGGYLYH
FT                   GRVKALAEAARRAGLEF"
FT   gene            135572..136072
FT                   /locus_tag="Toce_0136"
FT   CDS_pept        135572..136072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0136"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR005712:IPR013810:IPR005324:IPR018192; KEGG:
FT                   afl:Aflv_0122 ribosomal protein S5; PFAM: Ribosomal protein
FT                   S5 ; ribosomal protein S5 domain protein; SPTR: Ribosomal
FT                   protein S5; TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5, N-terminal domain; Ribosomal protein S5,
FT                   C-terminal domain; TIGRFAM: ribosomal protein S5,
FT                   bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06927"
FT                   /db_xref="GOA:D9RZM9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZM9"
FT                   /protein_id="ADL06927.1"
FT                   /translation="MQRERDIEHEFSEKVVTINRVSKVTKGGKNFRFSALVVVGNKNGK
FT                   VGVGTGKAHEIPDAIRKAIEDAKKNLINVPVINGTIPHEAIGESGAGRVLVKPAVEGTG
FT                   VIAGGPVRAVLELAGIRNVVSKSLGSSNAKNMVDATIEALKQLKSIEEVAKMRGKTVQE
FT                   LLG"
FT   gene            136099..136539
FT                   /locus_tag="Toce_0137"
FT   CDS_pept        136099..136539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0137"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="COGs: COG0200 Ribosomal protein L15; InterPro
FT                   IPR005749:IPR001196; KEGG: tte:TTE2273 ribosomal protein
FT                   L15; SPTR: 50S ribosomal protein L15; TIGRFAM: ribosomal
FT                   protein L15; PFAM: Ribosomal protein L18e/L15; TIGRFAM:
FT                   ribosomal protein L15, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06928"
FT                   /db_xref="GOA:D9RZN0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN0"
FT                   /protein_id="ADL06928.1"
FT                   /translation="MRLHDLKPAEGSRKRPKRVGRGIGSGHGKTSTRGHKGQNARSGGG
FT                   VRPGFEGGQMPLYRRLPKRGFTNIFKKEYAIVNVKDLNVFEENTRVTPELLVEKGLIKQ
FT                   VKDGVKILGDGELKVKLEVVAHAFSGSAKEKIEAAGGKAEVI"
FT   gene            136539..137795
FT                   /locus_tag="Toce_0138"
FT   CDS_pept        136539..137795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0138"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: mta:Moth_2440 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR:
FT                   Preprotein translocase subunit secY; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06929"
FT                   /db_xref="GOA:D9RZN1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN1"
FT                   /protein_id="ADL06929.1"
FT                   /translation="MLEALKNAWKIPDLRRRLQFTLLMLVVFRIGAFVPVPGMNPEAVR
FT                   QLIERGALLGFFDIIAGGAFKQFSVFAMSITPYINASIIVQLLTIVIPRWEELAKEGVE
FT                   GRKVLARYTRYGTVILGLIQATGLAVGFRSALTNPGFFGSLLVVLSLTAGTAFLMWVGE
FT                   QITDKGIGNGISLLIFAGIVSRLPSGVYQMYDYIRVGTANVLMVLLFAVFALVVIVGVI
FT                   AVQQAERRIPVQYARRVVGRRVYGGQTTHIPMKLNAAGVIPVIFAMSILLFPSTIAGFF
FT                   PNSKVAVSIANFIEPGGWLYASLYALLIIFFTYFYTAVTFNPVDVADNMKKYGGFIPGI
FT                   RPGRSTAEYLNKIMTRITLIGAIFLAAIAVLPYLITGVTSLNIYFGGTALLIVIGVALE
FT                   TMKLIEAQMLMRHYQGFLK"
FT   gene            137808..138458
FT                   /locus_tag="Toce_0139"
FT   CDS_pept        137808..138458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0139"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COGs: COG0563 Adenylate kinase and related kinase;
FT                   InterPro IPR006259:IPR000850:IPR007862; KEGG: adg:Adeg_1237
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain protein; SPTR: Adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: Adenylate kinase, active site lid;
FT                   Adenylate kinase; TIGRFAM: adenylate kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06930"
FT                   /db_xref="GOA:D9RZN2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN2"
FT                   /protein_id="ADL06930.1"
FT                   /translation="MRIVLMGPPGAGKGTQAKKLAEAFDVPHISTGDMLRSAVQEGTPL
FT                   GKKAREYMDKGLLVPDEVITGIVRERLRDKSCEKGFILDGFPRTIPQAESLEEALGEMG
FT                   IRLDAVVNIVVPREELIERFTGRRVCEVCGFTYHVKYNPPQKEGICDKCGGKLIMRADD
FT                   DVKTVENRINVYEQQTRPLIEYYDRKNLLVNIDGNRPIDVVFEDIKSRLRGEG"
FT   gene            138458..139204
FT                   /locus_tag="Toce_0140"
FT   CDS_pept        138458..139204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0140"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="COGs: COG0024 Methionine aminopeptidase; InterPro
FT                   IPR002467:IPR000994:IPR001714; KEGG: tte:TTE2270 methionine
FT                   aminopeptidase; PFAM: peptidase M24; SPTR: Methionine
FT                   aminopeptidase; TIGRFAM: methionine aminopeptidase, type I;
FT                   PFAM: Metallopeptidase family M24; TIGRFAM: methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06931"
FT                   /db_xref="GOA:D9RZN3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN3"
FT                   /protein_id="ADL06931.1"
FT                   /translation="MVIIKSKREIEIMRRAGRVVALVLEELKRHIKPGVTTGELDRIAE
FT                   EVILKNGAVPAFKGYRGFPATICTSINEEVVHGIPGLRTLKDGDIISVDVGAIVEGYCS
FT                   DAARTYPVGNVSEKALELIEVTRQSFYEGLTFAKAGYRLSDISHAIQTYVESRNFSVVR
FT                   EWGGHGIGRQMHEDPHVPNYGPPNKGPRLRPGMTLAIEPMVNAGGYEVYILEDNWTVVT
FT                   KDGSLSAHYENTIAITDGEPEILTRI"
FT   gene            139217..139504
FT                   /locus_tag="Toce_0141"
FT   CDS_pept        139217..139504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0141"
FT                   /product="LSU ribosomal protein L14E"
FT                   /note="KEGG: cth:Cthe_2926 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06932"
FT                   /db_xref="GOA:D9RZN4"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN4"
FT                   /protein_id="ADL06932.1"
FT                   /translation="MKEVEPGQVVMSCAGRDKGRFMLVIRVIDSQYVYVADGKLRRIEK
FT                   PKKKKLKHLKILNKKAGFIHEKLASGRKVYNEEIRRALEELVEKPDDNRV"
FT   gene            139524..139742
FT                   /locus_tag="Toce_0142"
FT   CDS_pept        139524..139742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0142"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR004368:IPR006196; KEGG: bcl:ABC0173
FT                   translation initiation factor IF-1; PFAM: S1 IF1 family
FT                   protein; SPTR: Translation initiation factor IF-1; TIGRFAM:
FT                   translation initiation factor IF-1; PFAM: Translation
FT                   initiation factor 1A / IF-1; TIGRFAM: translation
FT                   initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06933"
FT                   /db_xref="GOA:D9RZN5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN5"
FT                   /protein_id="ADL06933.1"
FT                   /translation="MSKSDVIEVEGTVVEPLPNGMFRVELKNGHKVLAHVSGKIRMNYI
FT                   RILPGDKVTVELSPYDLTRGRIVYRYK"
FT   gene            139764..139877
FT                   /locus_tag="Toce_0143"
FT   CDS_pept        139764..139877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0143"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="InterPro IPR000473; KEGG: afn:Acfer_1906 ribosomal
FT                   protein L36; PFAM: ribosomal protein L36; SPTR: 50S
FT                   ribosomal protein L36; TIGRFAM: ribosomal protein L36;
FT                   PFAM: Ribosomal protein L36; TIGRFAM: ribosomal protein
FT                   L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06934"
FT                   /db_xref="GOA:D9RZN6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN6"
FT                   /protein_id="ADL06934.1"
FT                   /translation="MKVRPSVKKICEKCKIIKRKGRVMVICENPKHKQRQG"
FT   gene            139893..140264
FT                   /locus_tag="Toce_0144"
FT   CDS_pept        139893..140264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0144"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="COGs: COG0099 Ribosomal protein S13; InterPro
FT                   IPR001892:IPR019980:IPR018269; KEGG: pth:PTH_0345 30S
FT                   ribosomal protein S13; PFAM: ribosomal protein S13; SPTR:
FT                   30S ribosomal protein S13; TIGRFAM: 30S ribosomal protein
FT                   S13; PFAM: Ribosomal protein S13/S18; TIGRFAM: 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06935"
FT                   /db_xref="GOA:D9RZN7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN7"
FT                   /protein_id="ADL06935.1"
FT                   /translation="MARIAGVDLPKDKRVEIALTYIYGIGRSLSNKILKEAGVNPDTRV
FT                   KDLTEREISNLRDIIEKNYKVEGDLRREVALNIKRLIEIGCYRGIRHRRGLPVRGQRTR
FT                   TNARTRKGPRKTVGARRSK"
FT   gene            140285..140668
FT                   /locus_tag="Toce_0145"
FT   CDS_pept        140285..140668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0145"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="COGs: COG0100 Ribosomal protein S11; InterPro
FT                   IPR001971:IPR019981:IPR018102; KEGG: tte:TTE2265 30S
FT                   ribosomal protein S11; PFAM: ribosomal protein S11; SPTR:
FT                   30S ribosomal protein S11; TIGRFAM: 30S ribosomal protein
FT                   S11; PFAM: Ribosomal protein S11; TIGRFAM: 30S ribosomal
FT                   protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06936"
FT                   /db_xref="GOA:D9RZN8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN8"
FT                   /protein_id="ADL06936.1"
FT                   /translation="MALTSRKRREKRRVEKGKAHIHSTFNNTIVTITDEAGNPITWASA
FT                   GTVGFKGSRKGTPFAAQMAAESAARKAMDYGLRTVEVFVKGPGPGREAAIRSLQAAGLE
FT                   ISVIKDVTPIPHNGCRPPKRRRV"
FT   gene            140698..141324
FT                   /locus_tag="Toce_0146"
FT   CDS_pept        140698..141324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0146"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="COGs: COG0522 Ribosomal protein S4 and related
FT                   protein; InterPro IPR005709:IPR001912:IPR002942:IPR018079;
FT                   KEGG: ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein; SPTR: Ribosomal protein S4; TIGRFAM: ribosomal
FT                   protein S4; PFAM: Ribosomal protein S4/S9 N-terminal
FT                   domain; S4 domain; TIGRFAM: ribosomal protein S4,
FT                   bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06937"
FT                   /db_xref="GOA:D9RZN9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZN9"
FT                   /protein_id="ADL06937.1"
FT                   /translation="MARYTGPVCRLCRREGMKLYLKGERCYTPKCAIDRRGYAPGQHGQ
FT                   MKRKLSEYGLQLREKQKAKRIYGVLERQFKIYFEEAIRRKGVTGENLLRLLECRLDNVV
FT                   YRLGFAKSRAQARQIVRHGHIEVNGRKVTIPSYQVREKDVIAVREKSRSLDFFKEMAEA
FT                   GKGRIVPEWLSVNYDTLTGEVVRMPNREDIDVPIQEHLIVELYSK"
FT   gene            141368..142318
FT                   /locus_tag="Toce_0147"
FT   CDS_pept        141368..142318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0147"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0202 DNA-directed RNA polymerase alpha
FT                   subunit/40 kD subunit;
FT                   InterProIPR011773:IPR011261:IPR011262:IPR011260:IPR 011263;
FT                   KEGG: cth:Cthe_2932 DNA-directed RNA polymerase subunit
FT                   alpha; PFAM: RNA polymerase insert; RNA polymerase
FT                   dimerisation; RNA polymerase alpha subunit domain protein;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type; SPTR: DNA-directed
FT                   RNA polymerase, alpha subunit; TIGRFAM: DNA-directed RNA
FT                   polymerase, alpha subunit; PFAM: RNA polymerase Rpb3/Rpb11
FT                   dimerisation domain; RNA polymerase Rpb3/RpoA insert
FT                   domain; Bacterial RNA polymerase, alpha chain C terminal
FT                   domain; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit, bacterial and chloroplast-type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06938"
FT                   /db_xref="GOA:D9RZP0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZP0"
FT                   /protein_id="ADL06938.1"
FT                   /translation="MTEIEKPRIELVEISEDNTYGKIVIEPLERGYGTTLGNSLRRVLL
FT                   SSLPGAAITSVKIDGVQHEFSTIPGVLEDTVEIIMNIKGLAIKMHSDEPKLLRIEAQGE
FT                   GEVTAKDIICDADVEIINKDHHIATLDKDGRLFAELTLEKGKGYVTAEKNKKPGQPIGI
FT                   IPIDSIFTPVIKANYTVEHTRVGQVTDYDKLTLEVWTNGTIKPDEAVSAAAKILIDYFN
FT                   LFTGLTTAVKKVEAPVEKEKDERERILEMPIEELDLSVRSYNCLKRAGINTIGELIQKT
FT                   PEEMMKVRNLGKKSLEEVEEKLAALNLSLKKSEDA"
FT   gene            142334..142666
FT                   /locus_tag="Toce_0148"
FT   CDS_pept        142334..142666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0148"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="COGs: COG0203 Ribosomal protein L17; InterPro
FT                   IPR000456; KEGG: tit:Thit_1943 ribosomal protein L17; PFAM:
FT                   ribosomal protein L17; SPTR: Ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: Ribosomal protein
FT                   L17; TIGRFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06939"
FT                   /db_xref="GOA:D9RZP1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZP1"
FT                   /protein_id="ADL06939.1"
FT                   /translation="MRKLGRDSGHRKMMLRNMVTSLFKHGRIITTETRAKEVRSIAEKI
FT                   ITLGKKNDLAARRMVLAEVLDETTVKNIFEKIAPKYNDRNGGYTRIIKLGPRRGDSSPM
FT                   VVLELV"
FT   gene            142698..143528
FT                   /locus_tag="Toce_0149"
FT   CDS_pept        142698..143528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0149"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component;
FT                   InterProIPR005876:IPR003439:IPR003593:IPR017871:IPR 015856;
FT                   KEGG: tte:TTE2261 cobalt transporter ATP-binding subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   Cobalt import ATP-binding protein CbiO 2; TIGRFAM: cobalt
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter;
FT                   Cobalt ATP-binding cassette C terminal; TIGRFAM: cobalt
FT                   transport protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06940"
FT                   /db_xref="GOA:D9RZP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZP2"
FT                   /protein_id="ADL06940.1"
FT                   /translation="MAAEILAESVYYQYSQAKDLALKDVNLRIQKGEFVAIIGPNGSGK
FT                   STLAKLFNGLFLPTKGSVRVDGLDTRDRDNIWKIRQKAGMVFQNPDNQIVATLVEEDVA
FT                   FGPENLGLPPEEIKKRVYEALKIVELVDFAQKAPHLLSGGQKQRVAIAGVLAMKPDYII
FT                   LDEPTAMLDPVGRREVINTVKRLNREEGKTIVLITHFMEEAVQADRVIAMNRGQVVMEG
FT                   TPREIFSRVEELKAIGLDVPQVTELAHRLKGRGLEVRGDILTIDEMVECLCPLL"
FT   gene            143513..144376
FT                   /locus_tag="Toce_0150"
FT   CDS_pept        143513..144376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0150"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR015856; KEGG:
FT                   aoe:Clos_0524 cobalt transporter ATP-binding subunit; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter; Cobalt
FT                   ATP-binding cassette C terminal; TIGRFAM: cobalt transport
FT                   protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06941"
FT                   /db_xref="GOA:D9RZP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZP3"
FT                   /protein_id="ADL06941.1"
FT                   /translation="MPVVVKNLTHIYMPGTPFESVALQDVNWTVQDGEFWGLIGHTGSG
FT                   KSTLIQHLNGLLKPTSGEVIIDGVNINERGVNLREIRQKVGLVFQYPEHQLFEETVEKD
FT                   VAFGPRNIGLPEEEIDRRVREAIELVGLNFSEIKDRSPFELSGGQMRRVAIAGVLAMKP
FT                   KVLILDEPTVGLDPRGKDEILREIVQLRERQNITVILVSHSMEDIAKLVDKIAVMHRGR
FT                   MVESGTPREIFKNYEGLSSIGLDIPQVTHLMLKLKNCGKDVSTEVLTVEEAEAEILEAA
FT                   RRKGRA"
FT   gene            144369..145166
FT                   /locus_tag="Toce_0151"
FT   CDS_pept        144369..145166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0151"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: amt:Amet_4445 cobalt transport protein;
FT                   PFAM: cobalt transport protein; SPTR: Cobalt transport
FT                   protein; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06942"
FT                   /db_xref="GOA:D9RZP4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:D9RZP4"
FT                   /protein_id="ADL06942.1"
FT                   /translation="MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDFTGYA
FT                   FPAVFIIAVSILSGISLKYMMRGLRPLVIIIVLTFVLNLFMIKGRVIYEIGPLDITYEG
FT                   LYQGTFMVLRLIMLIVGTSLLTLTTSPIALTDGIESLLKPFRRVGVPAHELAMMMTIAL
FT                   RFIPTLMEETDKIMKAQMARGADFASGNVVQRARSLVPLLVPLFINAFRRADDLAMAME
FT                   SRCYRGGENRTRMKQLRMTSADLAAFIATGLLAVGSIMSRFIW"
FT   gene            145176..145907
FT                   /locus_tag="Toce_0152"
FT   CDS_pept        145176..145907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0152"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="COGs: COG0101 Pseudouridylate synthase; InterPro
FT                   IPR001406:IPR020097; KEGG: cth:Cthe_2939 tRNA pseudouridine
FT                   synthase A; PFAM: Pseudouridine synthase I, TruA,
FT                   alpha/beta domain; SPTR: Pseudouridylate synthase; TIGRFAM:
FT                   tRNA pseudouridine synthase A; PFAM: tRNA pseudouridine
FT                   synthase; TIGRFAM: pseudouridylate synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06943"
FT                   /db_xref="GOA:D9RZP5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZP5"
FT                   /protein_id="ADL06943.1"
FT                   /translation="MNVKILLEYDGTNYHGWQKQNNALSVQEVLEKAIYALTGERVSII
FT                   GAGRTDAGVHARGQVANFRTNTRIPVERLPYAINSKLPEDIAVKGAEAVPDDFHARYSA
FT                   KAKVYTYSIYNAPFPSPLLRRYSYFFPLPLDVEAMRRAAKAFIGVHDFAAFRASGSSVK
FT                   TSVRNITRLDVKKCGKLLTIEVEADGFLYNMVRIIAGTLLEVGTGKKDPEEIPSIIESR
FT                   DRERAGVTLPAHGLCLEKVIY"
FT   gene            145967..146401
FT                   /locus_tag="Toce_0153"
FT   CDS_pept        145967..146401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0153"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="COGs: COG0102 Ribosomal protein L13; InterPro
FT                   IPR005822:IPR005823; KEGG: adg:Adeg_0211 ribosomal protein
FT                   L13; PFAM: ribosomal protein L13; SPTR: 50S ribosomal
FT                   protein L13; TIGRFAM: ribosomal protein L13; PFAM:
FT                   Ribosomal protein L13; TIGRFAM: ribosomal protein L13,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06944"
FT                   /db_xref="GOA:D9RZP6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D9RZP6"
FT                   /protein_id="ADL06944.1"
FT                   /translation="MSTFMAKKEEIKREWYVIDATDKPLGRLAAQVAKILKGKHKPIYT
FT                   PHVDTGDHVIIVNADKVVLTGKKLDKKIYYRHSLYPGGLKAETYRHFLQRAPEKAIYKA
FT                   VWGMLPHNSLGRRMIKKLKIYRGPEHPHQAQQPKELPYEG"
FT   gene            146417..146806
FT                   /locus_tag="Toce_0154"
FT   CDS_pept        146417..146806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0154"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="COGs: COG0103 Ribosomal protein S9; InterPro
FT                   IPR000754:IPR020574; KEGG: ate:Athe_2069 ribosomal protein
FT                   S9; PFAM: ribosomal protein S9; SPTR: 30S ribosomal protein
FT                   S9; PFAM: Ribosomal protein S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06945"
FT                   /db_xref="GOA:D9S017"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D9S017"
FT                   /protein_id="ADL06945.1"
FT                   /translation="MKEAVLATGRRKTSVARVWLTPGTGRILINKRPFEEYFPLETLRN
FT                   DVTRPLVVTNTLGKFDIIANVRGGGVTGQAGAVRHGIARALLQIDETFKPMLRKEGLLT
FT                   RDPRMVERKKYGLKKARRAPQFSKR"
FT   gene            146916..147836
FT                   /locus_tag="Toce_0155"
FT   CDS_pept        146916..147836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0155"
FT                   /product="thioredoxin reductase (NADPH)"
FT                   /EC_number="1.8.1.9"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR005982:IPR013027:IPR000103:IPR008255; KEGG: pth:PTH_1417
FT                   thioredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Thioredoxin
FT                   reductase; TIGRFAM: thioredoxin reductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM:
FT                   thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06946"
FT                   /db_xref="GOA:D9S018"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9S018"
FT                   /protein_id="ADL06946.1"
FT                   /translation="MYDLAIIGAGPAGLSAAIYGARARLSTVMIEKMYPGGQAAITDII
FT                   ENYPGFPEGIGGAELTEAMKKQAERFGAQFLNGNVEKIEKVGEKFLIRLKTETLEAKTV
FT                   ILAMGAEARKLGVKGEKEFTGRGVSYCATCDGAFYTDRPVMVVGGGDTAIGEAIYLTHF
FT                   ATSVTVVHRRNELRATKILQERAFKNEKIKFIWDSVVDEIKGGDAVEEVVVRNVKTGEK
FT                   TSVPVDGIFVAIGWDPNTAIVKDLVQLNERGYIVTDENMATNVPGLFAAGDIREKSLRQ
FT                   VVTAVADGAIAAVSAEKYLEEHQMR"
FT   gene            148072..149283
FT                   /locus_tag="Toce_0156"
FT   CDS_pept        148072..149283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0156"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COGs: COG0137 Argininosuccinate synthase; InterPro
FT                   IPR001518:IPR018223; KEGG: gyc:GYMC61_0760
FT                   argininosuccinate synthase; PFAM: argininosuccinate
FT                   synthase; PRIAM: Argininosuccinate synthase; SPTR:
FT                   Argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: Arginosuccinate synthase; TIGRFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06947"
FT                   /db_xref="GOA:D9S019"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D9S019"
FT                   /protein_id="ADL06947.1"
FT                   /translation="MKKVVLAYSGGLDTSVAIKWLKENYNCDVVALCADLGEGKDLEFI
FT                   KNKAERVGAIKCYVVDAKEEFIKNYAFFALKANALYEGVYPLSAALSRPLISKLLVDVA
FT                   RREGAFAVAHGCTGKGNDQVRFDVSVAALAPDLKVIAPVREWPMSREEEIEYAVNNGIP
FT                   VPVGRQNPFSIDQNLWGRSIECGVLEDPWVEPPEEVFQWTVSPEKTPDEPTYVEITFEK
FT                   GVPVALNGKEMAPVELVQELNKIAGNNGFGRIDHVENRLVGIKSREVYECPASLLLINA
FT                   HRNLESLTLPREVLHFKYGVERKYAELIYNGLWYSPLKEALDAFIDETQKVVSGTVKVK
FT                   LFKGSAMVVGRKSSRSLYDIKLATYSEEDLFEHRAAMGFITLWGLSTKVYARVNKKNEP
FT                   QTEG"
FT   gene            149288..150604
FT                   /locus_tag="Toce_0157"
FT   CDS_pept        149288..150604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0157"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COGs: COG0165 Argininosuccinate lyase; InterPro
FT                   IPR009049:IPR000362:IPR003031:IPR020557; KEGG: sth:STH486
FT                   argininosuccinate lyase; PFAM: fumarate lyase; SPTR:
FT                   Argininosuccinate lyase; TIGRFAM: argininosuccinate lyase;
FT                   PFAM: Lyase; TIGRFAM: argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06948"
FT                   /db_xref="GOA:D9S020"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D9S020"
FT                   /protein_id="ADL06948.1"
FT                   /translation="MSKKLWGGRFEKETDDLVEKFTASIDFDKRLYEQDIKGSMAHARM
FT                   LARAGIIPKEEAAEIIKGLLEIKLEIERGEFPFTCELEDIHMHVESRLFEKIGPVAGKL
FT                   HTARSRNDQVALDLHLYVKEKIAEVVGKIDELMKVLRKLAAENRDAVMPGYTHLQRAQP
FT                   VTLSRHLKAYYYMLRRDKERFSKALKGADIMPLGACALAGTTLPIDREYTGELLGFSRI
FT                   YENTIDAVSDRDFVIEFISCSAILMVHLSRMAEDLILWSTSEFDFIELDDAFATGSSIM
FT                   PQKKNPDVLELIRGKAGRVFGNLMSVLTVMKGLPLSYNRDMQEDKEPLFDTADTVIGCL
FT                   KVLPKLLSTMKIKKENMKKAVEESFSDATYYAEYLVKKGMPFRAAHEVVGKMVSYCIKK
FT                   NKKLSDLSLREFKNFSKLFDEDVLDLSRYPEKVKNKKVL"
FT   gene            complement(150787..151842)
FT                   /locus_tag="Toce_0158"
FT   CDS_pept        complement(150787..151842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0158"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR017846:IPR003200; KEGG: dae:Dtox_3581
FT                   nicotinate-nucleotide/dimethylbenzimidazolephosp
FT                   horibosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; PRIAM:
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase;
FT                   SPTR:Nicotinate-nucleotide/dimethylbenzimidazolepho
FT                   sphoribosyltransferase;
FT                   TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyltransferase;
FT                   TIGRFAM: nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06949"
FT                   /db_xref="GOA:D9S021"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D9S021"
FT                   /protein_id="ADL06949.1"
FT                   /translation="MKLLEEALKNIGDLDEISMKKAKERLDNLTKPRGSLGILEDLAVK
FT                   MAGIKRELYPKIKNKVITIMAGDHGVVEEGVSAFPQEVTPQMILNFLSGGAGINVLARH
FT                   AGAKIVCVDVGTAADVFHPDLIIKKVRRGTDNISRGPAMTREEAIKAIEVGIETAWNEI
FT                   DKGADILGTGDMGIGNTTPSSAILAVYSDEPLEKLVGRGTGINDERLKLKIKAINRALE
FT                   INQPDPNDPIGVLSKVGGLEIGAIAGCILGAASRRIPVVIDGFISTAGAIIAAKIEPLC
FT                   TNYMIASHSSEEPGHKTMLKLLGLEPMLSMRMRLGEGTGAALAFNLVEAALKIISEMAT
FT                   FDEAGVSGQLE"
FT   gene            complement(152187..152450)
FT                   /locus_tag="Toce_0159"
FT   CDS_pept        complement(152187..152450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rcu:RCOM_2121370 sugar transporter, putative;
FT                   SPTR: Sugar carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06950"
FT                   /db_xref="GOA:D9S022"
FT                   /db_xref="UniProtKB/TrEMBL:D9S022"
FT                   /protein_id="ADL06950.1"
FT                   /translation="MEDKVNDIIIEFIEVNIQPKFIIPKKIYRWLTETFGVKVIYIIFS
FT                   IILLVISYCGIVSLLKRKYDVFLMIIIAFFIVLGFMLTLLGW"
FT   gene            complement(152471..153772)
FT                   /locus_tag="Toce_0160"
FT   CDS_pept        complement(152471..153772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0160"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="COGs: COG1114 Branched-chain amino acid permease;
FT                   InterPro IPR004685; KEGG: ctc:CTC00787 branched-chain amino
FT                   acid transport system carrier protein; PFAM: branched-chain
FT                   amino acid transport system II carrier protein; SPTR:
FT                   Branched-chain amino acid transport system carrier protein;
FT                   TIGRFAM: branched-chain amino acid transport system II
FT                   carrier protein; PFAM: Branched-chain amino acid transport
FT                   protein; TIGRFAM: branched-chain amino acid uptake carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06951"
FT                   /db_xref="GOA:D9S023"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D9S023"
FT                   /protein_id="ADL06951.1"
FT                   /translation="MNKKLQDVIVIGFALFAMFFGAGNLIFPPSIGFQLSSKWFLGLLG
FT                   FMLTGIGLPLLGIITVALNEGSFDNFAGKAGKTFANALNFAIVLCIGPLLAIPRTGATT
FT                   YEMGIAPIMPDFNILLACLIYFAINIYFTINRSKVIDYIGKILTPTLLIMLAIIIIKGI
FT                   IDPIGGFTASKIPNAFGRSFMEGYQTMDALGSIILAGIIVNAVREKGYDKPGDQIKLTI
FT                   LSGLIAALGLLFVYGGLMYLGATASTLFDGEIGKTALLISIVEKEFGSFGKVALGLAVS
FT                   LACMTTSVGLTATAAEYFSRLTKNRISYKTMVVIISLFSAFMGAFGVEKIIKFSVPILV
FT                   SVYPVVIVLILMNAFGSFIKNNRCYVYATIFTLLISVVDGLSAAGLNVNKIYEVMYYLP
FT                   FAKEGFAWVYTAIFGIMLGMMHSAFNKTLEKENN"
FT   gene            complement(153980..155281)
FT                   /locus_tag="Toce_0161"
FT   CDS_pept        complement(153980..155281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0161"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="COGs: COG1114 Branched-chain amino acid permease;
FT                   InterPro IPR004685; KEGG: cno:NT01CX_2428 branched-chain
FT                   amino acid transport system II carrier protein; PFAM:
FT                   branched-chain amino acid transport system II carrier
FT                   protein; SPTR: Branched-chain amino acid transport system
FT                   II carrier protein; TIGRFAM: branched-chain amino acid
FT                   transport system II carrier protein; PFAM: Branched-chain
FT                   amino acid transport protein; TIGRFAM: branched-chain amino
FT                   acid uptake carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06952"
FT                   /db_xref="GOA:D9S024"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D9S024"
FT                   /protein_id="ADL06952.1"
FT                   /translation="MNKKFSDLMVIGFALFAMFFGAGNLIFPPSIGFQLSSKWFLGFLG
FT                   FMLTGIGLPLLGIIAMAQNEGSFDNFAGKAGKTFANALNFVIVLCIGPLLAIPRTGATT
FT                   YEMGIAPIMPDFNILLACLIYFAINIYFTINQSRVIDNVGKILTPTLLIMLAIIIIKGI
FT                   IDPIGGFTASKIPNPFGKSFLEGYQTMDALASTIFAGIIINAIKERGYNDVGDKIKLTI
FT                   LSGLIAALGLLFVYGGLMYLGATASTLFDGEIGKTVLLISIIEKEFGNFGKVALGLAVS
FT                   LACMTTSVGLTATAAEYFSRLTKNRISYKTMVVIISLFSAFMGAFGVEKIIKFSVPILV
FT                   SVYPVVIVLILMNAFGPFIKNNRCYVYATIFTLLISVVDGLSAAGLNVNKIYEVMYYLP
FT                   FAKEGFAWVYTAIFGIMLGMMHSAFNKTLEKENN"
FT   sig_peptide     complement(155210..155281)
FT                   /locus_tag="Toce_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(155470..156360)
FT                   /locus_tag="Toce_0162"
FT   CDS_pept        complement(155470..156360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0162"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: mmh:Mmah_1386 cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein; SPTR:
FT                   Cation diffusion facilitator family transporter; TIGRFAM:
FT                   cation diffusion facilitator family transporter; PFAM:
FT                   Cation efflux family; TIGRFAM: cation diffusion facilitator
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06953"
FT                   /db_xref="GOA:D9S025"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D9S025"
FT                   /protein_id="ADL06953.1"
FT                   /translation="MNERVENFKKIKKVLWAVLGLNLSVAFLKILVGYSISSSSMMADG
FT                   FHSLSDASTNIIGLIGAALASKPADATHPYGHGKFETFTATGIALMLFLVSFNIIKSGI
FT                   ERLLNPRIPEVNSFSLIIMFITLAVNIGVILYEDMEGKKLHSHILISDAAHTRSDLYVS
FT                   LSVIAGLIAVKLGYPIVDPLISFVIALLILKAGIEIIKDTSRVLCDAAVVDPEKIASLV
FT                   RNIRGVVDCHGVRTRGREDDFSMDLHILVNPSMTVEESHRLHHSIEEEIRRNFKGAHHI
FT                   LIHIEPYPDSSNQNT"
FT   gene            156753..157229
FT                   /locus_tag="Toce_0163"
FT   CDS_pept        156753..157229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0163"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="COGs: COG0782 Transcription elongation factor;
FT                   InterPro IPR006359:IPR001437:IPR018151; KEGG: cth:Cthe_2897
FT                   transcription elongation factor GreA; PFAM: transcription
FT                   elongation factor GreA/GreB domain protein; SPTR:
FT                   Transcription elongation factor; TIGRFAM: transcription
FT                   elongation factor GreA; PFAM: domain; Transcription
FT                   elongation factor, GreA/GreB, C-term; TIGRFAM:
FT                   transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06954"
FT                   /db_xref="GOA:D9S026"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D9S026"
FT                   /protein_id="ADL06954.1"
FT                   /translation="MPKKEVVLTQEGLRKLEKELEYLKSVKRKEVADRIKQAISFGDLS
FT                   ENSEYDEAKNEQAFVEGKIAMLEEKLRNAKVIDDADISTETVTLGSKVLIRDLDTEEAI
FT                   EYTIVSSAEANPIDFKISNESPVGKALMGAKKGDVIEISVPAGQVRYRVEEIKK"
FT   gene            157250..158722
FT                   /locus_tag="Toce_0164"
FT   CDS_pept        157250..158722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0164"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COGs: COG1190 Lysyl-tRNA synthetase (class II);
FT                   InterProIPR002313:IPR004365:IPR004364:IPR018149:IPR 006195;
FT                   KEGG: csc:Csac_0828 lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; SPTR: Lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetases
FT                   class II (D, K and N); OB-fold nucleic acid binding domain;
FT                   TIGRFAM: lysyl-tRNA synthetase, eukaryotic and
FT                   non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06955"
FT                   /db_xref="GOA:D9S027"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:D9S027"
FT                   /protein_id="ADL06955.1"
FT                   /translation="MGNLELEANEIIRARLQKLEELRSMGIAPYGQKYVRTHNCLEIKE
FT                   NFEKLEGSETSIAGRIMAIRGHGKAAFFDIQDEKGRLQIYIKKDHVGDEVYEIFKKLDI
FT                   GDIIGVEGKIFKTQKGEISVMADRITVLAKSLRPLPEKWHGLKDVDTRYRQRYLDLIVN
FT                   PDVRRTFVTRSKIIRAIRNYLDSRGFIEVETPVLTPLAGGAAARPFITHHNALDIDLYL
FT                   RIATELYLKRLIVGGFEKVYEIGKDFRNEGISIKHNPEFTMIELYQAYADYQDMMELTE
FT                   DMISHVAKEVLGTTKVVYQGEEIDLTPPWTRMTMVEAVKKYAGVDFNELKTDEEARAVA
FT                   RKLGLEVGDNDTRGKVLNTIFEEKVEEHLVQPTFILDYPIEISPLAKRKEDNPDFTYRF
FT                   ELFITRRETANAFSELNDPIDQRERFLQQLKEREAGDEEAHAFDEDFINALEYGMPPTG
FT                   GLGIGIDRLVMLLTDSYSIRDVILFPTMRPKS"
FT   gene            159043..160550
FT                   /locus_tag="Toce_R0001"
FT   rRNA            159043..160550
FT                   /locus_tag="Toce_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            160665..163627
FT                   /locus_tag="Toce_R0002"
FT   rRNA            160665..163627
FT                   /locus_tag="Toce_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            163724..163838
FT                   /locus_tag="Toce_R0003"
FT   rRNA            163724..163838
FT                   /locus_tag="Toce_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            164215..165573
FT                   /locus_tag="Toce_0165"
FT   CDS_pept        164215..165573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0165"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="InterPro IPR012854; KEGG: tit:Thit_2257 copper amine
FT                   oxidase domain protein; PFAM: copper amine oxidase domain
FT                   protein; SPTR: Copper amine oxidase domain protein; PFAM:
FT                   Copper amine oxidase N-terminal domain; Glycosyl hydrolase
FT                   family 26"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06956"
FT                   /db_xref="GOA:D9S028"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D9S028"
FT                   /protein_id="ADL06956.1"
FT                   /translation="MMRLKFVIWGLIFLLAWPVPAKAEPAFKQKPQDIRVLIEVEGYKL
FT                   AKYEPVEGTYLGAYVYQDTLIKGDMKEFNRLTGKKHASFFLYVGYGQKFPQWWIDQLKE
FT                   VGAAAHIAWEPNKGLDQVKDDEYLRGFARKLKEAGIPVFLRFASEMNGDWTAYSGDPKK
FT                   YIEKWRLVHDVMEQEAPNVMMVWTVFTFPQSTIIKYYPGDEYVDWVGVNIYNVVYHNNN
FT                   IKHKASHEDPLELLDYVYDTFSMRKPIQISEYGATHYTVTDGKYYEDFAIQKITRMYNG
FT                   IKTRYPRVKSIFYFNVNNLANAPEGRRINNYAITDNKRILGTYSELIEDPHFLSDIGPN
FT                   LEGRTDRELMHVRDGVHIVKGKIFVSSRVLKEYMKASVNWDSKKKQITIKKGERSAVLN
FT                   VVSYANVLRGAKGAFTLKGTSYLPLREAADALGYRVMWDNSEKLIKVVLADRT"
FT   sig_peptide     164215..164283
FT                   /locus_tag="Toce_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            165682..165939
FT                   /locus_tag="Toce_0166"
FT   CDS_pept        165682..165939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0166"
FT                   /product="SacI domain containing protein"
FT                   /note="KEGG: bmy:Bm1_49675 SacI homology domain containing
FT                   protein; SPTR: SacI homology domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06957"
FT                   /db_xref="UniProtKB/TrEMBL:D9S029"
FT                   /protein_id="ADL06957.1"
FT                   /translation="MLVDIHLKLQFSLKIDMHALGGFELDQPITGRDYIQILNRILKSD
FT                   YGDYKELLEEGIINDFVGLYKPKHKRAIRSINYLTSNIPH"
FT   gene            166205..167712
FT                   /locus_tag="Toce_R0004"
FT   rRNA            166205..167712
FT                   /locus_tag="Toce_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            167827..170789
FT                   /locus_tag="Toce_R0005"
FT   rRNA            167827..170789
FT                   /locus_tag="Toce_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            170886..171000
FT                   /locus_tag="Toce_R0006"
FT   rRNA            170886..171000
FT                   /locus_tag="Toce_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            171150..171311
FT                   /locus_tag="Toce_0167"
FT   CDS_pept        171150..171311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06958"
FT                   /db_xref="UniProtKB/TrEMBL:D9S030"
FT                   /protein_id="ADL06958.1"
FT                   /translation="MEARGENTEYLGAELQEENKKAKAGLPEMDFTVGSIPAHLIKFSI
FT                   PLTWPPGT"
FT   gene            171344..171733
FT                   /pseudo
FT                   /locus_tag="Toce_0168"
FT   gene            171954..172544
FT                   /locus_tag="Toce_0169"
FT   CDS_pept        171954..172544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0169"
FT                   /product="small GTP-binding protein"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterPro IPR005225:IPR002917:IPR006073; KEGG: geo:Geob_2253
FT                   ferrous iron transport protein B; PFAM: GTP-binding protein
FT                   HSR1-related; SPTR: Ferrous iron transport protein B;
FT                   TIGRFAM: small GTP-binding protein; PFAM: Ferrous iron
FT                   transport protein B; TIGRFAM: small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06959"
FT                   /db_xref="GOA:D9S031"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D9S031"
FT                   /protein_id="ADL06959.1"
FT                   /translation="MDCCSQKGNVLSRFFKRKQDNSFSHQNCNTRKKLVLVGTPNVGKS
FT                   VIFNRLTGAYVTVSNYPGTTVEIFRGTGRIGGEIFEIIDTPGMYSLMPITEEERVTRTL
FT                   LFNENFDIVVHVVDAKNIERMLSMTMQLKEAGLPVMLVVNMMDEAERLGRKIDLDRLSA
FT                   LLDIPVVGTSAALNRGMDQMRRKVAEYVKKRVA"
FT   gene            172522..173991
FT                   /locus_tag="Toce_0170"
FT   CDS_pept        172522..173991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0170"
FT                   /product="Ferrous iron transport protein B domain protein"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterPro IPR011619:IPR011642:IPR011640; KEGG: gem:GM21_2625
FT                   ferrous iron transport protein B; PFAM: Ferrous iron
FT                   transport protein B domain protein; nucleoside recognition
FT                   domain protein; Ferrous iron transport B domain protein;
FT                   SPTR: Ferrous iron transport protein B; PFAM: Ferrous iron
FT                   transport protein B C terminus; Nucleoside recognition;
FT                   TIGRFAM: ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06960"
FT                   /db_xref="GOA:D9S032"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D9S032"
FT                   /protein_id="ADL06960.1"
FT                   /translation="MSKNELLEHNVHPFKYHDDIEKALEEIEKLLKSNYKVSKRSVALL
FT                   LLQDDEEITELVRSRENSFPEIQEVINRTRKKFSEPLHFVITMQRQKKVDEIVSQVVKA
FT                   GDRSRSSIGSWLDRITVQPVTGIPILLLVLYFGLYKFVGEFGAGTLVDFIEGNIFENYI
FT                   NPWVNSAVQAYIPNRAVQELLAMEYGIITLGIRYAVAIILPIVGTFFLMFSVIEDSGYL
FT                   PRLALLVDRVFKSMGLNGRAVIPMTLGFGCDTMATLVSRTLETRRERVIATLLLALAIP
FT                   CSAQLGVILGLLSGRPAALAIWATFVVLVFLLVGYLAAQVLPGERPVFYMEIPPLRLPR
FT                   LGNIIEKTVSRMQWYFLEIVPIFIITSVLIWIGRMTGIFDALIRATEPLMQALGLPPET
FT                   AQAFLFGFFRRDYGAAGLYDLQKSGILNGAQMLVASVTLTLFVPCIAQFTVMLKERGVK
FT                   TTLAIVAFVFPFAFLAGYILNLILKLAGVVL"
FT   gene            173993..174178
FT                   /locus_tag="Toce_0171"
FT   CDS_pept        173993..174178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gem:GM21_2624 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06961"
FT                   /db_xref="UniProtKB/TrEMBL:D9S033"
FT                   /protein_id="ADL06961.1"
FT                   /translation="MKCGFCGYEFDEEERGARTCGGCPMSGRCGKVKCPRCGYEMVKPS
FT                   GLFKWLKRRREKINGR"
FT   gene            174168..174398
FT                   /locus_tag="Toce_0172"
FT   CDS_pept        174168..174398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0172"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: chy:CHY_2108 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06962"
FT                   /db_xref="GOA:D9S034"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D9S034"
FT                   /protein_id="ADL06962.1"
FT                   /translation="MAGERNLTQLKIGEQAVIAKINAPNGGILKKLMALGVLPGARVSL
FT                   VQKFPSYVIKVGNTQIAADETIAKSIIVIKN"
FT   gene            complement(174417..175421)
FT                   /locus_tag="Toce_0173"
FT   CDS_pept        complement(174417..175421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0173"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="COGs: COG0309 Hydrogenase maturation factor;
FT                   InterPro IPR011854:IPR000728:IPR010918; KEGG: tit:Thit_1341
FT                   AIR synthase related protein domain protein; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein; SPTR: AIR synthase related protein domain
FT                   protein; PFAM: AIR synthase related protein, N-terminal
FT                   domain; AIR synthase related protein, C-terminal domain;
FT                   TIGRFAM: thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06963"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D9S035"
FT                   /protein_id="ADL06963.1"
FT                   /translation="MKTGKVPPDILKKAVYPFLGQKRSEVLVHSGFGEDCCIIDFGEYV
FT                   AVVSTDPITGADTAGGYLAVFVACNDIAACGARPIGILVTLLLPEGSGEDTLLRIMENV
FT                   HKACQKIGIEVLGGHSEVTPAVTKPVISATAIGMAKRDNFVTSAGASPGDDVIVTKFIG
FT                   LEGTAVLALDFEEYLRGKLPGEVIKRAQSFVDDISVIQDGLTAAGAGATAMHDITEGGL
FT                   LGALWELAEASGVGMEIYRERIPILPETEAVCRAFELDPLGLISSGSMLICSGDGQKVV
FT                   DALREKSIPATVIGKVTDGGRFILDADKKIPIVPPERDELYRAIENVKNKKKN"
FT   gene            complement(175433..175924)
FT                   /locus_tag="Toce_0174"
FT   CDS_pept        complement(175433..175924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0174"
FT                   /product="protein of unknown function DUF1393"
FT                   /note="COGs: COG4720 membrane protein; KEGG: aco:Amico_1479
FT                   protein of unknown function DUF1393; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1393)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06964"
FT                   /db_xref="GOA:D9S036"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D9S036"
FT                   /protein_id="ADL06964.1"
FT                   /translation="MSESIKKLAFMGLFMALLVIATYLLSFPVPNFNLYFNLGESIIYL
FT                   VALIYGGIPAAVIGGVGSALADILKGYPVWAPITFFIKGIEGFIAGTFAQRSNPYTGVV
FT                   LGAAFMMTGYAIAAWRLYGIGAVPIELAGDFVQVSVGAVIALFLHRRLKKLSFEDKDNF
FT                   "
FT   sig_peptide     complement(175847..175924)
FT                   /locus_tag="Toce_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            176057..176311
FT                   /locus_tag="Toce_0175"
FT   CDS_pept        176057..176311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0175"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: UL26"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06965"
FT                   /db_xref="UniProtKB/TrEMBL:D9S037"
FT                   /protein_id="ADL06965.1"
FT                   /translation="MKGKSRTFSFKRAGGWCEPVRGYAEFRPEAAPSNMHSISRRCRPM
FT                   PLPTLSNKKGGTAGKSSRPYGERIFLFILLNIKREVMLC"
FT   gene            176305..177585
FT                   /locus_tag="Toce_0176"
FT   CDS_pept        176305..177585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0176"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COGs: COG0172 Seryl-tRNA synthetase;
FT                   InterProIPR002317:IPR015866:IPR002314:IPR018156:IPR 006195;
FT                   KEGG: tte:TTE0025 seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Seryl-tRNA synthetase,
FT                   class IIa-like; PRIAM: Serine--tRNA ligase; SPTR:
FT                   Seryl-tRNA synthetase; TIGRFAM: seryl-tRNA synthetase;
FT                   PFAM: Seryl-tRNA synthetase N-terminal domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06966"
FT                   /db_xref="GOA:D9S038"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D9S038"
FT                   /protein_id="ADL06966.1"
FT                   /translation="MLDIKMIRSNPDEVKRALEKRGTQANLEEFLKLDEERRNLLVEVE
FT                   QLKSLRNRESEEIARRKKQGEPADDLIRQMREVSDRIKEMDEKVKEIEEKLEQILLMIP
FT                   NIPDESVPVGESDADNVEMRRWGEPRKFDFEPKPHWELGEALDILDFERASKITGSRFV
FT                   VYKGAGARLERALINFMLDLHIEKHGYKEIFPPFIVNRASMTGTGQLPKFEEEAFKLFN
FT                   NTDYFLIPTAEVPVTNLHANEILEKEDLPIYYVAYSGCFRAEAGSAGRDTRGIIRQHQF
FT                   NKVELVKFTEPEKSMEELEKLTADAEEVLQLLGLPYRVVALCTGDLGFASSKTYDIEVW
FT                   MPSYNRYVEISSCSNFKDYQARRANIRYRPEKGAKPQYVHTLNGSGLAVGRTTAAILEN
FT                   YQQPDGSVVIPEVLRPYMGGMEVIAKK"
FT   gene            complement(177748..179223)
FT                   /locus_tag="Toce_0177"
FT   CDS_pept        complement(177748..179223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0177"
FT                   /product="transposase IS4 family protein"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; InterPro IPR002559; KEGG: tte:TTE2646
FT                   transposase; PFAM: transposase IS4 family protein; SPTR:
FT                   Transposase; PFAM: Transposase DDE domain; Transposase
FT                   domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06967"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D9RY67"
FT                   /protein_id="ADL06967.1"
FT                   /translation="MWGDEMLTKKNREIIKQVELVSIDSLVPQDHLLRAVEESIDFSFI
FT                   YEEVKDLYSENTGRPSIDPVVLIKLLMLQALYGIRSMRQTIREVEVNVAYRWFLGYGLQ
FT                   EKIPHFSTFGKNYERRFKESDLFEKIFERVLMEAIECGFVKTDAVFIDATHIKASANKN
FT                   KYIEKVAKQRTQKYKEELLKEINAEREANGKKPFEEEDDDDDNNKGENSSKKVRVSTTD
FT                   PESGMFQKGEKERCFAYTASVACDRNNFVLGVKIAPGNVHDSQVFSDLFQEVNDKFSKI
FT                   EAVVVDAGYKTPGICREIIEAGALPVMPYKRPMTKDGYFKKREYVYDEYYDCYICPNNQ
FT                   ILEYSTTNRAGYREYRSNPQICCKCPMRLQCTKSKNYTKIITRHIWEHYIEIAEDIRHT
FT                   QWGKELYKMRGQTIERVFADAKEKHGMRYTNLRGLRKVGHYLTLLFACMNLKKLALWKK
FT                   RRGTFPPTVPALHSFFLKIFFAFNKKPLLGYAS"
FT   gene            complement(179345..179587)
FT                   /locus_tag="Toce_0178"
FT   CDS_pept        complement(179345..179587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0178"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="InterPro IPR011437; KEGG: mta:Moth_0712 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1540; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of Unknown
FT                   Function (DUF1540)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06968"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D9S040"
FT                   /protein_id="ADL06968.1"
FT                   /translation="MARIHCSVSNCHYWKSGNICDASEIMITSDKLGDRMPDSFDAPQA
FT                   SNAPQTPVSSCMETCCKTFVESENAAKNIDGVYRK"
FT   gene            179727..180214
FT                   /pseudo
FT                   /locus_tag="Toce_0179"
FT   gene            180436..181236
FT                   /locus_tag="Toce_0180"
FT   CDS_pept        180436..181236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tit:Thit_0722 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2837)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06969"
FT                   /db_xref="GOA:D9S041"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:D9S041"
FT                   /protein_id="ADL06969.1"
FT                   /translation="MEKLIAVILFTATIHMIDTLSYSVRLAGIRTKRLAMALSLFNIIV
FT                   LVARTANMIQAPLLGSIVDRAIAGGQVGMLLKGFRIIILSATVGSIIGAALIPSFVEIF
FT                   SKGIMALERAGSVPGLLGTVVYQGSFRKIRRSLKKPGVGILKTLKLDRIPPTFLLLNLF
FT                   ITSVSTIGVLAAIYAGALVPDYRITASQLSGIINGAATILLAVVVDPQAAMITDQTLQG
FT                   LRERQEANTMVVLLVAGKILGTLLSQLIFLPASQIVVFITRAIV"
FT   gene            complement(181283..182674)
FT                   /locus_tag="Toce_0181"
FT   CDS_pept        complement(181283..182674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB1372 hypothetical protein; SPTR:
FT                   Hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06970"
FT                   /db_xref="GOA:D9S042"
FT                   /db_xref="UniProtKB/TrEMBL:D9S042"
FT                   /protein_id="ADL06970.1"
FT                   /translation="MTLAHWIYALGTLAVVITMILRRNVVIPCILSTFLIGMIFTGSLV
FT                   GAVTVVFKANLAALSELGSIFVIIGLMVAMLKSLSVTGADELLVSPLRKLMVSPLISYA
FT                   ILVLSTYIISLFFWPTPAVPLIGALLLPAAVKSGLPPMAAAVAIALAGQGMALSGDFVI
FT                   QGAPGLSAKSAGIPVPLVTSDGAILSLVTGITAIIIAYLMMRKDIEKFRPEGMKEAAAS
FT                   SEVDAAMQVHAKERKGQNFAPFLAVLLVVAIAAVIFSMFRFNIKGGDASALLGGAAVLI
FT                   MTVATLLVEGAMGLDKVADHLTDGFVFAFKVMGQILPIAGFFFLGNPEAVVKIMGEGAP
FT                   GYLFDIGKMLADLIPAHGFLAAFGMLIIGIITGLDGSGFSGLPLTGTLAGAMAAGNQSV
FT                   ASALAAIGQMGAVWSGGGTIIAWSSLVAVAGIAGEPVLDLVRKNFIPVTIGLVVSTIVA
FT                   VLFLM"
FT   gene            183038..183112
FT                   /locus_tag="Toce_R0007"
FT   tRNA            183038..183112
FT                   /locus_tag="Toce_R0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(183206..183991)
FT                   /pseudo
FT                   /locus_tag="Toce_0182"
FT   gene            184147..184485
FT                   /locus_tag="Toce_0183"
FT   CDS_pept        184147..184485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0183"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845; KEGG: cth:Cthe_1112 ArsR family
FT                   transcriptional regulator; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: Transcriptional
FT                   regulator, ArsR family; PFAM: Bacterial regulatory protein,
FT                   arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06971"
FT                   /db_xref="GOA:D9S043"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S043"
FT                   /protein_id="ADL06971.1"
FT                   /translation="MVLVVILKALADENRLRILNLLRKGELCVCEIEAILEITQSNASR
FT                   HLNKLKNAGIITYEKKSQWVYYKINETFVKDNALLFDYLNNYMDNNSQFLKDLQRLKEY
FT                   KNNRITCA"
FT   gene            184599..184919
FT                   /locus_tag="Toce_0184"
FT   CDS_pept        184599..184919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0184"
FT                   /product="Arsenical resistance operon trans-acting
FT                   repressor ArsD"
FT                   /note="InterPro IPR010712; KEGG: amt:Amet_1829 arsenical
FT                   resistance operon trans-acting repressor ArsD; PFAM:
FT                   Arsenical resistance operon trans-acting repressor ArsD;
FT                   SPTR: Arsenical resistance operon trans-acting repressor
FT                   ArsD; PFAM: Arsenical resistance operon trans-acting
FT                   repressor ArsD"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06972"
FT                   /db_xref="GOA:D9S044"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:D9S044"
FT                   /protein_id="ADL06972.1"
FT                   /translation="MKIEFYEPPMCCPTGLCGPTVDEKLVKLNENIEFLKKKYPGIEIQ
FT                   RYMITQQPLKFKENQSVYKLIQDKGKEALPITTFNGEVIKVGQYPSLEEMEKKIEESGR
FT                   QV"
FT   gene            184919..185806
FT                   /locus_tag="Toce_0185"
FT   CDS_pept        184919..185806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0185"
FT                   /product="arsenite efflux ATP-binding protein ArsA (TC
FT                   3.A.4.1.1)"
FT                   /EC_number="3.6.3.16"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; InterPro IPR003348; KEGG: amt:Amet_1830
FT                   arsenite-activated ATPase ArsA; PRIAM:
FT                   Arsenite-transporting ATPase; SPTR: Arsenite-activated
FT                   ATPase ArsA; TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase; TIGRFAM: arsenite-activated
FT                   ATPase (arsA)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06973"
FT                   /db_xref="GOA:D9S045"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S045"
FT                   /protein_id="ADL06973.1"
FT                   /translation="MRTKFIFFSGKGGVGKTSMACATAIYYADQGKKTLVVTTDPAANL
FT                   SDVFEQEIGHKVTKINGIENLYAMEIDPDKATEEYKERCLAPMRELFDEEMLKIAEEQL
FT                   SGPCTEEMAAFDKFIDFMEEDSYDMIIFDTAPTGHTIRLLELPVDWSRHIEESSKGSGQ
FT                   TCMGPVALIQESKKKYDDAVSKLRDLEQTDFIFVMQPEETSLKETIRSINELKEIGITT
FT                   TKIIVNGLIPKEEAINPFFKSRYDMQQTYLSKAKDIFNNIPIQTMELFDSELRGLEMFR
FT                   KVARRLFEGSDVHE"
FT   gene            185781..186692
FT                   /locus_tag="Toce_0186"
FT   CDS_pept        185781..186692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0186"
FT                   /product="arsenite efflux ATP-binding protein ArsA (TC
FT                   3.A.4.1.1)"
FT                   /EC_number="3.6.3.16"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; InterPro IPR003348; KEGG: amt:Amet_1831
FT                   arsenite-activated ATPase ArsA; PRIAM:
FT                   Arsenite-transporting ATPase; SPTR: Arsenite-activated
FT                   ATPase ArsA; TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase; TIGRFAM: arsenite-activated
FT                   ATPase (arsA)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06974"
FT                   /db_xref="GOA:D9S046"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S046"
FT                   /protein_id="ADL06974.1"
FT                   /translation="MKEVMCMSNIEKLIYPQNGKRKNIFFSGKGGVGKTSIACITAVQT
FT                   SKKGFKTLLITTDPAAHIGNVLDKPVMDEITKIDGVENLYAVKIDQRKATEEYKNAILE
FT                   DARKKFDINTVKAMEEELNSPCTEEMAAFQKFIDYACEENFDVIVFDTAPTGHTLRLLE
FT                   LPLDWSKQIQLKAGLTAEISEADKAQKERFDKVIEMMKDKETTTFSFVMYPEKTPIIEA
FT                   YRASKELETIGIKTQLVVVNMIIPEEQAITPFFKNRRNMQMKYIEEIKERFKEAEILQV
FT                   PLFEKEIKGLKMLTQISKILFS"
FT   gene            186806..187039
FT                   /locus_tag="Toce_0187"
FT   CDS_pept        186806..187039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_1832 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06975"
FT                   /db_xref="UniProtKB/TrEMBL:D9S047"
FT                   /protein_id="ADL06975.1"
FT                   /translation="MGEMYDEFVEFIQNSDVKDKVDIKFIDVMEDSLDGYDAVKTMLEK
FT                   GYGMPLTAVNGRLRFYGGISNEMFYEEIKKHL"
FT   gene            187335..188564
FT                   /locus_tag="Toce_0188"
FT   CDS_pept        187335..188564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0188"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG4584 Transposase and inactivated
FT                   derivatives; InterPro IPR001584:IPR000169:IPR017894; KEGG:
FT                   chy:CHY_1117 ISChy4, transposase; PFAM: Integrase catalytic
FT                   region; SPTR: ISChy4, transposase; PFAM: Mu transposase,
FT                   C-terminal; Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06976"
FT                   /db_xref="GOA:D9RYE7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYE7"
FT                   /protein_id="ADL06976.1"
FT                   /translation="MLGSGSIIMLHELRAMGKSIRAIARETGRSRNTVRKYLRAEGIPE
FT                   RKPHPKRGSKLDPYKDTIQELINLGIFNCEVIYERIKEEGYTGGRTILRDYVRQFRPPK
FT                   QVPAVCRYETKPGQQAQVDWGEYTYIDEETGEIRKLYVFVMVLGYSRAIYVEFTNRCDI
FT                   HTFIRCLIRGFEYFGGVTDIVLTDRMKTVILGTGENRKPIWNSIFEDLAVTLGFTPKVC
FT                   RARRPQTKGKVESGIDFVKSNFLPGRKFINYGDLNHQAIVWCEKKNRRIHGTTGEKPID
FT                   RLKEENLKPLPASDRYQKFLEEVRKVHKDGLLSFNGVRYGVPWQYSGKEVVVRDKNGKI
FT                   EILYDGKVIATHEKHYRSRTIVFLKGQYKGLKEAEGMFYPRPRAIKLSSLEVEKRSLGV
FT                   YESLLEVGTV"
FT   gene            188561..189331
FT                   /locus_tag="Toce_0189"
FT   CDS_pept        188561..189331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0189"
FT                   /product="IstB transposition helper protein"
FT                   /note="COGs: COG1484 DNA replication protein; InterPro
FT                   IPR002611:IPR001270:IPR003593; KEGG: chy:CHY_1116 ISChy4,
FT                   transposition helper protein; PFAM: IstB domain protein
FT                   ATP-binding protein; SMART: AAA ATPase; SPTR: ISChy4,
FT                   transposition helper protein; PFAM: IstB-like ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06977"
FT                   /db_xref="GOA:D9RYE8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYE8"
FT                   /protein_id="ADL06977.1"
FT                   /translation="MIDLEKARSHLEELGLLNAASFLDALLERAQRQNSTYLDFLNNLL
FT                   EAELAERQRRNIEVRSKLARLPYRKTLTEFDFAFQPSIDEKLIKELATMAFVHRVENVI
FT                   FLGPPGVGKTHLAVALAIEALSCGISVYFTSLSRLIEDLKKAYKESRLERRMRIYTRPK
FT                   LLVIDEVGYLPLDGLGSNLFFQLISARYEKGSIILTSNKGFGEWGELMGDPVLATAVLD
FT                   RLLHHAHIINIRGNSYRLKDRLKTGLYGNQHNNA"
FT   gene            complement(189379..190233)
FT                   /locus_tag="Toce_0190"
FT   CDS_pept        complement(189379..190233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0190"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: cdl:CDR20291_1072
FT                   integrase, catalytic region; PFAM: Integrase catalytic
FT                   region; SPTR: Integrase, catalytic region; PFAM: Integrase
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06978"
FT                   /db_xref="GOA:D9S050"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9S050"
FT                   /protein_id="ADL06978.1"
FT                   /translation="MLLEQKHYPVSALCKITGISRSAYYKWRHREKSQNELQNEKLLVL
FT                   IREAYEERDGILGYRQMTIKLRREHQLKVNHKRIYRLMKVMGLKSVCRKKKYNYIKSTP
FT                   EVIAENVLNRDFKAEHTCEKWLTDVTEFKYGNGQKAYLSAILDLADRSIVSYVIGHSNN
FT                   NALVFETFDLAVASHPDAKPIFHSDRGFQYTNKTFKSKLDKAGMTQSMSRVGRCIDNGP
FT                   MEGFWGILKSEMYYLHKFDDYDSLKKAIEEYIDYYNTRRYQKRLKCMTPIEYRNYLSIA
FT                   DLN"
FT   gene            complement(190272..190955)
FT                   /locus_tag="Toce_0191"
FT   CDS_pept        complement(190272..190955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0191"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: cbi:CLJ_B3075 transposase;
FT                   PFAM: transposase IS3/IS911 family protein; SPTR: Putative
FT                   uncharacterized protein; manually curated; PFAM:
FT                   Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06979"
FT                   /db_xref="GOA:D9S051"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:D9S051"
FT                   /protein_id="ADL06979.1"
FT                   /translation="MSRKPKVSFEQKLSAVKDYLKGRKTQRQIAKEYNVDHSSVRRWIS
FT                   NYQAMGESGLITSSKNTSYSQELKYTAVKEYLSGNASKLDICKKYKIRSTKQLSDWVLK
FT                   YNGHERLKSSGSGGKPIMTKGRNTTLEERIQIVKYCLEHNRNYIETAEKYQVSYQQVRS
FT                   WVIKYDKSGVDALIDRRGKRKSEDEFTEMDRLKAQNKLLEARNRWLEMENEVLKKLQEI
FT                   EGGRY"
FT   gene            complement(191205..192623)
FT                   /locus_tag="Toce_0192"
FT   CDS_pept        complement(191205..192623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0192"
FT                   /product="glycosyltransferase"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; KEGG: mta:Moth_1831
FT                   glycosyltransferase; SPTR: Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06980"
FT                   /db_xref="GOA:D9S052"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9S052"
FT                   /protein_id="ADL06980.1"
FT                   /translation="MTLPEKIYLFSVGLYIFFFLLFLRYFLWQHYAKKHYWSRRRLITL
FT                   FELKKLAREKQKKLPMFSILVPAREEAEVIGQTIEHLARLNYPHHLLEIIVITDEKELQ
FT                   KGEPVTTQQVVEAKIREFRKRKSAPILKHVIVPYDFDGYFGGTCTGSAVPSTKGRALNY
FT                   GLSFIDKNSDICGFYDAESHPELDVLLYIAYRWLISDKKDLIWQGPVFQVRNFFFLSPI
FT                   TKIASLYQALAHEWYLPVLMRQLPFVGGTNLFIESKLLKEIGGFDFNALTEDLEIGVRA
FT                   FLERNAWPEYFPYVSTEQTPQSYRAFFRQRLRWASGHIQVVEKFKDASGYDNAKRNRII
FT                   RTLLLKGEVEWVLYQLAVLVPPTILLLSLQGLIKPVMLPEFLQYILKSFVFIYFGFTYY
FT                   IYFRYSGYMKSRGLTKKLLALIELLILPVAAFLLPLPYSCAIVLRSLNRQPKAWCKTPR
FT                   TREATDIAPTMHSQ"
FT   gene            192917..193834
FT                   /locus_tag="Toce_0193"
FT   CDS_pept        192917..193834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0193"
FT                   /product="extracellular solute-binding protein"
FT                   /note="COGs: COG2998 ABC-type tungstate transport system
FT                   permease component; KEGG: mta:Moth_0067 extracellular
FT                   solute-binding protein; SPTR: Extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06981"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D9S053"
FT                   /protein_id="ADL06981.1"
FT                   /translation="MYRIRICKIVFLLVLSLTLGVFLAACGQKAPSEGNLGKNSESGEV
FT                   ILATTTSTQDSGLLDVLIPIFEQKTGYKVKIIPVGTGQALAMGEKGNADVMLVHAPEDE
FT                   IELVEKGAAINRRLVMHNDFVIVGPAEDPAGIKNAKDAAEAFKLIAEKEALFISRGDNS
FT                   GTHKKELDIWKKAGIENPSGKWYQSTGQGMGATLDVASEKSGYTLTDRATYLAKKDKLH
FT                   LVILKEKDGSLINIYHVMQANPDYVKQSNPDAAGMINVEGARAFVEFMVAPETQKIIGE
FT                   FGKDKFGQPLFIPDAGKSEDNILE"
FT   sig_peptide     192917..192997
FT                   /locus_tag="Toce_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            193853..194560
FT                   /locus_tag="Toce_0194"
FT   CDS_pept        193853..194560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0194"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4662 ABC-type tungstate transport system
FT                   periplasmic component; InterPro IPR000515; KEGG:
FT                   gur:Gura_3543 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06982"
FT                   /db_xref="GOA:D9S054"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9S054"
FT                   /protein_id="ADL06982.1"
FT                   /translation="MEAVMDGVKRALILLFTLDKEVYQITLFTLKVTGTATLISVVLSL
FT                   PLAFLIALKDFPGKRLIISLANLGMGLPPTVVGLWVSLMLWRSGPFGRLRLIYTPKAMI
FT                   IAQAVIAAPVILALSTAALQQLDKKLRWQIMALGATPIQMLFLMIREARYSLLAAVMAG
FT                   FGAAVSEVGASMMVGGNIAGYTRVLTTAIVLETGKGNFDEALALSFILLLVSYLGTLWL
FT                   TLLQQRRHKDVYN"
FT   gene            194547..195287
FT                   /locus_tag="Toce_0195"
FT   CDS_pept        194547..195287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0195"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: mta:Moth_0069 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06983"
FT                   /db_xref="GOA:D9S055"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S055"
FT                   /protein_id="ADL06983.1"
FT                   /translation="MYIIEGFDIQVRLKDKVLLDVNRVRLKRGEVFAVIGPNGAGKSTL
FT                   LRVLALLQSPHKGEIYFAGEKVKPRDGIRLRRRMAVVFQEPLLLDTTVIDNVAVGLRIR
FT                   GMPAKAAREKAEYWLEKFKVGKLSNRWVGSLSGGEAKRVSLARAFALEPEVLFLDEPFE
FT                   NLDAPLREALLADFSEVLRTTGITTFFVSHNLREVVLLADRVMALMEGRTVQEGAPREL
FT                   IDNPANEELARFVGVWKRIMPGFF"
FT   gene            195380..195964
FT                   /locus_tag="Toce_0196"
FT   CDS_pept        195380..195964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0196"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG1238 membrane protein; InterPro IPR015414;
FT                   KEGG: drm:Dred_2300 hypothetical protein; PFAM: SNARE
FT                   associated Golgi protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06984"
FT                   /db_xref="GOA:D9S056"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D9S056"
FT                   /protein_id="ADL06984.1"
FT                   /translation="MTLVFMGELMDFFFRNGPLGLFIIAFTEATFFPIPPDVVLVYMAM
FT                   VLPSKAYYYALITSIGSTLGGVFGYFLGVRFGRPLLMRFVKDSNFDRMEDMFQRYGAWA
FT                   VAIAGFSVLPYKVFTIAAGVFRLDLMAFIIASLLSRSALYFLEAALVVIMGEKAPGLID
FT                   MILGPGSFVVIAATVLVYLAYKKWRNKKHKV"
FT   gene            196125..197456
FT                   /locus_tag="Toce_0197"
FT   CDS_pept        196125..197456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0197"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119; KEGG: tit:Thit_0105 S-layer
FT                   domain protein; PFAM: S-layer domain protein; SPTR: S-layer
FT                   domain protein; PFAM: S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06985"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D9S057"
FT                   /protein_id="ADL06985.1"
FT                   /translation="MKKLIAGLLMIMLVVSLAAPVAQAKPKPCFKDVDERFEWARFSIE
FT                   KMYAKGIIKGFPGGWFKPQDKVTHLQAIIMALRIMGWEDEVKKIKVLPKDVKNIKISGK
FT                   DGYYYVALAIEKGLVKPEELKNFRPNEPAKRYEVAKYIVRAIGKEEEAKQHMTEKLPFK
FT                   DAKAIPKDAVGYVYVMTELGLMKGYPGNVFQPNKPVTRAEMAVIINKLNDLLDEDDDKK
FT                   EIRSLVVSIDVEALTITVKEGDKTATYNVKEDVPVYINYKYGSLSSLEPGDEVKLIFND
FT                   KREVVFIQVVNKKVTATAKGILVDVDKSKNTVSLFTYSGEETGYVGILRESDIEGRHLE
FT                   LETIDDRFVLVGETDGLKDYIGKKIVVLGEINDGVSIYMRGQVLDVDEWFAVTEKNTIT
FT                   FDVTGGTLVEVEGKPASLSDLEEGVYAEVKAQGDTALSIKVIKE"
FT   sig_peptide     196125..196196
FT                   /locus_tag="Toce_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            197599..197772
FT                   /locus_tag="Toce_0198"
FT   CDS_pept        197599..197772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH3168 S-layer associated protein,
FT                   putataive"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06986"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D9S058"
FT                   /protein_id="ADL06986.1"
FT                   /translation="MGPAFRAKNALNITRAFAAPTKFTVSQRKYDWVWPYIEKMALMGV
FT                   IAGKGKNTFGTR"
FT   sig_peptide     197599..197652
FT                   /locus_tag="Toce_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            198351..198719
FT                   /locus_tag="Toce_0199"
FT   CDS_pept        198351..198719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0199"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: bcl:ABC3884 stage 0 sporulation
FT                   protein F; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver; SPTR: Response regulator
FT                   receiver protein; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06987"
FT                   /db_xref="GOA:D9S059"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9S059"
FT                   /protein_id="ADL06987.1"
FT                   /translation="MGYKRKILVVDDQEWVRKMLLEALAVLGYEAFGASSGPEALQLAV
FT                   EKEPDLAVIDVSIPGMDGLTLLSKFREKDLKIPGILISGNGEKNCIEKALKEGAFAYLV
FT                   KPFDIGDLEGLIKQALTS"
FT   gene            198745..199710
FT                   /locus_tag="Toce_0200"
FT   CDS_pept        198745..199710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0200"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661:IPR003594:IPR004358:IPR005467; KEGG:
FT                   bld:BLi00981 hypothetical protein; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SPTR: Sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06988"
FT                   /db_xref="GOA:D9S060"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9S060"
FT                   /protein_id="ADL06988.1"
FT                   /translation="MYYGQSEPNSELIRGQKIYEDLFTNKDYSIPGYPELFMKEGNHRI
FT                   VIKIQNEEDEENHHSFNINTTLVKNADGTVSVVITCEDEDNSEGVREDLKRRLSYLENL
FT                   SVIGELAASAVHEIKNPLFSIRGFLQIIDNSFSDDDKRKEYIRIMISEIDRLEGLVRDF
FT                   LMLAKTRARSKGSVIVCELIRDIAELYKNRMEMQNIKFSLMAEDESVCIPGNREQLEQV
FT                   FINLIQNALEAMENGGNIEVVVYRKNEKLVIEVRDEGKGISPEIEKKIFTPFFTNKKNG
FT                   TGLGLFLSKKIVEEHMGRIYFRSTEGKGTVFFLEFPLVKT"
FT   gene            199919..201184
FT                   /locus_tag="Toce_0201"
FT   CDS_pept        199919..201184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0201"
FT                   /product="transcription termination factor Rho"
FT                   /note="COGs: COG1158 Transcription termination factor;
FT                   InterProIPR004665:IPR011112:IPR011113:IPR000194:IPR
FT                   011129:IPR003593; KEGG: pth:PTH_2835 transcription
FT                   termination factor Rho; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; Rho termination
FT                   factor RNA-binding; Rho termination factor domain protein;
FT                   SMART: Cold shock protein; AAA ATPase; SPTR: Transcription
FT                   termination factor; TIGRFAM: transcription termination
FT                   factor Rho; PFAM: Rho termination factor, N-terminal
FT                   domain; Rho termination factor, RNA-binding domain; ATP
FT                   synthase alpha/beta family, nucleotide-binding domain;
FT                   TIGRFAM: transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06989"
FT                   /db_xref="GOA:D9S061"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D9S061"
FT                   /protein_id="ADL06989.1"
FT                   /translation="MLASELEKKTIAQLHEIAREKKIPGYYKYRKKELIIKIMEAMAAE
FT                   SGDSIAEGVLEVLPDGYGFLRIENYLPSDEDIYISPSQIRRFHLRTGDLISGRIRQPKE
FT                   GEKYRALLQVHAVNGLDPEHAVKRFHFDSLTPIFPQPKLTLEHDPEELSTRIIDIISPI
FT                   GKGQRALIVSPPKAGKTMMLKKIANALSKNHPDLELIVLLIDERPEEVTDMRRSVDGEV
FT                   VSSTFDEPPENHLRVADMVLERAQRLVESKKDVVILLDSITRLARANNLVVPPTGRTLS
FT                   GGLDPSALHKPKRFFGAARNIEEGGSLTIIATALVETGSRMDDVIYEEFKGTGNMEIHL
FT                   DRKLAERRIYPAIDIKKSGTRREELLLSKEELEAVWVLRKALAPLDTVEAASTLISRLK
FT                   RTKTNREFLENLAATLNELQLT"
FT   gene            complement(201190..201516)
FT                   /locus_tag="Toce_0202"
FT   CDS_pept        complement(201190..201516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0202"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="InterPro IPR004518; KEGG: tpd:Teth39_0442 MazG
FT                   nucleotide pyrophosphohydrolase; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; SPTR: MazG nucleotide
FT                   pyrophosphohydrolase; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06990"
FT                   /db_xref="GOA:D9S062"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:D9S062"
FT                   /protein_id="ADL06990.1"
FT                   /translation="MTCEKQSNFKVISLPRLNGLTPTLESTALKLMEEAGELAQAIGKF
FT                   RASSGENIKMDEKEVVDMMARELLDVAQVAVSMMFVLEENYQIDLDEKIRQHIEKLKAK
FT                   GYLK"
FT   gene            complement(201513..201968)
FT                   /locus_tag="Toce_0203"
FT   CDS_pept        complement(201513..201968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0203"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="InterPro IPR011642; KEGG: amt:Amet_1017 nucleoside
FT                   recognition domain-containing protein; PFAM: nucleoside
FT                   recognition domain protein; SPTR: Nucleoside recognition
FT                   domain protein; PFAM: Nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06991"
FT                   /db_xref="GOA:D9S063"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D9S063"
FT                   /protein_id="ADL06991.1"
FT                   /translation="MFEVLKEATVGSLLSIKQIAVIVIPIMVAMEFLKDLGALDRIANF
FT                   FSPLVRVFGMRKESGFPLIIGIIIGLSYGAGVIFRSAKEYQLPRRDLYLITYFLVAAHA
FT                   VFEDTAIFVALGVNGALLLTTRLLVAALFTFLASKLMRQELEEEVNL"
FT   gene            complement(201983..202420)
FT                   /locus_tag="Toce_0204"
FT   CDS_pept        complement(201983..202420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0204"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="InterPro IPR011642; KEGG: amt:Amet_1016 nucleoside
FT                   recognition domain-containing protein; PFAM: nucleoside
FT                   recognition domain protein; SPTR: Nucleoside recognition
FT                   domain protein; PFAM: Nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06992"
FT                   /db_xref="GOA:D9S064"
FT                   /db_xref="UniProtKB/TrEMBL:D9S064"
FT                   /protein_id="ADL06992.1"
FT                   /translation="MGSPSSSISLDTLRRGLQSGIEVTWQLARILIPVYFIVTFLKHTP
FT                   ILGVVTRLFAPLMGIFGLPGEAALVLVIGNLVNLYAAIGAMLSLSLSLKEITVLAIMLS
FT                   FCHSLPVETALAKNIGLSAVNVIAVRVGLAVLSGIAYNFIF"
FT   gene            202765..204384
FT                   /locus_tag="Toce_0205"
FT   CDS_pept        202765..204384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0205"
FT                   /product="carbon starvation protein CstA"
FT                   /note="COGs: COG1966 Carbon starvation protein predicted
FT                   membrane protein; InterPro IPR003706; KEGG: cbl:CLK_3760
FT                   carbon starvation protein CstA; PFAM: carbon starvation
FT                   protein CstA; SPTR: Carbon starvation protein CstA; PFAM:
FT                   Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06993"
FT                   /db_xref="GOA:D9S065"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D9S065"
FT                   /protein_id="ADL06993.1"
FT                   /translation="MNSLVLLILGAVLFLIAYATYGAYLARQWGLDPSRKTPAHELYDG
FT                   VDYVPANRYVLLGHHFASIAGAGPIAGPIQAAIFGWLPVYLWIVLGSIFVGGVHDFGSL
FT                   LASIRHRGKSIGEIIEANIGTSGKKLFNIFAWLTLILVVAAFASITAEAFAATPAAGTA
FT                   SVLFIFIAMLFGQLVYRRNAGLAVSTIIGVALIFLSVWIGYRYPFMQFDKTSWQYILLV
FT                   YIFFASVLPVWLLLQPRDYLNSFLLYAMLIGGAIGIILMHPTLQLSPFKGFTVLTGAGA
FT                   QYLFPMVFVTVACGACSGFHSLVGSGTTSKQLSSENDARFVGYGAMLIEGFLAIVALIS
FT                   VAYVSKAEGSPAEVFANGVAEFMTSFGVPADFGKVFITLAFTAFALTSLDTATRLARYI
FT                   FQEYFETEDGKRSLLTDKYVATLITIFVAYLLVTYGYQKIWPIFGSANQLLSALALLAL
FT                   TAWFVRTRRNPVMTFIPMIWMFAVTLSATVLLMKNFYVARNYVLVVLAAALFVLAIILM
FT                   AVTYTTLKGAKKSEKGTTFKAG"
FT   sig_peptide     202765..202821
FT                   /locus_tag="Toce_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            204462..204962
FT                   /locus_tag="Toce_0206"
FT   CDS_pept        204462..204962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0430 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06994"
FT                   /db_xref="UniProtKB/TrEMBL:D9S066"
FT                   /protein_id="ADL06994.1"
FT                   /translation="MDSGKYLEMLSKRLKPYFDLEKKRIISGERADLFARCHVKHVRTF
FT                   LTPKDVIDSYETNEYFVVKIFEGKLKEEALFLFDTFLKDIMKIYVTPGDGHMCSIINGV
FT                   MVLEEGLDGEVEKKIRGYSYEKSYLFSLKGWSRINLAAVDLKSGRIIPSRGAKKLEKLL
FT                   MPG"
FT   gene            205044..206774
FT                   /locus_tag="Toce_0207"
FT   CDS_pept        205044..206774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0207"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="COGs: COG3275 Putative regulator of cell autolysis;
FT                   InterProIPR011620:IPR003018:IPR010559:IPR003594:IPR 005467;
FT                   KEGG: amt:Amet_1377 signal transduction histidine kinase,
FT                   LytS; PFAM: histidine kinase internal region; 5TM Receptors
FT                   of the LytS-YhcK type transmembrane region; GAF domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; GAF domain
FT                   protein; SPTR: Signal transduction histidine kinase, LytS;
FT                   PFAM: Histidine kinase; 5TMR of 5TMR-LYT; GAF domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06995"
FT                   /db_xref="GOA:D9S067"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9S067"
FT                   /protein_id="ADL06995.1"
FT                   /translation="MVYSILAGLADRLGLFIVIAYLLSKNRAFKNLILKHRVSLLDKIL
FT                   LSAVFGAFGILGTYMGIPVYGALANSRAVGVIIGGLLGGPLVGVLSGFVAGFHRWAIDV
FT                   GGFTALACGLSTFTEGTIAGLLHRKLNHGKICWKTALFIGMALELLQMVIILLVAKPFS
FT                   AALALVKVIGFPMTSVNAIGIAIFIIIVENIFREQERVGAYQAQLALDIASETLPYLRQ
FT                   GLSEFSAYRTAKIIYEKADYDAVAITDNRQILAHIGVGEDHHRNGLKVLTRATRRALET
FT                   GECQIASNKEEIECSNGECPLKSAVIVPLVEKDRVIGCLKLYRTRDNSITSIDIRLAQG
FT                   LAQLFSTQLELSRMEHQARLLAKAELRALQSQINPHFLFNALNTIVSICRKDPEQARAL
FT                   LIYLGEFFRKNLSSGRELVPLEQEIEHVKAYLAIEQARFGERLKVVFEIDPVTGVMVPP
FT                   LILQPLVENAVKHGLLPKKEGGTVIIKAKNVTGGMEITVADDGMGMDEDTLKGILLHRV
FT                   SSDRIGLCNVNERLESLYGEESRLKVSSKPMLGTVVKFFIPAAAENWREADGAYGATGR
FT                   "
FT   gene            206746..207510
FT                   /locus_tag="Toce_0208"
FT   CDS_pept        206746..207510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0208"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="COGs: COG3279 Response regulator of the LytR/AlgR
FT                   family; InterPro IPR001789:IPR007492; KEGG: adg:Adeg_0898
FT                   two component transcriptional regulator, LytTR family;
FT                   PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; SMART: response regulator receiver; SPTR:
FT                   Transcriptional regulator, LytR/AlgR family; PFAM: Response
FT                   regulator receiver domain; LytTr DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06996"
FT                   /db_xref="GOA:D9S068"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D9S068"
FT                   /protein_id="ADL06996.1"
FT                   /translation="MELTVLLVDDESPARDELRYLLEAYPEINVVGEASSGQEAIDKII
FT                   ELNPDVVFLDIKLWDMDGFEVARRVFEKGRTPFIIFATAHDEYAVKAFEVNALDYILKP
FT                   FSAGRLEKTVQKIIDIFKNQRKREGVLRISEYLGMREKPSCNKLSFWKNERIYLICPED
FT                   ICYCVAVEKGSIVKAKQGEFNTTSTLSELEKKINSPNFFRTHKSYLVNLDRVKEIIPWF
FT                   NGTFILSIQGYEKDEVPVSRRQARILRRLFDI"
FT   gene            207673..207861
FT                   /locus_tag="Toce_0209"
FT   CDS_pept        207673..207861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0209"
FT                   /product="ferredoxin"
FT                   /note="InterPro IPR001080:IPR017900:IPR017896; KEGG:
FT                   chy:CHY_1120 ferredoxin; SPTR: Ferredoxin; PFAM: 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06997"
FT                   /db_xref="GOA:D9S069"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9S069"
FT                   /protein_id="ADL06997.1"
FT                   /translation="MKLYVDQDLCISCGLCIDACPSVFSWNDEGKSVAIDGEVPADAEN
FT                   EAREALENCPTEAIKEA"
FT   gene            complement(208133..209227)
FT                   /locus_tag="Toce_0210"
FT   CDS_pept        complement(208133..209227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0210"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COGs: COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp protein;
FT                   InterProIPR005905:IPR011127:IPR011095:IPR000291:IPR 011761;
FT                   KEGG: tpd:Teth39_0187 D-alanyl-alanine synthetase A; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; PRIAM:
FT                   D-alanine--D-alanine ligase; SPTR: D-alanine/D-alanine
FT                   ligase; TIGRFAM: D-alanine/D-alanine ligase; PFAM: D-ala
FT                   D-ala ligase C-terminus; D-ala D-ala ligase N-terminus;
FT                   TIGRFAM: D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06998"
FT                   /db_xref="GOA:D9S070"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D9S070"
FT                   /protein_id="ADL06998.1"
FT                   /translation="MEKLKVGVVFGGQSGEYEVSLMSATSIINAMDKSKYDIVPIGITK
FT                   DGRWHVFLGDVSKIQDGTWVDEAIPAFLPPDTGYKCAITLKDGIETRYHLDVIFPVLHG
FT                   PHGEDGTVQGVFELMNIPYVSSGVGPSAVCMDKVYTKKLLKQEGLPVVDFKVFYKKDLP
FT                   HKLTEMVEEVEKSFGYPCFVKPANLGSSVGITKAHDREELKNAIMHAAEFDRKLLVERF
FT                   IPAREIECSVLGNDDPVASVPGEIIPSEEFYSYTAKYFDGGKSKLLIPAPLAAEETEKI
FT                   RNLAVRAYKALDCTVMARVDFLISKITGVAYINELNTIPGFTKISMYPKLWEASGLPYK
FT                   ELIDRLIELAIERHHQKHALKLTL"
FT   gene            209484..209630
FT                   /locus_tag="Toce_0211"
FT   CDS_pept        209484..209630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0211"
FT                   /product="SMC domain-containing protein"
FT                   /note="KEGG: SMC domain-containing protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL06999"
FT                   /db_xref="UniProtKB/TrEMBL:D9S071"
FT                   /protein_id="ADL06999.1"
FT                   /translation="MEKNRIRVLEEERDRLLTQWMKNKENRIKLLVRIMELEEQIEALK
FT                   NSA"
FT   gene            complement(209653..210072)
FT                   /locus_tag="Toce_0212"
FT   CDS_pept        complement(209653..210072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0212"
FT                   /product="HEPN domain protein"
FT                   /note="COGs: COG2250 conserved hypothetical protein related
FT                   to C-terminal domain of eukaryotic chaperone SACSIN;
FT                   InterPro IPR007842; KEGG: chy:CHY_1716
FT                   nucleotidyltransferase/HEPN domain-containing protein;
FT                   PFAM: HEPN domain protein; SMART: HEPN domain protein;
FT                   SPTR: Nucleotidyltransferase/HEPN domain protein; PFAM:
FT                   HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07000"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D9S072"
FT                   /protein_id="ADL07000.1"
FT                   /translation="MTNVTLAESYLQKARVRLKMIKFLLEEEAYSDIIREAQEAVELAL
FT                   KGILRKIGVEPPKQHDVGYLLFEYRDKLPAEVAERVDKLASISKWLRKEREFSFYGDVD
FT                   FIPTLEYTREDAEKAYGDLKTVIEAAEKVILPKNK"
FT   gene            complement(210069..210560)
FT                   /locus_tag="Toce_0213"
FT   CDS_pept        complement(210069..210560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0213"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: chy:CHY_1716
FT                   nucleotidyltransferase/HEPN domain-containing protein;
FT                   PFAM: DNA polymerase beta domain protein region; SPTR:
FT                   Nucleotidyltransferase/HEPN domain protein; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07001"
FT                   /db_xref="GOA:D9S073"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D9S073"
FT                   /protein_id="ADL07001.1"
FT                   /translation="MLLESFSNTLNRVLEACRKIYGEDLITLAVFGSVARGTPNPDSDI
FT                   DLLIVARNLPSGRLKRMEQFAKVEELLIPWMDSLRKIGINTYLSPVIKTPEEVFAGSLL
FT                   FLDMIDDALILYDRENFFTRFLQEFSSKLKRLGAKKVVTGERWHWVLKPDYKHGEVFDI
FT                   "
FT   gene            210888..212039
FT                   /locus_tag="Toce_0214"
FT   CDS_pept        210888..212039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0214"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: dda:Dd703_3240
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR:
FT                   Iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07002"
FT                   /db_xref="GOA:D9S074"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D9S074"
FT                   /protein_id="ADL07002.1"
FT                   /translation="MDFQFFVPTRILFGRGRVREAGNYGKGLGKKALVVTGKSSARKSG
FT                   SLDKLTKSLEENGVEWVLFDGVEPNPLTTTIDRGAVFARENKVDLVIGLGGGSAMDTAK
FT                   GIAFAAANDGPIVDYMEGRTGEKALPLILIPTTSGTGSEANNIAVMTNPVTMVKKGFRN
FT                   PSIFAVVSIVDPDLTATMPRKVTASTGIDAFFHAVESILSLRCQPFTEILSLKAIELIY
FT                   NNIMKACADGKDSDSREAMALASTMAGMALGQSGVCLLHGMEHPLSSYYGASHGEGLAP
FT                   LAGAFLRFVKPFASERLAKVAKAMGLDVEGLSADEAAQKAVEAVEQMLKELGLPDSISQ
FT                   FGVKEEDIEKLAQHVYKYMGHNLETTPGSPGYEDIKRMYLESL"
FT   gene            complement(212075..213250)
FT                   /locus_tag="Toce_0215"
FT   CDS_pept        complement(212075..213250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0215"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="COGs: COG0426 flavoprotein; InterPro
FT                   IPR016440:IPR008254; KEGG: fpl:Ferp_1981 flavodoxin/nitric
FT                   oxide synthase; PFAM: flavodoxin/nitric oxide synthase;
FT                   SPTR: Flavodoxin/nitric oxide synthase; PFAM:
FT                   Metallo-beta-lactamase superfamily; Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07003"
FT                   /db_xref="GOA:D9S075"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9S075"
FT                   /protein_id="ADL07003.1"
FT                   /translation="MAAFKVSENVYWVGVNDWALKDFHGLYVPRGGSYNSYLILGEKKA
FT                   LIDTVYKRFTGDFIRKISEVTPLEEIDYVVANHSEVDHSSSLPEVLKAAPRAKVVTNKK
FT                   CQAMLQRLFGIPSNRFFPVKNGDKLSLGNFTLQFIEQPMVHWPETMFTYLMEEKVLFPC
FT                   DFLGTQMAASPLLVEDTSDFTADSRAYYTFIMRPFNEQVLKGVHKVRELSPQIVAPSHG
FT                   PVLKGTAVEQILKKYEIWSTSPETRKVVIPYVSLWGGTGRMAELIAEGVELAGVPVKVM
FT                   NLTSTPMSEVISEALEAKFLAVGSPTLVKGIHPLISAFLVFLEMIKPGNKKGMVFGTFG
FT                   WNGNAGKITHEMMEKMGVRMVEDPLLLYLTPTPEDCLLLIEKGKTIAAALE"
FT   gene            complement(213262..213765)
FT                   /locus_tag="Toce_0216"
FT   CDS_pept        complement(213262..213765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0216"
FT                   /product="Rubrerythrin"
FT                   /note="InterPro IPR003251:IPR009040; KEGG: tye:THEYE_A1650
FT                   rubrerythrin subfamily; PFAM: Rubrerythrin; SPTR:
FT                   Rubrerythrin subfamily; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07004"
FT                   /db_xref="GOA:D9S076"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9S076"
FT                   /protein_id="ADL07004.1"
FT                   /translation="MKEALEKALNFEKEGFEFYKKIAAEMQNPLAKRLFESLAEQEKEH
FT                   MKKIKEIYESLDFAASSNQPATAAGIEEELKKIFFELEESRRKMPLDHLEGYKLAMEME
FT                   KKGYNMYREFTQTAASESEKKFFEALMQEEKEHLNSLDNVYRFLTDTPTWYSEEESRVW
FT                   NWMV"
FT   gene            complement(213768..215012)
FT                   /locus_tag="Toce_0217"
FT   CDS_pept        complement(213768..215012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0217"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1251 NAD(P)H-nitrite reductase; InterPro
FT                   IPR013027:IPR000103; KEGG: hmo:HM1_0433 nad(p)h-nitrite
FT                   reductase, large subunit protein NirB, putative; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07005"
FT                   /db_xref="GOA:D9S077"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:D9S077"
FT                   /protein_id="ADL07005.1"
FT                   /translation="MGLYFYIRGEKMARLLILGNGIAAVSAAEAFRQHDSSTPITIVSE
FT                   EPHYAYYRLRLSKYLGENPSEEDMLIHQPGWYAENGIEVLLDRKAVSIDTVRCKVTLDD
FT                   GSDIGYSSLLIATGSSPFKPPVPGCELKGVFSIRTLDDVKNLYKYSKERNTGVVIGGGV
FT                   LGLEAAWSLAKKGKKIYVVEGNPYILSKQLDEQASEILKSLGEKAGIEFLLSNRLERVL
FT                   GDTEARGIVLRDGRELKVDFVILSTGVKPNTGLLEGSGIAVARGIIVDEFMRTNLEGVY
FT                   AAGDVAEYRGQVHGIWPMAREQGKTAGLNLAGIKTQYNEVVPSNYIKVFETEIFSAGDL
FT                   CKAGDAEAEILDFSPEENIYRKIFFKGNRAVGVILLGDVKAGTRMARGIKSGRHLPDSL
FT                   LKNTTFDEIIEKMEE"
FT   gene            complement(215027..215185)
FT                   /locus_tag="Toce_0218"
FT   CDS_pept        complement(215027..215185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0218"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="COGs: COG1773 Rubredoxin; InterPro
FT                   IPR004039:IPR001052:IPR018527; KEGG: tme:Tmel_0414
FT                   rubredoxin-type Fe(Cys)4 protein; PFAM: Rubredoxin-type
FT                   Fe(Cys)4 protein; SPTR: Rubredoxin; PFAM: Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07006"
FT                   /db_xref="GOA:D9S078"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:D9S078"
FT                   /protein_id="ADL07006.1"
FT                   /translation="MKKWVCSVCGYVYDPAIGDPENGIEPGTAFEDLPDDWVCPECGVG
FT                   KDMFEEE"
FT   gene            215533..216054
FT                   /locus_tag="Toce_0219"
FT   CDS_pept        215533..216054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0219"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="InterPro IPR003346; KEGG: cpo:COPRO5265_1367
FT                   transposase; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; SPTR: Transposase IS116/IS110/IS902 family
FT                   protein; PFAM: Transposase IS116/IS110/IS902 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07007"
FT                   /db_xref="GOA:D9S079"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9S079"
FT                   /protein_id="ADL07007.1"
FT                   /translation="MAQVIFAGIACEIALSLTLQNIEHLKRQIKSLDKVISRELKAIPQ
FT                   TLNTVKGLGDVSAAGIIAEIGNIKRFKNEASLAQYAGLTWTRYQSGDFDAEERRLTKSG
FT                   DKYLRYYLVKAANSLRVHNEEYKAYYKTKYQEVQKHQHKRALVLTARKLVRLVFALLSK
FT                   GQIYKGTVTI"
FT   gene            complement(216191..216948)
FT                   /pseudo
FT                   /locus_tag="Toce_0220"
FT   gene            217057..217581
FT                   /locus_tag="Toce_0221"
FT   CDS_pept        217057..217581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0221"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="COGs: COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase; InterPro IPR014048:IPR008332:IPR001497;
FT                   KEGG: tpd:Teth39_0207 methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; methylguanine DNA
FT                   methyltransferase ribonuclease domain protein; SPTR:
FT                   Methylated-DNA--protein-cysteine methyltransferase;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: 6-O-methylguanine DNA methyltransferase,
FT                   ribonuclease-like domain; 6-O-methylguanine DNA
FT                   methyltransferase, DNA binding domain; TIGRFAM:
FT                   O-6-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07008"
FT                   /db_xref="GOA:D9S080"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D9S080"
FT                   /protein_id="ADL07008.1"
FT                   /translation="MVYFRKINTAIGVIMVASTERGVCRIALPGENMESFINDLKKMYG
FT                   GAELVDESVRGKSSEINFLAEQELTAYFNRELKNFTVPLDLKGTEFQKKVWKEVMKIPY
FT                   GEVRSYGYIARAIGKPKACRAVGGANNRNPVPIIVPCHRVVGNDGSLVGYGGGLEMKSF
FT                   LLKLEGIKREF"
FT   gene            217605..217733
FT                   /locus_tag="Toce_0222"
FT   CDS_pept        217605..217733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0062 glycosylase; SPTR: Predicted
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07009"
FT                   /db_xref="UniProtKB/TrEMBL:D9S081"
FT                   /protein_id="ADL07009.1"
FT                   /translation="MVRSKDLMNWTGQEVVLDEHVYYGAADTCIGVAAVEKEKVKF"
FT   gene            217866..218141
FT                   /locus_tag="Toce_0223"
FT   CDS_pept        217866..218141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0223"
FT                   /product="Rubrerythrin"
FT                   /note="InterPro IPR003251; KEGG: hbu:Hbut_1530 hypothetical
FT                   protein; PFAM: Rubrerythrin; SPTR: Conserved archaeal
FT                   protein; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07010"
FT                   /db_xref="GOA:D9S082"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9S082"
FT                   /protein_id="ADL07010.1"
FT                   /translation="MSEEKVMHYEENCQMTLPEMLREGIIGELQAINQYERYARMTCYE
FT                   PARQLFQEIADDEKHHVAELMKMLAQCDKRQAEELRRAFMHHPGKY"
FT   gene            218405..219307
FT                   /locus_tag="Toce_0224"
FT   CDS_pept        218405..219307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0224"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG1732 Periplasmic glycine
FT                   betaine/choline-binding (lipo)protein of an ABC-type
FT                   transport system (osmoprotectant binding protein); InterPro
FT                   IPR007210; KEGG: gwc:GWCH70_0298 substrate-binding region
FT                   of ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM: Substrate
FT                   binding domain of ABC-type glycine betaine transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07011"
FT                   /db_xref="GOA:D9S083"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D9S083"
FT                   /protein_id="ADL07011.1"
FT                   /translation="MRKCVLLFISVLLIFSLTACSLGGRAEKGKIVVAGKKFTEQVILT
FT                   HLLAEYLKAKMDLDVQVKEGLGSTFILHQALVRGDVDLYVEYTGTGYLNILKNKYNPSQ
FT                   TPDEIYEATKKGYKEKYNIAWLKPLGFNNTYALALRKELADQLNVKTCSDLVKHSNKLV
FT                   FGADAEFFERSDGYDALVDTYGFNFKRAMNIDPDLQYEAAQKGDIDVITAFTTDARIKQ
FT                   FGLTVLKDDKNFFPPYYAVPIVRQEVLDANPGLEEALNKLEGILTDEKMMELNAQVNIE
FT                   GKSPKQVAIDFLKSEGLID"
FT   sig_peptide     218405..218461
FT                   /locus_tag="Toce_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            219333..220460
FT                   /locus_tag="Toce_0225"
FT   CDS_pept        219333..220460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0225"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG1125 ABC-type proline/glycine betaine
FT                   transport systems ATPase components;
FT                   InterProIPR005892:IPR003439:IPR000644:IPR003593:IPR 017871;
FT                   KEGG: gwc:GWCH70_0297 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   CBS domain containing protein; SMART: AAA ATPase; CBS
FT                   domain containing protein; SPTR: Glycine betaine/L-proline
FT                   ABC transporter, ATPase subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter; CBS domain; TIGRFAM: glycine
FT                   betaine/L-proline transport ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07012"
FT                   /db_xref="GOA:D9S084"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S084"
FT                   /protein_id="ADL07012.1"
FT                   /translation="MICFENVYKEYDDGFVALKNINLEIKKGELVTLIGPSGCGKTTTL
FT                   RMINRLTEPTSGTVYIDGQDISKIDPVELRRNIGYVVQQIGLFPHMTIAENIALVPKLK
FT                   KWKPSAYEKRVDELLDLVGLDPATFKHRYPAELSGGQQQRVGVIRALAAEPDIILMDEP
FT                   FSALDPISREQLQDDIVKLQEEIHKTIVFVTHDMDEAIKIANRIAIMKDGEIVQFDTPD
FT                   KILRHPANSFVRDFIGENRLVQDHTIVPKAKDLMYTSVVTTSPKRGLAEAFRLMKEKKV
FT                   DSLVVTDKNKSFLGVVTLKELEEHYQNENLLVADIADRDVPTLTIDADVTNVAEIFRNK
FT                   DVSAIPVLDGNRLVGIITRSSMMRGLAEWEFRKKQ"
FT   gene            220474..221115
FT                   /locus_tag="Toce_0226"
FT   CDS_pept        220474..221115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0226"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: gyc:GYMC61_1174 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07013"
FT                   /db_xref="GOA:D9S085"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9S085"
FT                   /protein_id="ADL07013.1"
FT                   /translation="MDLLNTFIERKQDILIAFQEHVFLSGIAMAIAIAVAVPLGIALTR
FT                   YKKLAEPIIGIAAIIQTIPSLALLGFMLPIFGIGKLPAIIALTLYALLPILRNTYTGIL
FT                   GVDPALIDVGKGMGMTSRQILWMVELPLSLPVIMAGVRTATVLTIGVAALATFIGAGGL
FT                   GDLIDRGLRVADRNLILAGAIPAAILAILFDLILRKVEDKVTPKGLKKQK"
FT   gene            221273..221614
FT                   /locus_tag="Toce_0227"
FT   CDS_pept        221273..221614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0227"
FT                   /product="PAS fold domain protein"
FT                   /note="InterPro IPR013767:IPR000014; KEGG: pgn:PGN_0746
FT                   hypothetical protein; PFAM: PAS fold domain protein; SMART:
FT                   PAS domain containing protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: PAS fold"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07014"
FT                   /db_xref="GOA:D9S086"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9S086"
FT                   /protein_id="ADL07014.1"
FT                   /translation="MEQKWVQKLPVAITVCDAEGKILYMNEKACKTFEKSGGADLIGKN
FT                   VLDCHPEPARSKLKNMLETQTKNCYTIEKNGVKKLIYQTPWYDENNNYEGFIEFSIEIP
FT                   FEIPHYIRK"
FT   gene            221707..222732
FT                   /locus_tag="Toce_0228"
FT   CDS_pept        221707..222732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0228"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="COGs: COG1035 Coenzyme F420-reducing hydrogenase
FT                   beta subunit; InterPro IPR007525:IPR017900:IPR017896; KEGG:
FT                   dps:DPPB80 related to F420H2-dehydrogenase, beta subunit;
FT                   PFAM: coenzyme F420 hydrogenase/dehydrogenase beta subunit
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   manually curated; PFAM: 4Fe-4S binding domain; Coenzyme
FT                   F420 hydrogenase/dehydrogenase, beta subunit C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07015"
FT                   /db_xref="GOA:D9S087"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9S087"
FT                   /protein_id="ADL07015.1"
FT                   /translation="MPKVKEGFVNHDKCINCGLCEKVCPVLNNTPVNNEPKAYACINKD
FT                   EKIRMDSSSGGTFTLIAEQVINSGGVVFGAGFDEDFTVVHSYAESRESLSNFHGSKYVQ
FT                   SKIGDMYKQAEKFLKQRRQVLFTGTPCQIAGLKSYLRKLYDNLLCVDFICFGVPSTKVW
FT                   KKYISYHENNIGAPVRRVSFRNKKQGWKRFSMFLSFDNGMKHIESFDKDFFMQAFLKKI
FT                   CLRPSCHACNFKTLHRQSDITLADFWGVQNLLPEMDDDKGTSLVFINSHRGELIFEQIK
FT                   DKLLYNMVDLNEAVRYNLSAVKSVKQHPNRENFFKELDLISFDALVKKYIQFNVSKIKE
FT                   N"
FT   gene            223088..223282
FT                   /locus_tag="Toce_0229"
FT   CDS_pept        223088..223282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0229"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="KEGG: fjo:Fjoh_0023 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07016"
FT                   /db_xref="UniProtKB/TrEMBL:D9S088"
FT                   /protein_id="ADL07016.1"
FT                   /translation="MEKGKRYLLFLKATDSPGVYSIVSLNQGKFNIDNLDTKEKELEQK
FT                   DGQFKTLKQDVLNKFNSRI"
FT   gene            complement(223366..224842)
FT                   /pseudo
FT                   /locus_tag="Toce_0230"
FT   gene            225510..226643
FT                   /locus_tag="Toce_0231"
FT   CDS_pept        225510..226643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0231"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase"
FT                   /note="COGs: COG0240 Glycerol-3-phosphate dehydrogenase;
FT                   InterPro IPR004455:IPR003421; KEGG: hor:Hore_09740 NAD/NADP
FT                   octopine/nopaline dehydrogenase; PFAM: NAD/NADP
FT                   octopine/nopaline dehydrogenase; NADP oxidoreductase
FT                   coenzyme F420-dependent; SPTR: NAD/NADP octopine/nopaline
FT                   dehydrogenase; PFAM: NAD/NADP octopine/nopaline
FT                   dehydrogenase, alpha-helical domain; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07017"
FT                   /db_xref="GOA:D9S089"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S089"
FT                   /protein_id="ADL07017.1"
FT                   /translation="MIKRPEEVRYTVIGAGNGGLAMAGYLGLMGFTVNLYNRSEEKIRE
FT                   LIKDPKIHLTGAVEGEGRLSVVTTDIREAIDGSDIIMVTTPATAHRELAEQMAPYIKDD
FT                   QIIVLNPGRTCGALEVYETLRKSGCTKNVIVAEAQTFIYACRATGPSSAKIFSVKNEVK
FT                   LSAIPAKKTWMVIRLLSAAYPQFKPARDVMETSLNNFGAIFHPAPTLLNSGHIERGQTF
FT                   EYYLEGITPSIGQMLEKLDAERMKVARALGVKAISAMQWLEDSYGARGNSIYEAIQNNP
FT                   AYKGLTAPKDLKTRYIYEDVPFSLVPISSLAKNLGIETPAIDTIIRLANMMTGVNFWEQ
FT                   GRTVDKLGLAGLSPAEIHEFAQNGYLEIKRTEEEVVA"
FT   gene            226643..228289
FT                   /locus_tag="Toce_0232"
FT   CDS_pept        226643..228289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0232"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="InterPro IPR006158; KEGG: tte:TTE0924 methionine
FT                   synthase I cobalamin-binding subunit; PFAM: cobalamin
FT                   B12-binding domain protein; SPTR: Methionine synthase I,
FT                   cobalamin-binding domain protein; PFAM: B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07018"
FT                   /db_xref="GOA:D9S090"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D9S090"
FT                   /protein_id="ADL07018.1"
FT                   /translation="MKRILGATIGSCVHVAGVMNFLSLAEREGYEVEFLGAAVSIDELI
FT                   AAVKERMPDYVGVGYRLTPEPLREVLKELKEKIKAHGLDSGIKWIFGGTEPTAKVAEES
FT                   GIFTKIFNGLEDIDEVIGFLKGYRRSTEETYPEDLISRIESKYPYPILRHHLGLPSLEA
FT                   TIEAIEKVAEAKVLDVISIAPDQNAQEYFFEQDKMDRRLDGAGGVPVRSREDFLALYRA
FT                   SRRGNYPLLRCYSGTSHLIEFAELLNETIKNAWCAVPLCWYNVLDKRGPRLLRDSIREN
FT                   QQVMKWHGERGIPVEVNESHHWSLRDAHDTVGVATAFLAAYNAKKMGVKHYIAQYMFNV
FT                   PPSLSPRMDLAKMLAKIELIESLQDENFRVYRQARAGLASFPGDLAQAKGQLASSAYLA
FT                   MAIKPHIYHVVGFCEAHHAATAEDIIESCKIVRGVIRNAFLGLPDLVNDPVVQERKKQL
FT                   VDEAMITLEAIKRLNPGAEDPWTDPDTIARAVELGILDAPHLKGNPAACGKLVTRLVDG
FT                   ALYAYDPEENRVLTETERIEKIFKRAEITVS"
FT   gene            complement(228332..228571)
FT                   /locus_tag="Toce_0233"
FT   CDS_pept        complement(228332..228571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pth:PTH_2680 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: YKOF-related
FT                   Family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07019"
FT                   /db_xref="InterPro:IPR011522"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D9S091"
FT                   /protein_id="ADL07019.1"
FT                   /translation="MISCEVSIYPMETQNSDQVINQALASIKDKGVTCQVGTISTYISG
FT                   PPEKVWECIRTLYDAASARSKELSMVVTISNSQE"
FT   gene            complement(228590..228778)
FT                   /locus_tag="Toce_0234"
FT   CDS_pept        complement(228590..228778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0234"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="InterPro IPR012610; KEGG: gym:GYMC10_5313 small
FT                   acid-soluble spore protein, H-type; PFAM: small
FT                   acid-soluble spore H family protein; SPTR: Small
FT                   acid-soluble spore protein, H-type; TIGRFAM: small
FT                   acid-soluble spore protein, H-type; PFAM: Small
FT                   acid-soluble spore protein H family; TIGRFAM: small
FT                   acid-soluble spore protein, H-type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07020"
FT                   /db_xref="GOA:D9S092"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/TrEMBL:D9S092"
FT                   /protein_id="ADL07020.1"
FT                   /translation="MDFQRAQEILNSSDTYEVFYQGKLVWIKGLNPDDNTADVEILGEK
FT                   IHTKVPVNELVEGGSFY"
FT   gene            228916..229695
FT                   /locus_tag="Toce_0235"
FT   CDS_pept        228916..229695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0235"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="COGs: COG0682 Prolipoprotein
FT                   diacylglyceryltransferase; InterPro IPR001640; KEGG:
FT                   tpd:Teth39_0751 prolipoprotein diacylglyceryl transferase;
FT                   PFAM: prolipoprotein diacylglyceryl transferase; SPTR:
FT                   Prolipoprotein diacylglyceryl transferase; PFAM:
FT                   Prolipoprotein diacylglyceryl transferase; TIGRFAM:
FT                   prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07021"
FT                   /db_xref="GOA:D9S093"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:D9S093"
FT                   /protein_id="ADL07021.1"
FT                   /translation="MLIDVSPYAFKIGPIAVHWYGIFMAISFLVGSYYLYTMGRKLRLD
FT                   EDFLLNLAMIVIISGVIGARLMFVLTNYPEWFLKDPVQVLKIWEGGLSWHGALLGGFLA
FT                   GWPYCRRHGVNPNMIADWTVLGLSFGYIIVRIGNIFNQEVLGRMTEFSFGRWPAQLIGS
FT                   FIGLILLIRFLYLQTKKLPPGYQFWSFIWYHQILRALIEETVRDNPLFLIHYVNDHWGI
FT                   GFLTLTQLITPFVVAFAYYMYKSTGGYGYGGYRRNWY"
FT   gene            229817..231031
FT                   /locus_tag="Toce_0236"
FT   CDS_pept        229817..231031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0236"
FT                   /product="protein of unknown function DUF819"
FT                   /note="COGs: COG5505 integral membrane protein; InterPro
FT                   IPR008537; KEGG: cdl:CDR20291_1543 hypothetical protein;
FT                   PFAM: protein of unknown function DUF819; SPTR: Putative
FT                   membrane protein; PFAM: Protein of unknown function
FT                   (DUF819)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07022"
FT                   /db_xref="GOA:D9S094"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:D9S094"
FT                   /protein_id="ADL07022.1"
FT                   /translation="MTLIKPDDAWSLWAVLIGWAAVSILLEQKYDWAAKISGAVIALFG
FT                   ALILANLNIIPTESPVYDAVWSYVVPVAIPLLLFKANIRKIWTESGRMILAFWPAALGT
FT                   CVGAFVATVLLKNVIPELGKIGGIMTASYIGGGVNFVAMTAVFKPQESLLNATIVSDNL
FT                   VMAAFFLLYMYIPTLKYFQKNFKILYPDGGIATINTEAETKAAAYWGRKEISLKDIATA
FT                   MAVGVAVAAISKKLSILLGAVMPGGNFLFDMLKIMVSNQYFLITTITVTLVTIFSDFFE
FT                   NINGAQELGTFLIYIFFVVIGVPASIKEIILKSPALLLFCVIMAFFNLIFSLYGNKFLN
FT                   ISLEESLLASNATIGGPTTAAAMAISRGWSNHIIPALLCGIWGYVTGNYFGLFMGNWLI
FT                   RILGQ"
FT   gene            complement(231089..231739)
FT                   /locus_tag="Toce_0237"
FT   CDS_pept        complement(231089..231739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR009501; KEGG: gur:Gura_4126 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07023"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9S095"
FT                   /protein_id="ADL07023.1"
FT                   /translation="MGFTQELVSWSYEQKCQKAVESLKKRGFTAVYCKTGQEAVDYIIR
FT                   EAKEASTIGFGGSMSIADLKIADTLREMGKELLIHGAPGLSPEERLSVMRRQLTCDLFL
FT                   TSTNALTMTGCLVNIDGTGNRAASMFFGPKKVIVVAGRNKLVSDTEEALKRIKMYAAPP
FT                   NAKRLNYQTPCAKTGFCADCDSPDRICRITTILERKPRLTDIHVLVINEDLGF"
FT   gene            complement(231884..231961)
FT                   /locus_tag="Toce_R0008"
FT   tRNA            complement(231884..231961)
FT                   /locus_tag="Toce_R0008"
FT                   /product="tRNA-Arg"
FT   gene            232144..232716
FT                   /locus_tag="Toce_0238"
FT   CDS_pept        232144..232716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0238"
FT                   /product="Protein of unknown function DUF2284,
FT                   metal-binding protein"
FT                   /note="COGs: COG5423 metal-binding protein; InterPro
FT                   IPR019271; KEGG: pth:PTH_2051 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2284, metal-binding; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted
FT                   metal-binding protein (DUF2284)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07024"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D9S096"
FT                   /protein_id="ADL07024.1"
FT                   /translation="MDLLTKFKDAEKLLEFALGCEGVTEAKLIAVRDVVVDERVRFQCS
FT                   HSGCREYGKRFMCPPHVPGVDEFRKVLSNYIMALLIQVQGSAKGEGADEEATRLALLLH
FT                   DAVYRTEKRAFSLGFSFAAGLTGGPCRLCEECPVTKDSGAFCVKRDRVRPPMEAMGIDV
FT                   FKTCKNAGMEMAFTPGKVIWTGMVLLD"
FT   gene            232741..234153
FT                   /locus_tag="Toce_0239"
FT   CDS_pept        232741..234153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0239"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="COGs: COG3858 glycosyl hydrolase; InterPro
FT                   IPR012854:IPR001223:IPR011583:IPR001579; KEGG:
FT                   swo:Swol_1871 glycosyl hydrolase-like protein; PFAM: copper
FT                   amine oxidase domain protein; glycoside hydrolase family
FT                   18; SMART: chitinase II; SPTR: Copper amine oxidase domain
FT                   protein; PFAM: Copper amine oxidase N-terminal domain;
FT                   Glycosyl hydrolases family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07025"
FT                   /db_xref="GOA:D9S097"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D9S097"
FT                   /protein_id="ADL07025.1"
FT                   /translation="MLKRRFAVFFLTVTIMLTVITPFTASAAAFVRVMLNGDELKFDVA
FT                   PVLKNNRLLVPFRLLSENLGAGVRWDGRTKMVTAYKSETQVVLRVGSSTAYVNGKPVKL
FT                   DVPAMLIQGRTLVPLRFYSEAFGAAVDWDGRENTVFIKTADKLSKYIMGYYYSQSYDDF
FT                   INNVDKLSSIATKWYTLNSDCNLTSYDGSRWIMKPEGYDSVLRTARERGVKVHALVFES
FT                   DRARLQQALATAEKRNALVGQILAEVDKENYDGVNIDFEYLGPEDKENFNAFIKDLYAA
FT                   LKSRNKTLSLSLPAKTEKQDWWPGYDYGTLGKYSDFVVLMAYDKSPSTPGPQAGVEWVE
FT                   EIVNYALARIPAEKIVLGIGYYGYAWSGNEKYTVLEARNGMTYSKIWFLDELAQKYGLK
FT                   MTIDSTSLMDYGSFTDEKGNIYQIWMESPKSVDAKSKLAIKKGLKGIAVWRLGYTTPSF
FT                   WQAVNDNFIAAK"
FT   sig_peptide     232741..232821
FT                   /locus_tag="Toce_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            234307..235131
FT                   /locus_tag="Toce_0240"
FT   CDS_pept        234307..235131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1732 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF322)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07026"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S098"
FT                   /protein_id="ADL07026.1"
FT                   /translation="MKVIALVGKSGTGKSHKAHIVARHYGAELIIDDGLLIHGNRVVAG
FT                   FSAKREETMIGAIRRAIFQDPDHAGEVKKKLAEINAGKVLIIGTSEKMIRAICRALELP
FT                   APEAVVRIEDVSTPEEIEKARLIRKYEGKHVIPVPTLEIKKYFSGYLLDPLKIFYRRGK
FT                   QEIVTEKSVVRPTYSYLGRYTIADTVVSQIALHAALSVKGVGPGGRAIIENYGTGVAIV
FT                   LELSVEYGVPLIPLLEKVQSEVAKQVEHMTALNVLRVDVTARRLYFKKENSI"
FT   gene            235209..235736
FT                   /locus_tag="Toce_0241"
FT   CDS_pept        235209..235736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0241"
FT                   /product="NADH dehydrogenase subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023; KEGG: csc:Csac_0619 NADH
FT                   dehydrogenase (ubiquinone), 24 kDa subunit; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 24 kDa subunit; SPTR: NADH
FT                   dehydrogenase (Ubiquinone), 24 kDa subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07027"
FT                   /db_xref="GOA:D9S099"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D9S099"
FT                   /protein_id="ADL07027.1"
FT                   /translation="MFCCAGEEHGIEKKFPDDEVDLSALEQVLKEYRGVPGSLITVLQK
FT                   VQDIYGYLPRKALYHIAREIGVKPAKVFGVATFYAQFRLKPIGKHLIMVCHGTACHVNG
FT                   AELITSALCDELKIKDGETTADGLFTLQNVACLGCCSLAPVMMIDGEAYGKLTPDKARD
FT                   VIRDIYKRETGK"
FT   gene            235755..237506
FT                   /locus_tag="Toce_0242"
FT   CDS_pept        235755..237506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0242"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR011538:IPR019554:IPR019575:IPR017900:IPR 017896;
FT                   KEGG: csc:Csac_0620 NADH dehydrogenase (quinone); PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding; PRIAM:
FT                   NADH dehydrogenase (quinone); SPTR: NADH dehydrogenase
FT                   (Quinone); PFAM: NADH-ubiquinone oxidoreductase-F
FT                   iron-sulfur binding region; 4Fe-4S binding domain;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07028"
FT                   /db_xref="GOA:D9S0A0"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A0"
FT                   /protein_id="ADL07028.1"
FT                   /translation="MKVVVGLGSCGIAAGGNRVLEAIQEEVESRKIDVDVKKAGCIGMC
FT                   YLEPIVDVIDDDGNKTTYVRVTPEIVKEIFEKHIEKGEVLSEHAIGEDDRSYIDGQVRI
FT                   ALRNCGAIDPESIEEYIEKGGYKALEKVLKEMTPEQVIEEMKVSGLRGRGGAGFPTWFK
FT                   WNATRSAQGSPKYVVCNADEGDPGAFMDRSVLEGDPHSVLEGMAIAGYAIGAEHGYIYV
FT                   RAEYPLAIKRLEIAIEQAREKGFLGSNIFGTGFSFDVKIKAGAGAFVCGEETALIASLE
FT                   GERGMPRLKPPFPAQKGYMGKPTNINNVETFANVPWIILNGGKAFAAIGTEKSKGTKVF
FT                   ALAGKVKKGGLVEVPMGIPLRDVIFRIGGGIKNDRKIKAVQLGGPSGGCVPESLLDTPV
FT                   DYESIVKTGAIMGSGGMIVMDETTCMVDMARFFLDFTRKESCGKCTHCRLGTKRMLEIL
FT                   ERICEGRGEESDLELLEELAVNVKGGSLCGLGQTAPNPVLTTLRYFRDEYEAHIKDKKC
FT                   PAKQCKALIAYRIDAEKCKSCGLCARKCPVNAIKGSKGQPYEIVLEKCTKCGTCMQVCR
FT                   FGAVFVE"
FT   gene            237526..241146
FT                   /locus_tag="Toce_0243"
FT   CDS_pept        237526..241146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0243"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG3383 Uncharacterized anaerobic
FT                   dehydrogenase;
FT                   InterProIPR001041:IPR013027:IPR006963:IPR006656:IPR
FT                   000759:IPR017900:IPR006655:IPR017896; KEGG: aoe:Clos_0277
FT                   molybdopterin oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; ferredoxin;
FT                   molybdopterin oxidoreductase Fe4S4 region; molybdopterin
FT                   oxidoreductase; SPTR: Molybdopterin oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase;
FT                   Molybdopterin oxidoreductase; Molybdopterin oxidoreductase
FT                   Fe4S4 domain; TIGRFAM: glutamate synthase (NADPH),
FT                   homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07029"
FT                   /db_xref="GOA:D9S0A1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A1"
FT                   /protein_id="ADL07029.1"
FT                   /translation="MEEIRLNINGREVRGLKGQTILEVARENGIDIPTLCYDERVKIYG
FT                   SCGLCLVEVEGAPKLLRACATEISNGMVVYTDTKKVRASRKVALELLLSNHTGDCRPPC
FT                   RQACPARTDCQGYVGLIANGQYREAVKLIKEQLPLPASIGRICPHPCEDACRRQLVEEP
FT                   IAIAWLKSFVGDVDLASEYPYMPEIKPPTGKSVSVIGSGPAGLSAAYYLAKEGHRVVVY
FT                   EAMEKPGGMLRYGIPQYRLPKEVLDREIDLIRKMGVEFITGCRVGRDVTLDYLRSSYDA
FT                   VFVAIGAWKSAKVGCPGEDLDGVLGGIDFLRAVAKGEPVNMGRRVAVVGGGNTAMDACR
FT                   TAIRLGAEEVYVLYRRTRNEMPANEVEIKEAEEEGVKFVFLVSPIEIMGRDGRVAAVRL
FT                   QKMRLGEPDSTGRRKPEPIPGEEMILEVDTVIAAIGQEVNPEGLEGLNLTRKRTISADE
FT                   GTFATSIPGVFAGGDAINEGPGIAIEAVADGKKAAEVIMSYLEGNTIPFREPYVVRRSD
FT                   LTQADFADRERIPRVPMPHLSPEERKTNFREFVLGYSEEEAKKEAMRCLECGCKDFFEC
FT                   KLIKYANEYGVNPEKLAGEVSRYEYRDDHPFIVRDPNKCILCGLCVRVCDEVMGITALG
FT                   FVNRGFDTVIKPEFELPLRDTSCISCGQCVAVCPTGALQEKPPVAKPVPVATEKKHTVC
FT                   SFCGVGCNMKLDIRGDMILRALPDKESPVDAGHLCVKGRFGFSALKAGERLTTPLVREN
FT                   GKLAETSWEEALLYAGRKVQGIRAMNGGESLAVFVSPRLTNEEIFMAVEFAKKGLGTPH
FT                   VASFSNTTSGLKDVLGFDASTNSLEELTSTDMILLIGCRVMEDYAVAGLKIREALKEGA
FT                   KLVVINPEPSIADEWAHKVVRPENSVDFLKALLKGLIEEGFTSGAARAEGFEELKASLA
FT                   DTAVSDDIREIARLYGKAGNAMVVFDHERLTRDAERLIASIAVVSGHIGRPRNGIVMLK
FT                   AKGNAQGLVDMGVTADAAEILKLIEQGRIKGAFIFGEDPAGADAAVTGILKKLEFLAVQ
FT                   DLFLTDTARLADVVLPAAAFSESRGSYTSAERRVQWFERALPASTGRENWQVIRDLAGA
FT                   TGCAFNFGSAEEVLDAISRQIPEYRGVKKTALTGGGIFWPAGTKDAFGMPVLYREGFNF
FT                   ESGKARLAVSAGGPAFRCMGPADAVERAFARKMEETGIAR"
FT   gene            241374..242333
FT                   /locus_tag="Toce_0244"
FT   CDS_pept        241374..242333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0244"
FT                   /product="Protein of unknown function DUF2229, CoA enzyme
FT                   activase"
FT                   /note="COGs: COG3580 conserved hypothetical protein;
FT                   InterPro IPR018709; KEGG: nth:Nther_0109 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2229, CoA
FT                   enzyme activase; SPTR: Putative uncharacterized protein;
FT                   PFAM: CoA enzyme activase uncharacterised domain (DUF2229)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07030"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A2"
FT                   /protein_id="ADL07030.1"
FT                   /translation="MKIGIPRTLAYYAYYPFINTFFEKLGLEVAVSDPTSKEIVDAGVE
FT                   DAVADACVPIKLFHGHVKNLINRVDYVFVPRLVSVNREATFCPKFLGLPDMLACSIPNL
FT                   NNMLEVRIDIRGKKRELFLTCLRVAGKFKKGFFTAYNAYRKALISFKDYTNQFLQGGIP
FT                   PLGIMAQKKSADIKLGVVGYPYMLYDPYVSLDLIKKLIGMGTYVVTPEMVPEEVKQKYA
FT                   GKLRKTLFWTFSNSVLRTAFHFLETGCVDGIIHVTAFGCGPDFIVDKIMELEARERNMA
FT                   YLTIALDEHTGQEGLNTRLEAFVDMLRRKRKVKEAAML"
FT   gene            242330..243466
FT                   /locus_tag="Toce_0245"
FT   CDS_pept        242330..243466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3581 conserved hypothetical protein; KEGG:
FT                   pth:PTH_1326 hypothetical protein; SPTR: Uncharacterized
FT                   protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07031"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A3"
FT                   /protein_id="ADL07031.1"
FT                   /translation="MRKVSYPYLGNATITFQKLMKALGNDVVLPKRPTEETLSLGTKYA
FT                   PEFACLPFKIVLGTYIEALEAGADTLVSTGGVGPCRAGLYTTLHEKILKSLGYDFEMIT
FT                   LEPPGRHLRDLIASIKKLVSKKLSIADYFRIGRFVWKELQLLDKAEKLSHKIRPLEVKK
FT                   GETTRTYKKCAELIAQAQSYRDLVEIEREIELLYEKIEKKDIDPIKIGIVGEIYVVIEP
FT                   AANLEIEEMLGDLGVYAERSMFLASYTFYNAVMDLFRMPGERDVKKLASPYFKEMCGGH
FT                   GRESVGNAILFAKRGFDGVIQLSPFTCIPEIVAKSILPKVCAEYGIGFLPVTLDEQTGK
FT                   EGLRTRVEAFVDLLAAKRKKKKMNLGKGDVVYGTLSGY"
FT   gene            243444..244409
FT                   /locus_tag="Toce_0246"
FT   CDS_pept        243444..244409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0246"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="COGs: COG1924 Activator of 2-hydroxyglutaryl-CoA
FT                   dehydratase (HSP70-class ATPase domain); InterPro
FT                   IPR008275:IPR002731; KEGG: chy:CHY_1411
FT                   CoA-substrate-specific enzyme activase domain-containing
FT                   protein; PFAM: ATPase BadF/BadG/BcrA/BcrD type; SPTR:
FT                   CoA-substrate-specific enzyme activase domain protein;
FT                   TIGRFAM: CoA-substrate-specific enzyme activase; PFAM:
FT                   BadF/BadG/BcrA/BcrD ATPase family; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07032"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A4"
FT                   /protein_id="ADL07032.1"
FT                   /translation="MAHYLGIDVGSVSTNLIIMDESGEVEEAVYIRTQGQPIKAVQEGL
FT                   RLLNSRGHGKWDIRGVGTTGSGRQLAAVIAGADIVKNEITAHAVAAQKEVPDVRTVIEI
FT                   GGQDSKIIILRDGVVTDFAMNTVCAAGTGSFLDQQANRLGIPIEEFGSYALRSKNPVRI
FT                   AGRCAVFAESDMIHKQQLGYKIEDIIRGLCQALVRNYLNNVGKGKEILPRVVFQGGVAA
FT                   NVGMKAAFEEALGMEVYVPKYHHVMGALGAALLARDAGVEKTKFRGFQASDIEFAADSF
FT                   ECQGCSNHCEVVNIKMEGKVIARWGDRCNKWKVIEDSGAA"
FT   gene            complement(244406..245053)
FT                   /locus_tag="Toce_0247"
FT   CDS_pept        complement(244406..245053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0247"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentanephosphat
FT                   ase"
FT                   /note="COGs: COG4359 conserved hypothetical protein;
FT                   InterPro IPR006384:IPR006383:IPR005834; KEGG: pth:PTH_0926
FT                   hypothetical protein; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase; SPTR: Uncharacterized conserved protein;
FT                   TIGRFAM: 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Putative Phosphatase; TIGRFAM:
FT                   Haloacid Dehalogenase superfamily, subfamily IB,
FT                   phosphoserine phosphatase-like;
FT                   2,3-diketo-5-methylthio-1-phosphopentane phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07033"
FT                   /db_xref="GOA:D9S0A5"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A5"
FT                   /protein_id="ADL07033.1"
FT                   /translation="MKIAFFIDFDGTITKEDTCVAMTRNFARGDWEEIELRWQRGEIST
FT                   EESARETFKLFDAGEEDLRNFLIENMEIDDYFMPFVEFCRERGYEIYILSDGYDFNIET
FT                   VFKKYGIKDIPYFSNMLIIDGRKFDIESPHSSWSCPQCGTCKAELIDKLKPKNGLAVYV
FT                   GDGHSDICAIKKADVIFAKGVLLSHCRRNDIPAIAYKDFSDIIDWARSANIR"
FT   gene            245310..246134
FT                   /locus_tag="Toce_0248"
FT   CDS_pept        245310..246134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0248"
FT                   /product="DNA end-binding protein Ku"
FT                   /note="COGs: COG1273 conserved hypothetical protein;
FT                   InterPro IPR009187:IPR006164; KEGG: tit:Thit_1867 Ku
FT                   protein; PFAM: Ku domain protein; SMART: Ku domain protein;
FT                   SPTR: Ku protein; TIGRFAM: Ku protein; PFAM: Ku70/Ku80
FT                   beta-barrel domain; TIGRFAM: Ku protein, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07034"
FT                   /db_xref="GOA:D9S0A6"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A6"
FT                   /protein_id="ADL07034.1"
FT                   /translation="MRALWRGSISFGLVNVPVKMYAATERKSVSFRQIHRECGTPIRYE
FT                   KVCPACNRKVEDDEIARGYEYEKGKFVIIEDKDLESIPDETTRTIDIIDFVNLAEIDPI
FT                   YFDHSYFLGPEETGQKAYLLLLKALKETGKIAIAKVMIRAKQSLACLRPYGENRLVMET
FT                   MFYPDEVRDAGEIPVSPEVKIHENEIKMAVQLINSLATDFKPEKYTDEYRKALLDIIRA
FT                   KVEGQDIRIPAPREEKVVDLMEALKASLAMVEKEKESKKEAAGRGRRKRATS"
FT   gene            complement(246129..247055)
FT                   /locus_tag="Toce_0249"
FT   CDS_pept        complement(246129..247055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0249"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="COGs: COG1793 ATP-dependent DNA ligase; InterPro
FT                   IPR012310:IPR016059; KEGG: swo:Swol_1123 DNA ligase,
FT                   putative; PFAM: ATP dependent DNA ligase; SPTR: DNA ligase,
FT                   putative; PFAM: ATP dependent DNA ligase domain; ATP
FT                   dependent DNA ligase C terminal region; TIGRFAM: DNA
FT                   polymerase LigD, ligase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07035"
FT                   /db_xref="GOA:D9S0A7"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A7"
FT                   /protein_id="ADL07035.1"
FT                   /translation="MIKPGIPFIPMEPLPHPKPFDDEKYGFQIKWDGTRIVAHLSGGVE
FT                   LFNRKMKRRTAQYPEVAGTLSDVLGDSDAVLDGEMITLIGGKPSFQQLMRRDWATDPGT
FT                   INYLASRIPVTYVVFDILYLNGKSLIDLPFSRRYHILKSTLRSSDPVVVTDTFPGRGIA
FT                   LYEIARERGLEGIVAKRLDSVYQIGKKSDKWLKIKNRREVTALVGGFLAEGKSVRSLFL
FT                   GQLVEGELIYIGRASSGLGAETSRVLYDLLSKSAKESCPFANPPQIERREKPVWVSPSV
FT                   AVEVEFLDYTDEGYLRHPVIRRVEFGS"
FT   gene            247163..248056
FT                   /locus_tag="Toce_0250"
FT   CDS_pept        247163..248056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0250"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="COGs: COG3285 eukaryotic-type DNA primase; InterPro
FT                   IPR014145:IPR002755; KEGG: swo:Swol_1124 hypothetical
FT                   protein; PFAM: DNA primase small subunit; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: DNA polymerase LigD,
FT                   polymerase domain protein; TIGRFAM: DNA ligase D; DNA
FT                   polymerase LigD, polymerase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07036"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A8"
FT                   /protein_id="ADL07036.1"
FT                   /translation="MPVVIVEDEKLELTNLSKVMWPEDNITKADFIDYYVRVAPYVLPH
FT                   LKDRPMVFTRYPDGIYGKAFYQKNIPDYAPEWLRTYDEESFTGGKRKVVRYALIDDMKS
FT                   LLWAANQASLEMHPWLSRVGTIEYPDFVVFDLDPMENTDFEDARQLALALKKLLDMEGL
FT                   VGFPKTSGATGIQVYVPIEPRYTYREVRVFAKIFCRVLERTFPEKATTERSIKKRRGKV
FT                   YLDYLQNIKGKTLIAPYSPRPIAGAPVSAPVTWDELEEGVRPSMFTIRNMPERLQKVGD
FT                   LFKGVLEVKQRIDRWL"
FT   gene            248193..249260
FT                   /locus_tag="Toce_0251"
FT   CDS_pept        248193..249260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0251"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR003953:IPR003042; KEGG: nth:Nther_1774 FAD dependent
FT                   oxidoreductase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; SPTR: FAD
FT                   dependent oxidoreductase; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07037"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0A9"
FT                   /protein_id="ADL07037.1"
FT                   /translation="MARVLVIGGGPGGLTAAASAASMGHEVRLLEKGRIGENIRCAEGF
FT                   FDVLKKLGKPGAGVRFKVEKLIAKALATYEIDVSDLNLWMIDRREWQEDLARIARDKGA
FT                   VIEENSPVSPKDLEGLMRDYDYIIDASGAPPVTARAYGFADFYKQNCARTVQYVMEGDF
FT                   SYLGNNLKVGLLPGLYGYYWIFPKDGHTANVGVGSFGGEPLPLWNRLRDVLEMEGLAGY
FT                   AIKRKLGGICPIRMAPRLVYDNILLVGDAAGLTSPLHGGGIDMAVLSGMEAVRSLSSGG
FT                   TDYEKNLRKLLSPRLTIEAMAAGVWKKKGFEEMDELIGKLVKTGLYRPFLNPNQFNSFT
FT                   AGLIAKILRVENPAV"
FT   sig_peptide     248193..248252
FT                   /locus_tag="Toce_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            249347..249781
FT                   /locus_tag="Toce_0252"
FT   CDS_pept        249347..249781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0252"
FT                   /product="FHA domain containing protein"
FT                   /note="COGs: COG1716 FOG: FHA domain; InterPro IPR000253;
FT                   KEGG: tit:Thit_1769 FHA domain containing protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein; SPTR: FHA domain containing protein; PFAM: FHA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07038"
FT                   /db_xref="GOA:D9S0B0"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B0"
FT                   /protein_id="ADL07038.1"
FT                   /translation="MYELLAQILKFLLIGLIYYFLYNFLKLMVLDLSEEKNTSVDTGYY
FT                   LRSDDGREYPLRPVTTIGRAGDSDIVINDPYLSSKHAMIFKKGRRMVIQDLKSTNGTFL
FT                   NGKRIKKAVALKEKDVITMGSRKFTFLRREARGLESGSDV"
FT   gene            249753..250985
FT                   /locus_tag="Toce_0253"
FT   CDS_pept        249753..250985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0253"
FT                   /product="cell cycle protein"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182; KEGG: tpd:Teth39_0572 cell
FT                   cycle protein; PFAM: cell cycle protein; SPTR: Cell cycle
FT                   protein; PFAM: Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07039"
FT                   /db_xref="GOA:D9S0B1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B1"
FT                   /protein_id="ADL07039.1"
FT                   /translation="MDSKVEATYNRALSAMALTGLISFLLLTIFRKPVTLVPFYGAVIF
FT                   LSIVFIGYFFTGWIFPSSDKFLFILAGFLTELGLIMLCRINMELFKRQVAFFALGVGFF
FT                   ILSSILTRYFISLELKPVYFWGATVALLLLPLLFGVEKGGAKNWLAFSGFTFQPSELAK
FT                   ITFVFYLAGVLKQNKINNFPRLAAEILAAVGLLAISKDLGGAMLFYITALAVIFTATSR
FT                   LDLTAAGLSAAGILGVLSYFLFDHVRVRIEAWLNPWQDVPGRGYQIVQSLFAIAEGGYF
FT                   GTGLGLGRPDFIPAVATDFIFSAFAEEFGFLGAAAVILMYFLMVYRGIKIALRLEDSYP
FT                   ALIALGYTVMFGMQIFTIIGGVIKLIPVTGVTLPFMSYGGSSMVMSFTSLGILNGLWLQ
FT                   AREGETDGEAA"
FT   gene            250969..252378
FT                   /locus_tag="Toce_0254"
FT   CDS_pept        250969..252378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0254"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR001460;
FT                   KEGG: tte:TTE1967 cell division protein
FT                   FtsI/penicillin-binding protein 2; PFAM: penicillin-binding
FT                   protein transpeptidase; PRIAM: Peptidoglycan
FT                   glycosyltransferase; SPTR: Penicillin-binding protein
FT                   transpeptidase; PFAM: Penicillin binding protein
FT                   transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07040"
FT                   /db_xref="GOA:D9S0B2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B2"
FT                   /protein_id="ADL07040.1"
FT                   /translation="MEKLHRNIKLVFAVFCGLFMCLLGYLTYFQVYERQKLIESSYNRR
FT                   LWEQEESITRGTVYDIRGRVLAATVVENGAKRRVYPQGPAFGPLLGYSSRKLGRAGLEE
FT                   VLNGELLGISQQDPMLLLRQKILGVSKGNDVYLTIDSDLQKRAYELFQGRRGALVALDP
FT                   NTGAVLAMVSSPGYNPSSVEKQWEALSKDKASPLLNRAIQGLYPPGSSFKIVTLAAALE
FT                   SIPDIEKRTYETPGYVKVSGRVIRDYEGMEPGNYDVKRAFSLSSNSIFVKIGLEVGKER
FT                   LFAKAQEFGFNSKIPFELPAAVSRFPRFSLMSDDVELAEASIGQGRILATPLQMAMVAS
FT                   TVANGGKMIQPYIVQKTVTPLGHVKNFEKAGSAKQVIDEVTANKIREYMVDVVENGTGT
FT                   PARVRGIPVAGKTGSAENPHGETHAWFVGFAPADDPKIAVAVVVENAGSGGRNAGPIAR
FT                   EVISQYLERLQ"
FT   gene            252419..253300
FT                   /locus_tag="Toce_0255"
FT   CDS_pept        252419..253300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0255"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: aco:Amico_1276 protein of
FT                   unknown function DUF6 transmembrane; PFAM: protein of
FT                   unknown function DUF6 transmembrane; SPTR: Permeases of the
FT                   drug/metabolite transporter (DMT) superfamily; PFAM:
FT                   EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07041"
FT                   /db_xref="GOA:D9S0B3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B3"
FT                   /protein_id="ADL07041.1"
FT                   /translation="MRIKKSLLADGALLLVTMAWGLNFVVMKNALQRITPFMYLAVRFL
FT                   LAFLVLAAVFNENIKKVDKRDIIGGSIIGLFLFLGFATQTVGLIYTTPAKSGFITGSNV
FT                   VMVPFLAYFVNKKFPGWYQVLGAAVTFAGLGVISLEGGLRVNVGDFLTLLCAVFFAMQI
FT                   VSTEYYARRGNPINLAILETGITGMLSLFVGALTEPMPVTLDLSMWIAILYAVICCTAG
FT                   AFLVQNVAQKYTTSTHAAVIMCQEAVFAGVFSFLFWGEPVTFKALAGFALILAGVLITE
FT                   LSPAYGLKTETL"
FT   sig_peptide     252419..252481
FT                   /locus_tag="Toce_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            253372..254343
FT                   /locus_tag="Toce_0256"
FT   CDS_pept        253372..254343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0256"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: tex:Teth514_0329 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter, ATP-binding protein, putative; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07042"
FT                   /db_xref="GOA:D9S0B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B4"
FT                   /protein_id="ADL07042.1"
FT                   /translation="MLKVCNIKKTYKKPPVTALAGVSLEVMEGEVVGLLGPNGSGKTTL
FT                   IKIINGIILQDSGEIYIGGRPVKNSREFANFLGSVFDTERSLSWGLTVRQNLMYFAHLK
FT                   GAASGEVKAKFEYLGEIFDLKELWDRRVATLSHGQRQRAAIATALAHDPKILILDEPTN
FT                   GLDVENTIHLSGIIRSLLEKKLSILISSHNLGFIEEVADRVYLMKQGRVVGNVRLEEPE
FT                   KQEEMRYYHIYLSYDATHEDARKLELAGFRVIDISGAMLKVEVPQSVPASRILEVMSEI
FT                   GLIVRSVLPVKRNLMELYRRVVLQNLPPGEVDVNESASRCDG"
FT   gene            254315..255106
FT                   /pseudo
FT                   /locus_tag="Toce_0257"
FT   gene            255133..256155
FT                   /locus_tag="Toce_0258"
FT   CDS_pept        255133..256155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0258"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="COGs: COG1902 NADH:flavin oxidoreductase Old Yellow
FT                   Enzyme family; InterPro IPR001155; KEGG: aoe:Clos_0391
FT                   NADH:flavin oxidoreductase/NADH oxidase; PFAM: NADH:flavin
FT                   oxidoreductase/NADH oxidase; SPTR: NADH:flavin
FT                   oxidoreductase/NADH oxidase; manually curated; PFAM:
FT                   NADH:flavin oxidoreductase / NADH oxidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07043"
FT                   /db_xref="GOA:D9S0B5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B5"
FT                   /protein_id="ADL07043.1"
FT                   /translation="MSKLFSKIKIKDMEVRNRIVMPPMCMYSSDDKGFPNSWHLIHYAT
FT                   RAIGGVGLVIMEATAVEKRGRISERDLGIWDDAHIEGLAEIASEVKKHGAKIGIQLAHA
FT                   GRKCGAPGEDLIAPSPIAFDETYGVPREMTKEDIKEVVSAFKAAAYRAYRAGFDIIEIH
FT                   GAHGYLISEFLSPLTNKRTDEYGGNLQNRARFLREVIRAVREVWPEEKPLMVRVSAEDY
FT                   AEGGNHDIDLANIINLVKGEGVDIIDVSSGAVVPATIKAYPGYQVRFAETIRKMTGLPV
FT                   IAGGLITVPEMAEEILQNERADMVYLGRELLRNPYWPLSAAKELGDDIKWPEQYERSRK
FT                   "
FT   gene            256152..256808
FT                   /locus_tag="Toce_0259"
FT   CDS_pept        256152..256808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0259"
FT                   /product="HhH-GPD family protein"
FT                   /note="COGs: COG0122 3-methyladenine DNA
FT                   glycosylase/8-oxoguanine DNA glycosylase; InterPro
FT                   IPR003265; KEGG: bha:BH1749 DNA-3-methyladenine
FT                   glycosidase; PFAM: HhH-GPD family protein; SMART: HhH-GPD
FT                   family protein; SPTR: DNA-3-methyladenine glycosidase;
FT                   PFAM: HhH-GPD superfamily base excision DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07044"
FT                   /db_xref="GOA:D9S0B6"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B6"
FT                   /protein_id="ADL07044.1"
FT                   /translation="MISRKKILRFQKDDPALKALSKADEKMAYLIHLIGDYSLELEEDY
FT                   FQSLVQSIVGQQLSMKAADSIWRKLQDLCGEVTPARILSLSEDELRSAGLSKKKIEYIK
FT                   DLSEKVLSGILDLDKIDSMADEEVIEALVRVKGIGRWTAEMFLIFSLGRPDVFSVADLG
FT                   LQRAVKWLYGLSDWPDKKFLIECSQRWKPYRTAASLYLWEAKNRGIVDEKDVAGE"
FT   gene            256901..257929
FT                   /locus_tag="Toce_0260"
FT   CDS_pept        256901..257929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0260"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR002306:IPR002305:IPR001412; KEGG: cce:Ccel_1411
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; PRIAM: Tryptophan--tRNA ligase; SPTR:
FT                   Tryptophanyl-tRNA synthetase; TIGRFAM: tryptophanyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (W and Y);
FT                   TIGRFAM: tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07045"
FT                   /db_xref="GOA:D9S0B7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B7"
FT                   /protein_id="ADL07045.1"
FT                   /translation="MSGKKRIFSGAQPSGSVTLGNFLGAIKNWVELQDKYDCIYCIVDL
FT                   HALTVRQDPKVFRERCYSFLAQYLACGLDPEKNVVYFQSHVSAHAELAWILNCYTYMGE
FT                   LSRMTQFKEKARKHQDNINAGLFTYPVLMAADILLFQTDLVPVGEDQKQHVELTRDIAT
FT                   RFNNLYGEVFKIPEPYIPEVGARIMSLLEPTKKMSKSDENENSYILLLDPPDVIMKKFK
FT                   RAVTDSEAVVRYDVERKPGISNLMNIYAAVTGRSFEEIEREFEGKGYGEFKKAVAEVVI
FT                   DKLRPIREKYDELMANKDYMESVIKNGAERAQELARETLKKVYDKIGLVPCPNTGLKGP
FT                   GL"
FT   gene            257977..258471
FT                   /locus_tag="Toce_0261"
FT   CDS_pept        257977..258471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tit:Thit_0279 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07046"
FT                   /db_xref="GOA:D9S0B8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B8"
FT                   /protein_id="ADL07046.1"
FT                   /translation="MKYDTKFLTRTALLLAVTLMLQYLKMPQLITGSLVNAMLLIAAGT
FT                   VGVFSGITIGLLTPLIALLVGILKFPPMVPFIMAGNALYVWLYSSQKNAVIGVLLAAVA
FT                   KYAWLSISVIYILKWFGVRVPPPVVQAFTLPQLFTALLGGAIGVTLIFLLQRSFAKAKE
FT                   M"
FT   gene            258476..259066
FT                   /pseudo
FT                   /locus_tag="Toce_0262"
FT   gene            259193..259912
FT                   /pseudo
FT                   /locus_tag="Toce_0263"
FT   gene            260053..262011
FT                   /locus_tag="Toce_0264"
FT   CDS_pept        260053..262011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0264"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG3711 Transcriptional antiterminator;
FT                   InterPro IPR007737:IPR011608:IPR002178:IPR013011; KEGG:
FT                   cdf:CD3083 transcription antiterminator; PFAM: PRD domain
FT                   protein; M trans-acting positive regulator;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; PRIAM: Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase; SPTR: Putative uncharacterized protein;
FT                   PFAM: HTH domain; Mga helix-turn-helix domain; PRD domain;
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07047"
FT                   /db_xref="GOA:D9S0B9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0B9"
FT                   /protein_id="ADL07047.1"
FT                   /translation="MEYYLYTRQKTLLRFLLTRKDWVKGQEIAAALGVTDRTVRNDIAY
FT                   INSLTKDNEEIITSMKSKGYRIKNCEKAREILKLARVDSPDNPDERVNYILKKLIFDKK
FT                   ELDIYQLADEIMVSESTIVGDLKRINKIVSANNRDLKVIKKSSKIFLKGSEKDKRSLLS
FT                   ELLFKETNGSFFDVSKYKKYFKDVDLDLIQKHLLETVKKYSFSINEMAVVNLLIHIAIT
FT                   VDRIKNKNLLDIYTSCRNMVNTMEYKIAKELCTKLEDEFQIKFPPEEVLYVSYLILGRE
FT                   KIQCTCTNRDELKDIVEPYYISLTVALLNSIATEYGIDFTRDDTLLIGLCLHLKIMYCR
FT                   IKNGMVLRNPLLEDLKRRYPFIFEIAVFLAREFYRLTGLQVNEDEIGFIALHLGAAFER
FT                   YTEKQNFPKRVAIVCPTGYTTSNILLSKINSIYKEKIKVLGVFSFMELDSIKKDNPDFI
FT                   FTTVPLEHDLPINTIVISPFLDEKDKKLIDKTLNLYYAESKAESLRSEADKFFKEELFY
FT                   KNLVFQNEFQVIDFMAKELHEKGYVPQNYPQLVIEREKLSSTSFGNLVAIPHPVLISAY
FT                   ETVISVAILDKPIMWGKHKVQLVLMFAIKPGDRKKLDFLYNHIIDAIDRPGGVNSLIES
FT                   RDFYDFKSRLLNLNYEN"
FT   gene            262145..262453
FT                   /locus_tag="Toce_0265"
FT   CDS_pept        262145..262453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0265"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="COGs: COG1447 Phosphotransferase system
FT                   cellobiose-specific component IIA; InterPro IPR003188;
FT                   KEGG: tte:TTE0336 phosphotransferase system
FT                   cellobiose-specific component IIA; PFAM: phosphotransferase
FT                   system PTS lactose/cellobiose-specific IIA subunit; SPTR:
FT                   Phosphotransferase system cellobiose-specific component
FT                   IIA; PFAM: PTS system, Lactose/Cellobiose specific IIA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07048"
FT                   /db_xref="GOA:D9S0C0"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C0"
FT                   /protein_id="ADL07048.1"
FT                   /translation="MESIEEIAFRIISAAGDSLSMMFEAMKLSRNGKFEEAEQLMQKAD
FT                   DFLLQAHKVQTELIAEESRGNKSEYSILMVHAQDHIMNAMLAKPLIREIINLYKRLG"
FT   gene            262494..263441
FT                   /locus_tag="Toce_0266"
FT   CDS_pept        262494..263441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0266"
FT                   /product="N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase"
FT                   /EC_number="3.5.1.26"
FT                   /note="COGs: COG1446 Asparaginase; InterPro IPR000246;
FT                   KEGG: cdl:CDR20291_0138 glycosylasparaginase; PFAM:
FT                   peptidase T2 asparaginase 2;
FT                   PRIAM:N(4)-(beta-N-acetylglucosaminyl)-L-asparagina se;
FT                   SPTR: Glycosylasparaginase; PFAM: Asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07049"
FT                   /db_xref="GOA:D9S0C1"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C1"
FT                   /protein_id="ADL07049.1"
FT                   /translation="MKWAIIGTWRMSLEGIIAATEILKHGGDSGDAVEEAVKIVEDFPL
FT                   YKSVGYGGLPNENCEVELDAAFMDGDTLSFGAVGGIRDFKNPVSIARKLSHEKFNIFLV
FT                   GSGAEEYAHKNGFERKNMLTDRAKKIWEKRVKEIYEKNLSPYDGHDTVGVVCLDKKGHM
FT                   TAATSTSGLFMKKRGRVGDSPICGSGLYVDSQVGGAVATGLGEDIMKGCLSYEAVRLME
FT                   SGIDPQTAAEKAVFNFSEKLRQRSGKAGAISLVCINNKGEWGVGTNVEFSFVVATDDSM
FT                   PKVYLAHPENGRVICEEASEEWLQEYQRKITSPV"
FT   gene            263554..264888
FT                   /locus_tag="Toce_0267"
FT   CDS_pept        263554..264888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0267"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG1455 Phosphotransferase system
FT                   cellobiose-specific component IIC; InterPro
FT                   IPR004501:IPR003352; KEGG: ent:Ent638_2981 PTS system
FT                   lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC; PRIAM:
FT                   Protein-N(pi)-phosphohistidine--sugar phosphotransferase;
FT                   SPTR: PTS family oligomeric beta-glucoside porter component
FT                   IIC; TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; PFAM: Phosphotransferase system, EIIC; TIGRFAM:
FT                   phosphotransferase system, cellobiose specific, IIC
FT                   component; PTS system, lactose/cellobiose family IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07050"
FT                   /db_xref="GOA:D9S0C2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C2"
FT                   /protein_id="ADL07050.1"
FT                   /translation="MKKIQDFLENKFAPFATKLAGQRHLAAIRDGFISFMPFLIIGSLF
FT                   IIIQDFPAPGWQELQVKLFGEEFNQFIILPKRVTYDIMSLYIVASISYKLAQSYRIDSF
FT                   SAAMLGIASFILLTPITTTIDINGTTHTVSRVITVGGWYGTNGILVAIITALVVTEMFN
FT                   YFIKKGIIIKMPEGVPPAVSRAFSALVPGFVIIVTMLLVRLLFLQTPYQYIHDFIYKLV
FT                   SLPMQSMVANNLLGAIGTVFSISLLWSIGLNGGTIVNGIMRPFWVPLQDANLAAIEAGK
FT                   LPPNIITEQFFDMIWIGGAGATLAVVFLLMFRAKSKQYRELGKMSLAPGLFNINEPIMF
FT                   GLPVVLNPIGIIPLILGPVAITIVNYEAMALNLVARPTGVIIPWTTPPIIQGFLITGHI
FT                   SGAILQIVDILIVMLIWWPFIAIMDKKRVAEENEKVYNKGESLKL"
FT   gene            264906..265598
FT                   /locus_tag="Toce_0268"
FT   CDS_pept        264906..265598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0268"
FT                   /product="CutC family protein"
FT                   /note="COGs: COG3142 Uncharacterized protein involved in
FT                   copper resistance; InterPro IPR005627; KEGG: cbt:CLH_0683
FT                   copper homeostasis protein CutC; PFAM: CutC family protein;
FT                   SPTR: Copper homeostasis protein CutC; PFAM: CutC family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07051"
FT                   /db_xref="GOA:D9S0C3"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C3"
FT                   /protein_id="ADL07051.1"
FT                   /translation="MIEVIAMTPEDAKRIEACGADRIELVSALTEGGLTPSYAMIDKVV
FT                   KSVRIPVNVMIRPHSKSFIYTREEIEIMKEDIRIAKELGANGVVIGALNEKKEIHEGFI
FT                   EELLNLCDGLDVTFHRAIDELEDPINGIRILSRYTHIKTVLTSGGKGSIVENIPKIREM
FT                   IKNSGHISVMVGGGLNFENIGRVVKETGVKVFHFGTAVRDNRSPFGEINEHSLKDIIKI
FT                   VREEGDNL"
FT   gene            265595..265903
FT                   /locus_tag="Toce_0269"
FT   CDS_pept        265595..265903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0269"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="COGs: COG1440 Phosphotransferase system
FT                   cellobiose-specific component IIB; InterPro
FT                   IPR003501:IPR013012; KEGG: tai:Taci_0332 phosphotransferase
FT                   system lactose/cellobiose-specific IIB subunit; PFAM:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; SPTR: Phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; PFAM: PTS system,
FT                   Lactose/Cellobiose specific IIB subunit; TIGRFAM: PTS
FT                   system, lactose/cellobiose family IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07052"
FT                   /db_xref="GOA:D9S0C4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C4"
FT                   /protein_id="ADL07052.1"
FT                   /translation="MKIVLICFAGMSTSMLVNRMKKAAAKRNIDADIVALSTSDMYEEL
FT                   DNADVILLGPQARYVLDEVREIATPKGIPVEVINSQIYGSMNGEAVLDMALELAKRE"
FT   gene            266119..266811
FT                   /locus_tag="Toce_0270"
FT   CDS_pept        266119..266811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0270"
FT                   /product="metal-dependent hydrolase"
FT                   /note="COGs: COG2220 Zn-dependent hydrolase of the
FT                   beta-lactamase fold; KEGG: pth:PTH_1415 metal-dependent
FT                   hydrolase; SPTR: UPF0173 metal-dependent hydrolase
FT                   PTH_1415; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07053"
FT                   /db_xref="GOA:D9S0C5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C5"
FT                   /protein_id="ADL07053.1"
FT                   /translation="MVSLTFHGHACFTISSSKFNLIIDPWLKDNPLSDIKPEQVKVDYI
FT                   LVTHGHGDHLGDAIEIAKASNATIIAPYELATYCQSKGAKVHPMHIGGDYTFDFGWLQL
FT                   TPAMHGSGELIGDQIVYMGNPCGFLLEIEGKTLYHAGDTGLFGDMRLIGEKVSLDVAML
FT                   PIGGNFVMGIDDAVRAVEFLKPKTVIPMHYNTFDIIKKDPQEFKKKVEGKTGARVVILA
FT                   PGETITVN"
FT   gene            complement(266818..268080)
FT                   /locus_tag="Toce_0271"
FT   CDS_pept        complement(266818..268080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0271"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: dge:Dgeo_1065 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07054"
FT                   /db_xref="GOA:D9S0C6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C6"
FT                   /protein_id="ADL07054.1"
FT                   /translation="MEKRTMSEKEFYNNFNALSYDAIFFAVFNSFVEPGTVVASFVSNL
FT                   TSSPVLIGLTTTIRNCGWFLPQLLVARRAEALPRKKPLVVVAGGLLRLAAGMMALSTLI
FT                   AAKNPALALTLFYVFFIVMAFSDGVGGVPWIDLFAKSIPPERRGTYYTKTLFLEGSLAF
FT                   GAGFLVKAILSSDRFSFPYDYSVIFLLGFICCTISYLSFLRLKEVEDGAPRQCESLVKY
FT                   LMGIPQVFKKDRDFRLLIVVNTLLRFFFMPLPFYVIFAQEALKVSQDSVGIFVSAQMLG
FT                   YILAGVFFGRINDFYGSRSVVMLTAKLTAMPPVLALLSLLLYRLNLPSLPLYVLLFILI
FT                   GATYSGIWVGIYNYLLKIAPEEKRPLYIGLLNTLTAPTTFLPLLGGVIIQFLSYVHLFV
FT                   ITAVLVFSSVVAAYALRELDA"
FT   gene            268243..269475
FT                   /locus_tag="Toce_0272"
FT   CDS_pept        268243..269475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0272"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterProIPR020817:IPR005110:IPR001453:IPR005111:IPR 008284;
FT                   KEGG: pth:PTH_2617 molybdopterin biosynthesis enzyme; PFAM:
FT                   MoeA domain protein domain I and II; molybdopterin binding
FT                   domain; MoeA domain protein domain IV; SPTR: Molybdopterin
FT                   biosynthesis enzyme; TIGRFAM: molybdenum cofactor synthesis
FT                   domain protein; PFAM: Probable molybdopterin binding
FT                   domain; MoeA N-terminal region (domain I and II); MoeA
FT                   C-terminal region (domain IV); TIGRFAM: molybdenum cofactor
FT                   synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07055"
FT                   /db_xref="GOA:D9S0C7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C7"
FT                   /protein_id="ADL07055.1"
FT                   /translation="MRLFDARTVRDALEALKENLGNIPVKSEEVLLLEALNRVLAEDVY
FT                   SPEDIPAFDRSTVDGYAVMARDTFGAGESMPALLKLVGEIRMGERPDITLKPGQAVKIS
FT                   TGGMLPEGSDAVVMLEYTQQFDDGTLVVERPVAPGENVIFRGEDVKEGSLVLPKGHTLR
FT                   PQDLAVLAGIGRQKVRVAALPVVAVISTGDEVRPPGEKIKPGEIRDMNTYSLSAQVRKW
FT                   GGIPRTYGVVGDDFDGLCRVMVEALASSDLVVLSGGSSVGSRDLTVKVIESLGEPGVVV
FT                   HGLAVKPGKPTILGAVMGKPVVGLPGHPVSAMVIFELVVRPLISAMLGRPANYGKINVR
FT                   ARVARNVASAAGREDFIRVKLEERDGELWAKPILGKSGLISTMVESDGLARIPPEKLGV
FT                   GEGEYIEVELY"
FT   gene            269490..271415
FT                   /locus_tag="Toce_0273"
FT   CDS_pept        269490..271415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0273"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterProIPR020817:IPR005110:IPR001453:IPR005111:IPR 008284;
FT                   KEGG: nth:Nther_0447 molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   SPTR: Molybdenum cofactor synthesis domain protein;
FT                   TIGRFAM: molybdenum cofactor synthesis domain protein;
FT                   PFAM: Probable molybdopterin binding domain; MoeA
FT                   N-terminal region (domain I and II); MoeA C-terminal region
FT                   (domain IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07056"
FT                   /db_xref="GOA:D9S0C8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C8"
FT                   /protein_id="ADL07056.1"
FT                   /translation="MKEREVYLENVSLAEAVDRFFVDLEESGALRLTGAEVVSVRQALG
FT                   RITAEPVFARISSPHYSAAAMDGIAVSAKDTFGAGEKNPVRLKEGVNFHYVDTGDPLPP
FT                   GCDAVIMIEEVHPLGDGEVEIVAPCSPWDNVRGIGEDIAAAELVVPENHRLRPQDLSAI
FT                   LAAGHTAVRVRKKPRVAVIPTGTELVNPGEPLKPGDIIESNSAMISGLVEEWGGEALVL
FT                   EKAEDDFELIKRRIEEGLSAADVVVINAGSSAGSEDYTAKCIRAMGELLVHGVAIKPGK
FT                   PVVLGRIAGKPVIGIPGYPVSAYLAMELFVKPIVYRMQGLPVPGRHKIRARLSRRVVSS
FT                   IGTLEFLRVKVGRMGSEFIASPLSRGAGVIMSVVRADGIVRIPESREGIESGESVEVEL
FT                   LRDREEIENTVLMIGSHDVTIDLLANELKRLYPEITLSSAHVGSMGGIMALMRGETHMA
FT                   GLHLLDPETGEYNLPYIRKYLAGRKVVLVNLAYRQQGLMVAKGNPKGIRGIEDLVREDV
FT                   TFVNRQKGAGTRILLDLKLKELDIDPGRIRGYGKEEYTHLAVAAAVAGGMADAGLGILA
FT                   AARAMDLDFVPVAPERFDIAIPHEFYPMDSIQKVLKILRSEEFKRKIESLGGYDTSRTG
FT                   ELIGGD"
FT   gene            271416..272390
FT                   /locus_tag="Toce_0274"
FT   CDS_pept        271416..272390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0274"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="COGs: COG2896 Molybdenum cofactor biosynthesis
FT                   protein;
FT                   InterProIPR013483:IPR007197:IPR010505:IPR006638:IPR 000385;
FT                   KEGG: pth:PTH_2623 molybdenum cofactor biosynthesis enzyme;
FT                   PFAM: molybdenum cofactor synthesis domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: Molybdenum cofactor biosynthesis protein A; TIGRFAM:
FT                   molybdenum cofactor biosynthesis protein A; PFAM:
FT                   Molybdenum Cofactor Synthesis C; Radical SAM superfamily;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A,
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07057"
FT                   /db_xref="GOA:D9S0C9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0C9"
FT                   /protein_id="ADL07057.1"
FT                   /translation="MKDRFGREIDYIRVSVTDRCNFRCIYCMPEGGVMPKTCADILRFE
FT                   EIARFLEAIVPLGISTVRITGGEPLVRKGIADFVRMVRRIPGVKDIAMTTNGSLLAGMA
FT                   ADLKSAGLNRVNISLDSLRPERFGRVTRGGDLKSVLKGIDAALENGLEPVKINCVVIKG
FT                   FNDDEIMDFAKLTIERNLTVRFIELMPVGESKKARMNFVPAGRISRSLGGELEPVEYPE
FT                   EGKGPAVYYRLPGAKGFIGFIAPMTRHFCAECNRVRLTSDGKLKVCLDSEEEFDVKAAL
FT                   RGGASGEDLRRIFTGALMRKPDGHRMNAVRFGKPGRTMCQIGG"
FT   gene            272393..272887
FT                   /locus_tag="Toce_0275"
FT   CDS_pept        272393..272887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0275"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="COGs: COG0315 Molybdenum cofactor biosynthesis
FT                   enzyme; InterPro IPR002820; KEGG: chy:CHY_0803 molybdenum
FT                   cofactor biosynthesis protein C; PFAM: molybdopterin
FT                   cofactor biosynthesis MoaC region; SPTR: Molybdenum
FT                   cofactor biosynthesis protein C; TIGRFAM: molybdenum
FT                   cofactor biosynthesis protein C; PFAM: MoaC family;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07058"
FT                   /db_xref="GOA:D9S0D0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0D0"
FT                   /protein_id="ADL07058.1"
FT                   /translation="MEFTHFDGQGRARMVDVSGKGETVRTAVARGYVFMKPETLSMIKE
FT                   GRIKKGDVLAVAQVAGIMAAKKTPDIIPMCHNITLTGVDMDFSIIDERSAVAVEARVKC
FT                   TGRTGVEMEALTAVSAACLTIYDMCKSVDKDMVIKNIQLVEKSGGTSGDFRREEEVPWE
FT                   K"
FT   gene            272875..273801
FT                   /locus_tag="Toce_0276"
FT   CDS_pept        272875..273801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0276"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0521 Molybdopterin biosynthesis protein;
FT                   InterPro IPR020817:IPR005302:IPR001453:IPR008284; KEGG:
FT                   ddf:DEFDS_0070 hypothetical protein; PFAM: molybdopterin
FT                   binding domain; MOSC domain containing protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: molybdenum
FT                   cofactor synthesis domain protein; PFAM: MOSC domain;
FT                   Probable molybdopterin binding domain; TIGRFAM: molybdenum
FT                   cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07059"
FT                   /db_xref="GOA:D9S0D1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0D1"
FT                   /protein_id="ADL07059.1"
FT                   /translation="MGKVVAVCVSEKKGEKKRDVGKAMLIEGFGIEGDAHAGAWHRQVS
FT                   LLALESIDKMREKGLSVGPGDFAENITTEGIDLSSLPVGTRLRINDVLLEVTQIGKECH
FT                   ERCAIYRQAGDCIMPKEGIFARVLRGGVVSAGDEIEVIPVIRVGILTASDRGAKGERED
FT                   LSGKVIEEMMEAVNGRIEEYVMVPDDLEAIKNSLLAMCEKGLDLVLTTGGTGLSPRDNT
FT                   PEATLAVVEKQVPGIPEAMRQKSLEKTPNAMLSRAVAGIRGRTLIINLPGSPKAVRENL
FT                   EVVLPALPHAVELLRGRVRDCGRPDRH"
FT   gene            274127..274411
FT                   /locus_tag="Toce_0277"
FT   CDS_pept        274127..274411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0277"
FT                   /product="Chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR020818:IPR001476:IPR018369; KEGG: tit:Thit_0563
FT                   chaperonin Cpn10; PFAM: Chaperonin Cpn10; SPTR: 10 kDa
FT                   chaperonin; PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07060"
FT                   /db_xref="GOA:D9S0D2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0D2"
FT                   /protein_id="ADL07060.1"
FT                   /translation="MNIRPLGDRIVIKVLEKEEKTKGGIVLPDTAKEKPQKGEVIAVGT
FT                   GEIIDGKRVPLEVKVGDKIIFSKYAGTEVKFDDEEYLILRQSDVLAIIE"
FT   gene            274436..276046
FT                   /locus_tag="Toce_0278"
FT   CDS_pept        274436..276046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0278"
FT                   /product="chaperonin GroEL"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR001844:IPR002423:IPR018370; KEGG:
FT                   tpd:Teth39_1721 chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; SPTR: 60 kDa chaperonin; TIGRFAM: chaperonin
FT                   GroEL; PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07061"
FT                   /db_xref="GOA:D9S0D3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0D3"
FT                   /protein_id="ADL07061.1"
FT                   /translation="MAKQIKFNEDARRALLKGIDKLANTVKVTLGPKGRNVVLDKKFGT
FT                   PTITNDGVTIAREIELEDPFENMGAQLIKEVATKTQDVAGDGTTTATLLAQAIIHEGMK
FT                   NVVAGANPMLIKKGIEKAVKAIVEELKTFSKPVETKEAIAQVASISAADEEIGNLIAEA
FT                   MEKVGKDGVITVEESKTMGTTLEVVEGMEFDRGYISPYMVTDAEKMEAVLDDPYILITD
FT                   KKLSNIQDLIPILEKVVQAGAKLLIIAEDVEGEALATLVVNKLRGTLLSVAVKAPGFGD
FT                   RRKAMLQDIAILTGGQVISEELGIDIKTVTMDMLGRARQVKVNKEKTIIVDGAGSKEEI
FT                   KKRINSIKAQIEETTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEKKHRIEDALS
FT                   ATKAAVEEGIVPGGGTAFINALPALDKLSVDGDEKIGVEIIRRALEEPVRQIAYNAGLD
FT                   GSVIVEKLKGMEKGIGFDALREEFGDMIKKGIVDPTKVTRSTLQNAASVAAMVLTTEAV
FT                   VAELPEKEKNQPMPNPDMY"
FT   gene            complement(276217..276651)
FT                   /locus_tag="Toce_0279"
FT   CDS_pept        complement(276217..276651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2764 conserved hypothetical protein; KEGG:
FT                   cth:Cthe_0331 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07062"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0D4"
FT                   /protein_id="ADL07062.1"
FT                   /translation="MVGVEIDMVVTDSLKALELYEKIFDIERVEVTDFPKGENEVIFTL
FT                   YGVRFHMLDENPKFGLKAPNPDEPKTIWFNILVPDIKETFSKAISAGCTEVQPVTEMPD
FT                   YGVSNAIFIDPFGYQWMLHQIHKEVSFEERIRLWEEKRDN"
FT   gene            276838..278361
FT                   /locus_tag="Toce_0280"
FT   CDS_pept        276838..278361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0280"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG4584 Transposase and inactivated
FT                   derivatives; InterPro IPR001584:IPR017894; KEGG:
FT                   cth:Cthe_1995 hypothetical protein; PFAM: Integrase
FT                   catalytic region; SPTR: Putative uncharacterized protein;
FT                   PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07063"
FT                   /db_xref="GOA:D9S0D5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0D5"
FT                   /protein_id="ADL07063.1"
FT                   /translation="MLTMTHIDNIRKAFFMKGQNISEIAREFQKDRKTIRKYIYQEDWN
FT                   TRVKVEEVKHTFPKLDPFKADIDQWLEEDKKARKKQRHTAKRIYDRLCEKYQDKFNCSY
FT                   RTVAGYVAMRKKELYQDNSCRLPLEHIPGEAQVDFGEADFYENGTLHHGFYLNLSFPYS
FT                   NVGYTQLFKGENQECLFQGLKDIFEHLGGVPRKLWFDNASTIVKLSKNGERKLTDAFLR
FT                   FKQHYGFEAVFCNPASGHEKGNVENKVGYHRRNLLVPVPRFERLEDFNRELLRLCDQDM
FT                   HREHYRKEASIAELFNEDRKALLELPTVPYEVAGYITVKTNAYAKFSLNGGKHLYSTAP
FT                   KYANSRVLVKITAHEVIPLDESHREIVRHQRLYGDNKQESMDWLPYLTQLSRCPGALKY
FT                   SGIYSMLPDPLREYLDGLSKSERGKALKALAVLCTKSSFEQAVNAVAEALLYGVQDLDS
FT                   LVAIHNRITGITPQLEPVKIPEGVPELTAFRFNAEDYDKAFLKGGANLC"
FT   gene            278355..279086
FT                   /locus_tag="Toce_0281"
FT   CDS_pept        278355..279086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0281"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="COGs: COG1484 DNA replication protein; InterPro
FT                   IPR002611:IPR003593; KEGG: cth:Cthe_1996 IstB-like
FT                   ATP-binding protein; PFAM: IstB domain protein ATP-binding
FT                   protein; SMART: AAA ATPase; SPTR: IstB-like ATP-binding
FT                   protein; PFAM: IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07064"
FT                   /db_xref="GOA:D9RYE5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYE5"
FT                   /protein_id="ADL07064.1"
FT                   /translation="MLKDEIAACCKALKLSRNLVENCDKIEAQSHEEYLLKLLRLELEH
FT                   RDASRKDRLLKNAGFYTIKTFAGYIFDEIKLPQGLTPQDLKDCKFLEEKKNLILYGNVG
FT                   TGKTHLATAIGVEACKKGYNVKFFRTAALVNRLVEARKGGELSGLLKQLSKPDLLICDE
FT                   WGYVPLDREGAQLLFQVISDCYERRSVVITTNLEFSRWASIFYDEQMTAAMIDRLIHHS
FT                   YLLIFDGQSYRMRQSLMRQLS"
FT   gene            complement(279318..279650)
FT                   /locus_tag="Toce_0282"
FT   CDS_pept        complement(279318..279650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2296 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07065"
FT                   /db_xref="GOA:D9S0Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q1"
FT                   /protein_id="ADL07065.1"
FT                   /translation="MISLLNLGSLVLGLIAWILPVVNLMRYKKHDHRNWVALSIISISI
FT                   SACAVSLYFQILYNYHLVKITDWSALMDITDNVTFVASVLLIVTIILNAITLLVYRDKI
FT                   ASRRLK"
FT   gene            280010..280330
FT                   /locus_tag="Toce_0283"
FT   CDS_pept        280010..280330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppp:PHYPADRAFT_234441 hypothetical protein;
FT                   SPTR: CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07066"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q2"
FT                   /protein_id="ADL07066.1"
FT                   /translation="MNSVVFEVRRRLAKAPRPAFVAALLRDDGTVIDIVPAVDNKSIEA
FT                   AAGRRRARKAVIVAFLENVSQEKLREIVLRYNGLMLEAEFYAIVQDRPTYYTVARLKKK
FT                   AG"
FT   gene            280418..280759
FT                   /locus_tag="Toce_0284"
FT   CDS_pept        280418..280759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1581 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07067"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q3"
FT                   /protein_id="ADL07067.1"
FT                   /translation="MALDDLEKAKKEVTASGSGEEARITEIGYFYLAQQINTLMQIHNE
FT                   FRNNVDLRFDSLRQEIKQQIDGIKQELKGEMDSVKQQNGGMRQEFKGEIDSVKQQIDGF
FT                   RQALVGEIN"
FT   gene            280987..281688
FT                   /locus_tag="Toce_0285"
FT   CDS_pept        280987..281688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0285"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR001867; KEGG: dae:Dtox_2625
FT                   two component transcriptional regulator, winged helix
FT                   family; PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07068"
FT                   /db_xref="GOA:D9S0Q4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q4"
FT                   /protein_id="ADL07068.1"
FT                   /translation="MQQLSCGRILVVEDEDSIRRFIVINLKRNGYEVIEAASGEEALMK
FT                   AMEGKPDLVVLDVMLPGMDGFEVCRLLREKLPDMAVIMLTARGQDIDKIMGLELGADDY
FT                   VVKPFNPLELTARIRAVLRRIRKAGLEDEKISSGPFMLDLKGHRVLKKGEELDLTPREF
FT                   DLMALFMKNPGKAFSRDEILNAVWGADYVGDPKTVDVHIRRLREKVEDDPGRPEYIETV
FT                   WGIGYRWREKY"
FT   gene            281685..283136
FT                   /locus_tag="Toce_0286"
FT   CDS_pept        281685..283136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0286"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003660:IPR003661:IPR003594:IPR004358:IPR 005467;
FT                   KEGG: dae:Dtox_2624 histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SPTR: Sensor protein; PFAM: HAMP domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07069"
FT                   /db_xref="GOA:D9S0Q5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q5"
FT                   /protein_id="ADL07069.1"
FT                   /translation="MKGIKARLLKSFLAVILLTVIIFEIILIISVRQYYFGNVEEVLSK
FT                   QAEVSANFYRQYLARDDFLEKNADVLLESFSAPTAAQVQIIDEEGILLADSQFAGHGGA
FT                   VGTPDVKKALKGLPSKWQGRMPGTGERVLAVSYPLKSGDTVVGVVRFVTSLEGVNGVVG
FT                   KIAVILISIGLAAVIISVFAAAILSQTIVKPLNDITRVAEEMAKGKFTARAPKRYDDEV
FT                   GRLADTLNFMAQEIMRQEELKNEFIASVSHELRTPLTAIKGWTITLLSAIRGTSQAGRS
FT                   DIRENAGVPDRRVYLNLDELIEGLEIITKESERLSELVEELLDFSRFEAGAIKLNLDKV
FT                   ALVDTLNYIKTQMMPRAKRQAVEFEIYPEEGLPEILADENRIKQVLINLLDNAFKFTPA
FT                   GGRVRVKAESANDSVRIIVEDTGCGIPPEDLPHVTKKFYKAKSKQPGSGLGLAICDEIV
FT                   RLHGGRMEITSAPGKGTRVEVILPV"
FT   gene            283269..284456
FT                   /locus_tag="Toce_0287"
FT   CDS_pept        283269..284456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0287"
FT                   /product="TPR repeat-containing protein"
FT                   /note="InterPro IPR001440:IPR019734:IPR013026; KEGG:
FT                   dae:Dtox_2626 TPR repeat-containing protein; PFAM: TPR
FT                   repeat-containing protein; SPTR: TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07070"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q6"
FT                   /protein_id="ADL07070.1"
FT                   /translation="MSRLKMFAAIIISGTLLLAGCSMLPAPGSTIRPPQPASTPVENEE
FT                   DIVPVVQKFLPPGAQLEQYGSGPAVRQGDIDAVDGKSEILAVYRVGNNTNEIGAFVLKF
FT                   KDGEWQKVWQQQGFGYALDLMEFADITGDGKPEVLIGTTIGASAGNGLDIFSWQQDTLK
FT                   KIAGTGYHRLEILHLSGNSTEKGYDGRAQLAVWQKDTITAMAVDVLRWEEIGLVPAVDL
FT                   YREYFPKVVEYYEEQLKKAPDAPALWFYLADAQQKAGMAEEALKSAEKGLALKGDYPQD
FT                   YRFKVVMGRALNDLGEYQRAISFFDEVMKAKEPLPPDIGQQGEPAYLKKIKAEALIDMG
FT                   KSYEGLRQYEKAEDCYRRSLEITKSLFKEDSIEKKLALMPAEKALQRLKGVRGNE"
FT   sig_peptide     283269..283358
FT                   /locus_tag="Toce_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            284580..285686
FT                   /locus_tag="Toce_0288"
FT   CDS_pept        284580..285686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0288"
FT                   /product="Methicillin resistance protein"
FT                   /note="COGs: COG2348 Uncharacterized protein involved in
FT                   methicillin resistance; InterPro IPR003447; KEGG:
FT                   mta:Moth_2408 methicillin resistance protein; PFAM:
FT                   Methicillin resistance protein; SPTR: Methicillin
FT                   resistance protein; PFAM: FemAB family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07071"
FT                   /db_xref="GOA:D9S0Q7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q7"
FT                   /protein_id="ADL07071.1"
FT                   /translation="MDFIINGDPSKYTKFVETHPKGHVLQTLEWAKVKEDNWRPIYVTV
FT                   EEKGAVKASMLLLLRQLPMIRKNIIYSPRGPVCDMHDFDTLKFLMDNVRKLARKNNAIM
FT                   LKIDPDISIKDQIVANNLKKLGFKQNMEALNFEGIQPRFVFRLDITPSLEELLMSFHPK
FT                   TRYNIRLAQRRGVKIRIGKREDLKEFHRIMEITGLRDGFVVRSLDYFEKMYDSLEPRGY
FT                   LELALAEYEGKTIAGIICLFCGTKCWYLYGASSNEHRNVMPNYLLQWEMIKRAKERGCT
FT                   LYDFRGVSGDLNPDNPLYGLYRFKKGFNGEFTEFIGEFDMVLSPFWYTVWQKGIPIFRN
FT                   IRRKITLMLKKSKFEDKRSSTKDELGAH"
FT   gene            285686..286840
FT                   /locus_tag="Toce_0289"
FT   CDS_pept        285686..286840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0289"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COGs: COG0787 Alanine racemase; InterPro
FT                   IPR000821:IPR001608:IPR011079:IPR020622; KEGG:
FT                   nth:Nther_0307 alanine racemase; PFAM: alanine racemase
FT                   domain protein; PRIAM: Alanine racemase; SPTR: Alanine
FT                   racemase; TIGRFAM: alanine racemase; PFAM: Alanine
FT                   racemase, C-terminal domain; Alanine racemase, N-terminal
FT                   domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07072"
FT                   /db_xref="GOA:D9S0Q8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q8"
FT                   /protein_id="ADL07072.1"
FT                   /translation="MGPYKKYMEVNLRALRQNYETIRREVGVPVMAVVKGDAYGHGAKD
FT                   VALALQEAGVEWFGVEFLEEAVELREAGIKGRILCLTGPVTREDCEIFIEKDVIPTIYN
FT                   LDRADLLNKTAARRGVSCRVHLKFDTGLGRFGFLYEDLDRVIDGLRSFSHLIYEGAYTH
FT                   FAEAFAKKPDYTLYQLSVFQRVLDKLEQSGIKVAIRHAANSVAAMDFPEARLDMVRIGS
FT                   ALYGITMFKNTSVRLERVARLKVKIIDVKSLPRGSYIGYGRTYKTQRDTVIGIIPVGYF
FT                   EGLKVQRRNYAFTLVGLLRNIYHEIKDFLNPVPLVFMDGKPLPILGRIGMQLTAIDLTG
FT                   TGAGIGDEVTVAIDPVYFRYGARLYTDSRDVQEGFLPGIEKGVM"
FT   gene            complement(287010..287467)
FT                   /pseudo
FT                   /locus_tag="Toce_0290"
FT   gene            complement(287627..287782)
FT                   /locus_tag="Toce_0291"
FT   CDS_pept        complement(287627..287782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07073"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Q9"
FT                   /protein_id="ADL07073.1"
FT                   /translation="MASEVVKKAVASKKTGGAKKRQAYRSLLRANMGYTHYWYSPMRLR
FT                   RVSAAG"
FT   gene            288424..291060
FT                   /locus_tag="Toce_0292"
FT   CDS_pept        288424..291060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0292"
FT                   /product="PTS system transcriptional activator"
FT                   /note="COGs: COG1221 Transcriptional regulators containing
FT                   an AAA-type ATPase domain and a DNA-binding domain;
FT                   InterProIPR002078:IPR011608:IPR004701:IPR003593:IPR 002464;
FT                   KEGG: cbk:CLL_A3361 transcriptional regulatory protein
FT                   LevR; PFAM: sigma-54 factor interaction domain-containing
FT                   protein; PRD domain protein; PTS system fructose subfamily
FT                   IIA component; SMART: AAA ATPase; SPTR: PTS system
FT                   transcriptional activator; PFAM: PTS system fructose IIA
FT                   component; Sigma-54 interaction domain; PRD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07074"
FT                   /db_xref="GOA:D9S0R0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R0"
FT                   /protein_id="ADL07074.1"
FT                   /translation="MPHLSKFYEVRLLSDVDIKLNRKDKVYKKLKELTESLTLNDLNVD
FT                   RKFGFEAGFIGKKIGINRNNTSKELNRLVREGKAVKIKGKPVLYLDKNCLETRWKLKIT
FT                   DHAIKDYETFKKLFLNSLEPTQNFEMISNSAPYRSILDRLIGADESLKAQIEQAKAAIL
FT                   YPPHGLHTLIVGPTGVGKTTFAEAMYRYAVEMGKIPATAPFVVFNCADYAENPQLLLSQ
FT                   LFGYVRGAFTGADREKKGLVEQADGGILFLDEVHRLPPEGQEMMFLLMDKGIYRRLGES
FT                   ENTRQARVLIIAATTEDPKSALLHTFLRRIPVVIMLPGLEERSLRERMAFVCRFFREES
FT                   ARIKVPLKVSKEVLKAFLLYDCPGNIGQLKSDIQLICARAFLDYMTFKKDEVEVKLSHL
FT                   SRRVREGFFKIGEKRGEIAQKFNLGVGEDVVFDGKDENMWDNLEGTVFIDEYKTADDFY
FT                   EVIESSWNEFSRKGLSERKIREMVDRQIEEYFDGIFSRIKLKGPVVDRDALAKIVSPRI
FT                   LKTVEDTLTDMREALGGAFSQKFIYSVALHVSILLERLRVGTVISHPDKKSIAREHPLE
FT                   YELARKVKAKLEERLFIEIPEDEIAFLAMLIYAAKVKKEQGNIGVLVISHGRAAASTMA
FT                   QVANELLGVNHARALDMPLEEKVETVLEKAVEEVKRIDRGKGVLILVDMGSLAAFSEII
FT                   TERTGIPTRTVEMVSTPMVIEATRKALLPDMTLDMLAEDVRCMSPYIGKGQHEIRSATY
FT                   GEYKGGYFRGILIDILGKTLTFLNPQKACDNLYEVLKKVLHKFDRKIDDDIYVKFLFHC
FT                   SCMIERIIRGEPLPYKNLKAIKKSRSGIFDVLKTQFELIEETFGIQIPDTEFAYIVEML
FT                   DTHFDTL"
FT   gene            291298..292350
FT                   /locus_tag="Toce_0293"
FT   CDS_pept        291298..292350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0293"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro
FT                   IPR013154:IPR013149:IPR002328; KEGG: cdf:CD0490 putative
FT                   sugar-phosphate dehydrogenase; PFAM: Alcohol dehydrogenase
FT                   GroES domain protein; Alcohol dehydrogenase zinc-binding
FT                   domain protein; SPTR: Putative sugar-phosphate
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES-like
FT                   domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07075"
FT                   /db_xref="GOA:D9S0R1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R1"
FT                   /protein_id="ADL07075.1"
FT                   /translation="MKAAKFYGIRDVRIEDIPEPTIESGNDVIIKVKAVGICGSDISKY
FT                   GKTGPHLPGEVPGHEFSGIVVEVGPNVKSVKVGDRVAVCPSLPCFQCDFCKQGIFSECE
FT                   SLNILGNHNHLGAFAEYTKISERNLVKIPEDIDFETAAGMEPACIAGHGLFRAKVKVED
FT                   TVAVLGVGPIGLFLIQWAKIFGASKVIAIDIFDEKLRIAKELGADFCINSKICDPVAKV
FT                   KEITDSKGVDVAMESAGTSQTCAQVLLLPRKGGKVLYAGVPYSDVTFSRDSFEKIMRNE
FT                   LTLIGSWFSNSFPFPGREWYSALRYMREGKLKVKPLITHRIGIEDIPATLEKIYKREIF
FT                   FGKIMVIPEE"
FT   gene            292409..292843
FT                   /locus_tag="Toce_0294"
FT   CDS_pept        292409..292843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0294"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="COGs: COG2893 Phosphotransferase system
FT                   mannose/fructose-specific component IIA; InterPro
FT                   IPR004701; KEGG: cbk:CLL_A3360 PTS system fructose IIA
FT                   component; PFAM: PTS system fructose subfamily IIA
FT                   component; SPTR: PTS system fructose subfamily IIA
FT                   component; PFAM: PTS system fructose IIA component;
FT                   TIGRFAM: PTS system, mannose/fructose/sorbose family, IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07076"
FT                   /db_xref="GOA:D9S0R2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R2"
FT                   /protein_id="ADL07076.1"
FT                   /translation="MIGILVVTHGDFGKQLIKSAELILGSQSHYETLGLFHGDNIDQFG
FT                   ERILEKIKSLDDGDGVLAFIDLYGGSPFNAITLNFKKLTAKHKLQCITGVNLPMILEAF
FT                   SSRQFCQIEELKKCCLDVGKKGIKDITEQLNSIEMDVKTN"
FT   gene            292862..293338
FT                   /locus_tag="Toce_0295"
FT   CDS_pept        292862..293338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0295"
FT                   /product="Protein-N(pi)-phosphohistidine--sugarphosphotran
FT                   sferase"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG3444 Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB; InterPro IPR004720:IPR000209; KEGG: cbk:CLL_A3359 PTS
FT                   system sorbose subfamily IIB component; PFAM: PTS system
FT                   sorbose subfamily IIB component; PRIAM:
FT                   Protein-N(pi)-phosphohistidine--sugar phosphotransferase;
FT                   SPTR: Protein-N(Pi)-phosphohistidine--sugar
FT                   phosphotransferase; PFAM: PTS system sorbose subfamily IIB
FT                   component; TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07077"
FT                   /db_xref="GOA:D9S0R3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R3"
FT                   /protein_id="ADL07077.1"
FT                   /translation="MSDIVLARIDDRLIHGQVITGWVRATKANRIIIVDDGVAQDPFMT
FT                   KVMLMAAPPAIKVEVYNIQQAVDKLMSSETEQDRIIILVKTPKTIYELIKKGIDLKEVN
FT                   VGGMGAGPGRKQMYKNISVSQEERNIFREIINLGVQVNIRIVPDDKSISIEKFL"
FT   gene            complement(293419..294642)
FT                   /locus_tag="Toce_0296"
FT   CDS_pept        complement(293419..294642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0296"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="COGs: COG3547 Transposase and inactivated
FT                   derivatives; InterPro IPR003346; KEGG: pth:PTH_2606
FT                   transposase; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; SPTR: Hypothetical transposase; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07078"
FT                   /db_xref="GOA:D9RYI8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYI8"
FT                   /protein_id="ADL07078.1"
FT                   /translation="MFYGGIDVAKHSHEVCLVNDSGDIVLKMHLDNNHKGMNKLLQALE
FT                   RLGLKPDDVKFCLEATGHYWLPIYCYLTNQGFELHVINPIQSDALRNLYVRKTKTDQKD
FT                   ALLLADLLRLGRAPETRLPSETTLKLQSLSRLRFEFVRQVGGLKNRVLGILDRIFPEYP
FT                   DCFSDVFIRTSRELLKSYPEPEELAEVDLSELSAFLKEHSRGRFGEERAKKIQSLAKGT
FT                   FGITMALDAFTLQLRLLVEQIEFIEEQIKVIEDAINEVMEELRPSKDTPYRHVIETIPG
FT                   IGPVLAAAIIGEIGDISRFPNPRALVAYAGLDATVRASGLFEGTRNRMSKRGSPVLRNS
FT                   LWLAAVSARRFNPELRAYYEQKRSQGKHSNVATGAVARKLVHLIYSLWKDNRPYDPDYQ
FT                   WSPPGKNA"
FT   gene            294957..295912
FT                   /pseudo
FT                   /locus_tag="Toce_0297"
FT   gene            296028..297551
FT                   /locus_tag="Toce_0298"
FT   CDS_pept        296028..297551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0298"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG4584 Transposase and inactivated
FT                   derivatives; InterPro IPR001584:IPR017894; KEGG:
FT                   cth:Cthe_1995 hypothetical protein; PFAM: Integrase
FT                   catalytic region; SPTR: Putative uncharacterized protein;
FT                   PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07079"
FT                   /db_xref="GOA:D9S0R5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R5"
FT                   /protein_id="ADL07079.1"
FT                   /translation="MLTMTHIDNIRKAFFMKGQNISEIAREFQKDRKTIRKYIYQEDWN
FT                   TRVKVEEVKHTFPKLDPFKADIDQWLEEDKKARKKQRHTAKRIYDRLCEKYQDKFNCSY
FT                   RTVAGYVAMRKKELYQDNSCRLPLEHIPGEAQVDFGEADFYENGTLHHGFYLNLSFPYS
FT                   NVGYTQLFKGENQECLFQGLKDIFEHLGGVPRKLWFDNASTIVKFLKNGERKLTDAFLR
FT                   FKQHYGFEAVFCNPASGHEKGNVENKVGYHRRNFLVPVPRFEKLEDFNRELLRLCDQDM
FT                   HREHYRKEASIAELFNEDRKALLDLPTVAYEVADYITVKTNAYAKFSLNGGKHLYSTAP
FT                   KYANSRVLVKITAHEIIPLDESHREIVRHQRLYGDNKQESMDWLPYLTQLPRCPGALKY
FT                   SGIYSMLPDPLREYLDGCSKSERGKALKAIASLCAKSSFEQAVNAVAEALLYGVQDLDS
FT                   LVAIHNRMTSITPPLEPVKIPEGVPELTAFRFNAEDYDKAFLKGGANVC"
FT   gene            297545..298276
FT                   /locus_tag="Toce_0299"
FT   CDS_pept        297545..298276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0299"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="COGs: COG1484 DNA replication protein; InterPro
FT                   IPR002611:IPR003593; KEGG: cth:Cthe_1996 IstB-like
FT                   ATP-binding protein; PFAM: IstB domain protein ATP-binding
FT                   protein; SMART: AAA ATPase; SPTR: IstB-like ATP-binding
FT                   protein; PFAM: IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07080"
FT                   /db_xref="GOA:D9S0R6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R6"
FT                   /protein_id="ADL07080.1"
FT                   /translation="MLKDEIAACCKALKLSRNLVENCDKIEAQSHEEYLLKLLRLELEH
FT                   RDASRKDRLLKNAGFYTIKTFADYIFDGIKLPQGLTPQDLKDCKFLEEKKNLILYGNVG
FT                   TGKTHLATAIGVEACKKGFNVKFFRTAALVNRLVEARKGGELSGLLKQLSKPDLLICDE
FT                   WGYVPLDREGAQLLFQVISDCYERRSVVITTNLEFSRWASIFYDEQMTAAMIDRLIHHS
FT                   YLLIFDGQSYRMRQSLMRQLS"
FT   gene            298336..299043
FT                   /locus_tag="Toce_0300"
FT   CDS_pept        298336..299043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0300"
FT                   /product="PTS system IID component, Man family (TC 4.A.6)"
FT                   /note="COGs: COG3716 Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID; InterPro IPR004704; KEGG: cbk:CLL_A3357 PTS system
FT                   mannose/fructose/sorbose family IID component; PFAM: PTS
FT                   system mannose/fructose/sorbose family IID component; SPTR:
FT                   PTS system mannose/fructose/sorbose family IID component;
FT                   PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07081"
FT                   /db_xref="GOA:D9S0R7"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R7"
FT                   /protein_id="ADL07081.1"
FT                   /translation="MQKTMIPIIKKLYTTKEDIIAAIKRHLVFFNTEPICGSVIHGITI
FT                   AMEEEKANGEPISDEGINAIKTGLMGPLAGIGDTITQGIITPIMLAICIGLTMSGNIAS
FT                   PIIFVLAQYAIMIGISYTMWMNGYSYGKKAVETILEGGLINKVIEGASILGTLVMGGLV
FT                   GRFVTLSTPIVININQVKFSLQKDLLDKIMPGLIPMLLTLLVLHLIKKGVSPIKMMGLL
FT                   IVLGVIGGVLGIF"
FT   gene            complement(299081..299821)
FT                   /locus_tag="Toce_0301"
FT   CDS_pept        complement(299081..299821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0301"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /note="COGs: COG2045 Phosphosulfolactate phosphohydrolase;
FT                   InterPro IPR005238; KEGG: cac:CAC3233 2-phosphosulfolactate
FT                   phosphatase; PFAM: 2-phosphosulfolactate phosphatase; SPTR:
FT                   Probable 2-phosphosulfolactate phosphatase; TIGRFAM:
FT                   2-phosphosulfolactate phosphatase; PFAM:
FT                   2-phosphosulpholactate phosphatase; TIGRFAM:
FT                   2-phosphosulfolactate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07082"
FT                   /db_xref="GOA:D9S0R8"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R8"
FT                   /protein_id="ADL07082.1"
FT                   /translation="MFIEVYPTAQSVKDLNGKTAIVIDVLRATSVITTALHNGAERVIP
FT                   VPSVEDAFRLARDLKGNSLLGGERRALKIPGFDLGNSPLEYKKELVEGKTVILTTSNGT
FT                   KAIKASESAEHILIGCFLNASAAAGKALQTLSSETTGVAVLCAGTLGEFSLDDAACAGL
FT                   IVDILVRNIKRINEIPELSDLAFACRDLYLEHRHDLKTFISHAAHYKRLLDLGLEKDID
FT                   YCLQQDVLDCVPVYEKKNMAVKIY"
FT   gene            complement(299865..300398)
FT                   /locus_tag="Toce_0302"
FT   CDS_pept        complement(299865..300398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0302"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934:IPR007842; KEGG: pth:PTH_0436
FT                   hypothetical protein; PFAM: DNA polymerase beta domain
FT                   protein region; HEPN domain protein; SPTR: Hypothetical
FT                   membrane protein; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07083"
FT                   /db_xref="GOA:D9S0R9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0R9"
FT                   /protein_id="ADL07083.1"
FT                   /translation="MDNIEKCVSELKTFSMLHQQYLICVLEGIIEYYKDSLLGLTIFGS
FT                   YARGENRKNSDLDLLIILKKAPGFSERIKEFVNNIELAHESLGQQLYEEEDILCELSPY
FT                   ILSKEEALKFQPVYFDLTEHNKILFDPEGIISRIYGAEDFIPTEEYESEDAETAIKDAE
FT                   FVLKTVEEAFKKGI"
FT   gene            complement(300471..301643)
FT                   /locus_tag="Toce_0303"
FT   CDS_pept        complement(300471..301643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0303"
FT                   /product="Integrase catalytic region"
FT                   /note="InterPro IPR001584; KEGG: adg:Adeg_0459 integrase
FT                   catalytic region; PFAM: Integrase catalytic region; SPTR:
FT                   Integrase catalytic region; PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07084"
FT                   /db_xref="GOA:D9S0S0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S0"
FT                   /protein_id="ADL07084.1"
FT                   /translation="MTLYQKLKASGNPQAVAQITISLLESHSVKETAKILGVTPRWVYK
FT                   LRERFRLSNGDISACIKKRGPKFRMPNRTPEHIENLVVTLAKETNLGSKRLALFIKNTF
FT                   NIQLSPFTIRNIRRRYGIHCRKHKTLTGSRRFATDFSAFEPLQLWQIDAKHIADQSALP
FT                   PEAYASIFKNKLPPFQFTAIDIKTRLRFIAYADSLDFKNGLTFMLLVAAWLRAFGVKHQ
FT                   LFFQTDNGAEFGGSAGSRKRKLIQKLIFDHWNVSLLNIPERNKETNCFVERSHRTDDEE
FT                   FYALNLKKVTSRTSFLKMAQNWILYFNYRRPHFGKNMNGMTPVEALKFYRCFYHPAIGS
FT                   MPVVVLDQLSNYTSLLFDISSLPWDNLPRNKKLLNETMAHYRHSIFSTSL"
FT   gene            302135..302869
FT                   /locus_tag="Toce_0304"
FT   CDS_pept        302135..302869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0304"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="COGs: COG0310 ABC-type Co2+ transport system
FT                   permease component; InterPro IPR018024:IPR002751; KEGG:
FT                   tit:Thit_0368 cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; SPTR:
FT                   Cobalamin biosynthesis protein CbiM; TIGRFAM: cobalamin
FT                   biosynthesis protein CbiM; PFAM: Cobalt uptake
FT                   substrate-specific transmembrane region; TIGRFAM: cobalamin
FT                   biosynthesis protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07085"
FT                   /db_xref="GOA:D9S0S1"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/Swiss-Prot:D9S0S1"
FT                   /protein_id="ADL07085.1"
FT                   /translation="MRKITFIAALLSLLPRYALAMHVMEGFLPFKWCLLWYSIYIPFLM
FT                   AGLIYIKKNIAEEPSKKILLGFAGAFVFALSALKLPSVAGSSSHPTGIGLGAILLGPLP
FT                   MAVIGGIVLLFQALLLAHGGITTLGANAFSMAVAGSFAAYGLYKVAGRVGLSKSASVFL
FT                   GAASGDLMTYIITSLQLALAFPASRGGVAASFAGFSGIFAVTQLPLAIGEGILTVIVLN
FT                   LLEIHAGVVVGRLVKGASNDEG"
FT   sig_peptide     302135..302194
FT                   /locus_tag="Toce_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            302856..303143
FT                   /locus_tag="Toce_0305"
FT   CDS_pept        302856..303143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0305"
FT                   /product="cobalt transport protein CbiN"
FT                   /note="COGs: COG1930 ABC-type cobalt transport system
FT                   periplasmic component; InterPro IPR000209; KEGG:
FT                   tit:Thit_0369 cobalt transport protein CbiN; SPTR: Cobalt
FT                   transport protein CbiN; PFAM: Cobalt transport protein
FT                   component CbiN; TIGRFAM: cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07086"
FT                   /db_xref="GOA:D9S0S2"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S2"
FT                   /protein_id="ADL07086.1"
FT                   /translation="MMKDKKMKKSLLSTALPIALIFLILFVVANFLDSGLEGTDDRAAD
FT                   LALRMNPDYRPWFESVWEPGDDRTEKLLFGLQAVTGVGLAAYFFIRLKAG"
FT   sig_peptide     302856..302942
FT                   /locus_tag="Toce_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            303145..303852
FT                   /locus_tag="Toce_0306"
FT   CDS_pept        303145..303852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0306"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR012809:IPR003339; KEGG: tit:Thit_0370 cobalt ABC
FT                   transporter, inner membrane subunit CbiQ; PFAM: cobalt
FT                   transport protein; SPTR: Cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: Cobalt transport
FT                   protein; TIGRFAM: cobalt ABC transporter, permease protein
FT                   CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07087"
FT                   /db_xref="GOA:D9S0S3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S3"
FT                   /protein_id="ADL07087.1"
FT                   /translation="MLLDNFAYNNNFRSVHPGEKLAFGLLMMFLGFISGPIVHLAVFAV
FT                   MTGILVPGAGIPIRFYLRSLLIPPVFLLPGVLVVVISSGSFDEGMVLFSRSMALVSCFY
FT                   FIAMTTPVPDILMLMHRLRVPDLFIELSLLTYRYLFVLLDAASRIHVSQNSRLGYAYCG
FT                   RGLKSMAMLASSLLIKSLKTADELRISLEARGYDGKLRVLDHREYRISSRNIAVILTLT
FT                   LLLVLLVLGKRIE"
FT   gene            303854..304687
FT                   /locus_tag="Toce_0307"
FT   CDS_pept        303854..304687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0307"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro
FT                   IPR005876:IPR003439:IPR003593:IPR017871; KEGG:
FT                   tpd:Teth39_1883 cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   Cobalt ABC transporter, ATPase subunit; TIGRFAM: cobalt ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   TIGRFAM: cobalt transport protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07088"
FT                   /db_xref="GOA:D9S0S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S4"
FT                   /protein_id="ADL07088.1"
FT                   /translation="MSNYLLEVQEVYFEYPGGIRALNGVSLAVERGKKVAFLGPNGAGK
FT                   STLFLHFNGILRPKKGRILYDGQELVYNRSFLREIRRKVGIVFQDPDAQLFAGTVFQEV
FT                   SFGPMNLNLPSKDVRERVESALSAMGIRELMDRPVHLLSYGQKKRVSIADVLAMDPEVV
FT                   VFDEPTAYLDPRHAGELVEMLDGLHAEGRQVILSTHDVDLAYSWADQIFVMKDGRVIGG
FT                   GSPEEVFMDDELLKRADLKKPLLVEVSDALRQMGLLDGRFPKNARDLLECLREGR"
FT   gene            304690..306087
FT                   /locus_tag="Toce_0308"
FT   CDS_pept        304690..306087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0308"
FT                   /product="hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing) ;cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /note="COGs: COG1797 Cobyrinic acid a c-diamide synthase;
FT                   InterPro IPR004484:IPR011698:IPR017929; KEGG: tit:Thit_0342
FT                   cobyrinic acid a,c-diamide synthase; PFAM: CobB/CobQ domain
FT                   protein glutamine amidotransferase; SPTR: Cobyrinic acid
FT                   a,c-diamide synthase; TIGRFAM: cobyrinic acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain; CobB/CobQ-like glutamine amidotransferase domain;
FT                   TIGRFAM: cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07089"
FT                   /db_xref="GOA:D9S0S5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S5"
FT                   /protein_id="ADL07089.1"
FT                   /translation="MARGIMIAGTHSGSGKTTVSLGLMGAMAKRHKVIPFKVGPDYIDT
FT                   AYHRFACGNHSYNLDAFLLGEERLKALYAEKAECGELAIAEGVMGFFDGMDSTGFGSSA
FT                   HVAGLLSLPVILVVDASGMARSVSAMVKGFRDFDPGVRIAGVILNRVGGERHYALLKEC
FT                   IERDTGIPAVGFLPEDPEIALPERHLGLVPVWEMEGLKGKFERLFYHIERCVDLEKIWN
FT                   ISADAGRVAFTLPQEEPVLAGEKVRIALALDEAFNFYYRGGLELFENFGAELVPFSPLK
FT                   DSALPEGASGIYIGGGFPEIFAGELSRNRPMLEAVKKAVLAGMPVYAECGGLMYLSRAI
FT                   VDKEGRSFPMVEAFDMEAIMTGRLRRFGYARATVLKDNVLAERGTVLCGHEFHHSEVVG
FT                   VVEDTSYLVEKPGGRGRWRCGFVRNNCLATYLHIDFYAYPELVRNFLNRCRSFCASALI
FT                   NEGSADR"
FT   gene            306084..306458
FT                   /locus_tag="Toce_0309"
FT   CDS_pept        306084..306458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0309"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="COGs: COG2138 conserved hypothetical protein;
FT                   InterPro IPR002762; KEGG: tit:Thit_0350 cobalamin (vitamin
FT                   B12) biosynthesis CbiX protein; PFAM: cobalamin (vitamin
FT                   B12) biosynthesis CbiX protein; SPTR: Cobalamin (Vitamin
FT                   B12) biosynthesis CbiX protein; PFAM: CbiX"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07090"
FT                   /db_xref="GOA:D9S0S6"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S6"
FT                   /protein_id="ADL07090.1"
FT                   /translation="MKALLIIAHGSRVDDSAGVMERLASKLKGMGRYDLAEVAYVQFQQ
FT                   PGIGEAVARLVERGAKEIVAVPAFLFRGVHVTRDIPGELKVSKDAHPGVKIFLAEPIGY
FT                   DERICEILAERAAGEVVEIS"
FT   gene            306475..307125
FT                   /locus_tag="Toce_0310"
FT   CDS_pept        306475..307125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0310"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="COGs: COG2082 Precorrin isomerase; InterPro
FT                   IPR003722; KEGG: tit:Thit_0351 precorrin-8X methylmutase;
FT                   PFAM: Precorrin-8X methylmutase CbiC/CobH; PRIAM:
FT                   Precorrin-8X methylmutase; SPTR: Precorrin-8X methylmutase
FT                   CbiC/CobH; PFAM: Precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07091"
FT                   /db_xref="GOA:D9S0S7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S7"
FT                   /protein_id="ADL07091.1"
FT                   /translation="MEYVNYIKDPEAIEKKSFEIIRSRIDARRFSDGELAVVQRVIHAT
FT                   ADFDYEEILEFSPDAVEKGLAALKAGCGIVTDTRMAQAGINRRALEALGCRILCYVDDP
FT                   EAVAIARERGITRSMAAMELASKDPKNLIFAIGNAPTALFKLAELIQEGKVRPSLVVGV
FT                   PVGFVGAAESKETLFRLRVPSIITRGRKGGTTVAVSIVNALLYALVKEGPCGG"
FT   gene            307118..308215
FT                   /locus_tag="Toce_0311"
FT   CDS_pept        307118..308215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0311"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="COGs: COG1903 Cobalamin biosynthesis protein CbiD;
FT                   InterPro IPR002748:IPR018254; KEGG: tit:Thit_0352 cobalamin
FT                   biosynthesis protein CbiD; PFAM: cobalamin (vitamin B12)
FT                   biosynthesis CbiD protein; SPTR: Cobalamin biosynthesis
FT                   protein CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD;
FT                   PFAM: CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07092"
FT                   /db_xref="GOA:D9S0S8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S8"
FT                   /protein_id="ADL07092.1"
FT                   /translation="MDRYVLKNGKKLRCGYTTGSCAAAASKAAVAMLFNGDIPGTVQIE
FT                   TPGGELLTIKIESAQKGPDWAVCCVRKDGGDDPDVTHGLLVCAKVRKIDGEGILVEAGE
FT                   GIGTVTKPGLPVKPGEPAINPVPMAMIKREVAKVLPEGCGVRLVLSIPGGEKVAEKTFN
FT                   PRLGIVGGLSILGTTGIVEPMSLESLKETLALELSVLSAQGIKNLVLTPGNYGKSYAIK
FT                   SGIDESLIVSCGNYLGFTLEKAVEMKFEEVHLVGDIGKLIKVAAGIFNTAGRVADARAE
FT                   IMAAYAAYFGAGPDTVRKVLASNTTEEAMELIEKSGINLSEFAAFVAGRVRDKCLWYTG
FT                   GKIEVSVELISNKRGLLAAVGVEKW"
FT   sig_peptide     307118..307210
FT                   /locus_tag="Toce_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            308209..308850
FT                   /locus_tag="Toce_0312"
FT   CDS_pept        308209..308850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0312"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="COGs: COG2241 Precorrin-6B methylase 1; InterPro
FT                   IPR012818:IPR000878:IPR019809; KEGG: tit:Thit_0353
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: Precorrin-6y
FT                   C5,15-methyltransferase (Decarboxylating), CbiE subunit;
FT                   TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: precorrin-6y
FT                   C5,15-methyltransferase (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07093"
FT                   /db_xref="GOA:D9S0S9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0S9"
FT                   /protein_id="ADL07093.1"
FT                   /translation="MVSVVGIGPGAPEYITPAALKRIKEAEVLVGAKRHLNLFKDLACK
FT                   KIPLEAGLDLGKVLKSPGRVAVIATGDPGIYGILDLVLKHVSEEEVDVIPGISSVQYMM
FT                   ARLRLPAKDTAVVSLHGRGGDIVSAVRNHSTVVVLTDPVNNPVKIARLLLENGILDREI
FT                   YVGQNLSYENEAIEKYGVKELAGSTGEFDINVVVIRICGNTESEYPMISF"
FT   gene            308808..309416
FT                   /locus_tag="Toce_0313"
FT   CDS_pept        308808..309416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0313"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="COGs: COG2242 Precorrin-6B methylase 2; InterPro
FT                   IPR014008:IPR004398:IPR020596; KEGG: tit:Thit_0354
FT                   precorrin-6Y C5,15-methyltransferase (decarboxylating),
FT                   CbiT subunit; PFAM: conserved hypothetical protein; SPTR:
FT                   Precorrin-6Y C5,15-methyltransferase (Decarboxylating),
FT                   CbiT subunit; TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Met-10+
FT                   like-protein; TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07094"
FT                   /db_xref="GOA:D9S0T0"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T0"
FT                   /protein_id="ADL07094.1"
FT                   /translation="MWEYGIGIPDDLFLRGDVPMTKEETRVISLAKMRLKKNSVVWDIG
FT                   AGTGSVSVEAALFCSEGRVFAVEKDKAALGLIVENARKFGATNLVPVPGEAPEALENLP
FT                   DPDRIFIGGTGERTADVLKAASSRLKKDGVMVINAVTVETVYAATGLLEGEGFEWDLLL
FT                   VNIASSRKAGQKHMMIARNPVFIITARPMGRDFENGECA"
FT   gene            309416..310105
FT                   /locus_tag="Toce_0314"
FT   CDS_pept        309416..310105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0314"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="COGs: COG2243 Precorrin-2 methylase; InterPro
FT                   IPR012382:IPR006364:IPR000878; KEGG: tex:Teth514_0312
FT                   precorrin-2 C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; SPTR:
FT                   Precorrin-2 C20-methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07095"
FT                   /db_xref="GOA:D9S0T1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T1"
FT                   /protein_id="ADL07095.1"
FT                   /translation="MKTKSAGKFYGVGVGPGDPELLTLRAVRVLEKVDIVIAPSAGGDS
FT                   IAFEIAKPYIKGKLLKMPFEMGACGRARQEALDKNADLIRRMLLEGNDTAFITLGDPMT
FT                   YSTFIYMTERLTDFEIEVIPGVTSFSAAAAKLLMPVAEGRKPFAVVPAGDREILEKALE
FT                   NFDNVVVMKVSSDYGGVLDLLEQKGFRSGLVVRCGHRDEVVTLEPEKYRGQKIDYLSVI
FT                   IGKKVKP"
FT   gene            310102..310854
FT                   /locus_tag="Toce_0315"
FT   CDS_pept        310102..310854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0315"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="COGs: COG2875 Precorrin-4 methylase; InterPro
FT                   IPR006362:IPR000878:IPR003043; KEGG: tex:Teth514_0313
FT                   precorrin-4 C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; PRIAM:
FT                   Precorrin-4 C(11)-methyltransferase; SPTR: Precorrin-4
FT                   C11-methyltransferase; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: precorrin-4
FT                   C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07096"
FT                   /db_xref="GOA:D9S0T2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T2"
FT                   /protein_id="ADL07096.1"
FT                   /translation="MIYFIGAGPGDPDLITVKGANILASCGVVIYAGSLVNPDVLRYAR
FT                   RDARVYDSSGMNLEEIIDVMKSAHGEGLDVARLHTGDPSIYSAVREQAEMLKKLGIPFE
FT                   IIPGVSSFTAAAAVLKSELTVPGVSQTVIITRVPGRTPVPERERLKSLAAHRATMAVFL
FT                   SADRIKDVADELIQSYGPKTPVAVVYRATWEDQKVVRGTLEDIAGKVEEEGIKRTAVII
FT                   VGEALGDAFEFSKLYDPSFSHGFRSGTP"
FT   gene            310851..311897
FT                   /locus_tag="Toce_0316"
FT   CDS_pept        310851..311897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0316"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="COGs: COG2073 Cobalamin biosynthesis protein CbiG;
FT                   InterPro IPR002750; KEGG: tit:Thit_0357 cobalamin (vitamin
FT                   B12) biosynthesis CbiG protein; PFAM: cobalamin (vitamin
FT                   B12) biosynthesis CbiG protein; SPTR: Cobalamin (Vitamin
FT                   B12) biosynthesis CbiG protein; PFAM: Cobalamin
FT                   biosynthesis central region; Cobalamin synthesis G
FT                   C-terminus; Cobalamin synthesis G N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07097"
FT                   /db_xref="GOA:D9S0T3"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T3"
FT                   /protein_id="ADL07097.1"
FT                   /translation="MKTAVIAVTERGAGIALRLRESLGSDIYLPEKLIKAGSPGTYPIE
FT                   GDFIEFVHGIFPKYRGLIFVTATGIAVRSIAGALKGKRLDPAVVVLDERARFAISLVSG
FT                   HLGGANDLAKAVAKATGAVPVITTASDLAGIETPDVTAAKLGLYIENFEGLKRVSSCLL
FT                   RGDKVAYVLESGYPVDAIERRHFEQNAVICDRVPRDAAAAVFITDKRVNPPGIPHVILR
FT                   PRSLVLGIGARKGAKYPELLRLLSEALDQLNLSVTGIGRIATVDLKREEESINELSRSL
FT                   KVPVEFYTVKRLQEVENRFPLSEFVKQRIGVGSVARPSAFLASNGGEELGYFRGGGFTL
FT                   AIFRRRMK"
FT   gene            311894..312625
FT                   /locus_tag="Toce_0317"
FT   CDS_pept        311894..312625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0317"
FT                   /product="precorrin-3 methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="COGs: COG1010 Precorrin-3B methylase; InterPro
FT                   IPR006363:IPR000878; KEGG: tit:Thit_0358 precorrin-3B
FT                   C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; SPTR:
FT                   Precorrin-3B C17-methyltransferase; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07098"
FT                   /db_xref="GOA:D9S0T4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T4"
FT                   /protein_id="ADL07098.1"
FT                   /translation="MSWIKVVGIGPGSSEDLTFRAAKALKDSDVVVGYTTYINLIKPLI
FT                   EGKMVIVSGMRDEVERCRKALELAGKGLKVSLVSGGDPGVYGMAGLLLEVALKGGAQTE
FT                   IEVIPGVSAVNSAAAILGAPLMQDFAVVSLSDHLVPWEVIEKRLSLAAQADFVIAIYNP
FT                   GSSERPENLSRAWEILMRHKKPDTPVGIVRKASREGQSVAITRLDKLPEYNVDMSTIVV
FT                   VGGESTFISGRWIITPRGYRV"
FT   gene            312622..313380
FT                   /locus_tag="Toce_0318"
FT   CDS_pept        312622..313380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0318"
FT                   /product="precorrin-6x reductase"
FT                   /note="COGs: COG2099 Precorrin-6x reductase; InterPro
FT                   IPR003723; KEGG: tit:Thit_0359 precorrin-6x reductase;
FT                   PFAM: Precorrin-6x reductase CbiJ/CobK; SPTR: Precorrin-6x
FT                   reductase; TIGRFAM: precorrin-6x reductase; PFAM:
FT                   Precorrin-6x reductase CbiJ/CobK; TIGRFAM: precorrin-6x
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07099"
FT                   /db_xref="GOA:D9S0T5"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T5"
FT                   /protein_id="ADL07099.1"
FT                   /translation="MILVLAGTKDGRLLAEKLSSMGFEVFASVVTDYGGQLLGERVRVR
FT                   IGPFGDTGLREFIARRGIRVVVDATHPFAKDISLKAIEVTRQMGVKYIRYERKESAREY
FT                   YTGVIMARDFEDAAQKAAEFHTIFLTIGSRNLEKFAGLKGMGKKLVVRVLPTSEVLKKC
FT                   EQLGFSPGEIIAARGPFSAEMNYLMFRDYGIDAVVSKESGPEGGVPEKLEAARRLGIPV
FT                   ILIQRPPLVYPVVVNNMEDLLKEMGNDDGS"
FT   gene            313364..314629
FT                   /locus_tag="Toce_0319"
FT   CDS_pept        313364..314629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0319"
FT                   /product="glutamyl-tRNA reductase"
FT                   /note="COGs: COG0373 Glutamyl-tRNA reductase; InterPro
FT                   IPR018214:IPR000343:IPR015895:IPR006151; KEGG:
FT                   tit:Thit_0360 glutamyl-tRNA reductase; PFAM: Tetrapyrrole
FT                   biosynthesis, glutamyl-tRNA reductase-like;
FT                   Shikimate/quinate 5-dehydrogenase; SPTR: Glutamyl-tRNA
FT                   reductase; TIGRFAM: glutamyl-tRNA reductase; PFAM:
FT                   Shikimate / quinate 5-dehydrogenase; Glutamyl-tRNAGlu
FT                   reductase, N-terminal domain; Glutamyl-tRNAGlu reductase,
FT                   dimerisation domain; TIGRFAM: glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07100"
FT                   /db_xref="GOA:D9S0T6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T6"
FT                   /protein_id="ADL07100.1"
FT                   /translation="MTMGLEEIVVTGIDHRVPVEIRERVAIKQRDLFDCLSRLKGTEGV
FT                   REAVILSTCNRTEVYLVAEKEARNWAGDFLIGLSGAEKDELSQNLFTLSGKDAALHLFR
FT                   VACGLESMVLGEDQILGQVREAWEKALEAGASGKILNRLFSDAVALGKKARFETRISDH
FT                   PLSISYIAVKFVEDVLGGLSGRTAFVIGAGEMARIAIKYLIQKGIAHVSVSNRTHERAL
FT                   NLKREIPEITVVPYDQKYEKIASSDIVISATDAPHYTVDYDKFKAAYRGGRVCMVDLAV
FT                   PRDIDPRIGSIPGVSLFTLDDLKMAAVENENQRRKLAAVIEEMAKAALEDYVKWYSCLA
FT                   VVPVIKQLNKYVEGVCLAEFEKVNGKLPEMGDRERRHIKKALDRVGAKIAARYLSALKF
FT                   LAENGKIDSDVVAAFQWGDTNG"
FT   gene            314613..315512
FT                   /locus_tag="Toce_0320"
FT   CDS_pept        314613..315512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0320"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COGs: COG0181 Porphobilinogen deaminase; InterPro
FT                   IPR000860; KEGG: dal:Dalk_4010 porphobilinogen deaminase;
FT                   PFAM: Porphobilinogen deaminase; PRIAM: Hydroxymethylbilane
FT                   synthase; SPTR: Porphobilinogen deaminase; TIGRFAM:
FT                   porphobilinogen deaminase; manually curated; PFAM:
FT                   Porphobilinogen deaminase, C-terminal domain;
FT                   Porphobilinogen deaminase, dipyromethane cofactor binding
FT                   domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07101"
FT                   /db_xref="GOA:D9S0T7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T7"
FT                   /protein_id="ADL07101.1"
FT                   /translation="MIPTGRIVRVGSRESRLALVQTEIVIRLLKDRRPELEFEVVKIKT
FT                   QGDKLLDVNLSDAGGKGVFVKEIEEALLAGSIDLAVHSMKDVPYELPEGLCIAAVTERE
FT                   DPRDVLISRDKRRLLNLRPGARIGTSSLRRSVQLKALRPDLDIVPVRGNVPTRIRKMDD
FT                   LELDGLVLAAAGIKRLGLEELIAEYFPPEVIVPAVGQGALAVEARKDDDILELAGLVSH
FT                   KATEVAVRAERSFMRALGGSCRVPLGAFARVEGTVVTLVGMVEKNGSVCKGTMSGKLKE
FT                   AEEIGLRLAERLGDSSDR"
FT   gene            315493..317058
FT                   /locus_tag="Toce_0321"
FT   CDS_pept        315493..317058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0321"
FT                   /product="uroporphyrinogen-III C-methyltransferase
FT                   ;uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /EC_number="2.1.1.107"
FT                   /note="COGs: COG0007 Uroporphyrinogen-III methylase;
FT                   InterPro IPR003043:IPR006366:IPR000878:IPR003754; KEGG:
FT                   tex:Teth514_0319 uroporphyrin-III C-methyltransferase;
FT                   PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4;
FT                   SPTR: Uroporphyrin-III C-methyltransferase; TIGRFAM:
FT                   uroporphyrin-III C-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; Uroporphyrinogen-III
FT                   synthase HemD; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07102"
FT                   /db_xref="GOA:D9S0T8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T8"
FT                   /protein_id="ADL07102.1"
FT                   /translation="MIAVTGKVYLIGAGPGDPGLLTLKAVRVLKKADAVLYDRLMNREI
FT                   LTLARKDAELIDVGKAPDNHPVPQHRINEILLEKALKGMTVVRLKGGDPFVFGRGSEEA
FT                   LYLTERGVPVEVVPGVTSAIAVPAYAGVPVTHRGISSSFHVITGSDGCGERADWDSLSR
FT                   LKGTLIFLMGVKNLESIVSNLLKYGKPADTPAAMIMWGATPAQKTVTGTLADIVRRVKE
FT                   AGIKNPAVFVVGGTVGLWEYLNWFEGKPLHGRRILVTGTIDAEKGQPEDGPFDFLEDAG
FT                   AEVIHCPTVKIEFDYGETAGFLANAGDLNLLVFTSKNAVTAFAGAMRRMRLDLRRLGGA
FT                   TVAAVGRKTAERLEEVFIYPDLVPEEFTSKDLLEKIPAGGGGKRTAAVITSDIGGQELV
FT                   GGLEARGYRVMKIAAYKNLPNYDVRERLIEELGKGVDAAVFTSPSSFYRMEQMVGKLPE
FT                   KLKKVFIAAIGPTTAAAIEKTGLKVDVCPKEHTLEGLQKALLEKFVGRGEGDGGNKKAQ
FT                   EIEI"
FT   gene            317021..317995
FT                   /locus_tag="Toce_0322"
FT   CDS_pept        317021..317995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0322"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COGs: COG0113 Delta-aminolevulinic acid dehydratase;
FT                   InterPro IPR001731; KEGG: tpd:Teth39_1889
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase; PRIAM:
FT                   Porphobilinogen synthase; SPTR: Delta-aminolevulinic acid
FT                   dehydratase; PFAM: Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07103"
FT                   /db_xref="GOA:D9S0T9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0T9"
FT                   /protein_id="ADL07103.1"
FT                   /translation="MEVIKRPRRLRYNTTVREMVRETCLDVKDLIYPLFVAHGENIKQE
FT                   IDSMPGVYRYSIDRLPEEVKEIRELGIPAVLLFGVPASKDEFGSEAYSDDGIVQRAVRV
FT                   IKEAEPSLVVITDVCLCAYTSHGHCGVVRNGRIENDETVKLIARTALSHVKAGADMVAP
FT                   SDMMDGRVRGIRQLLDGEGFSHVPVMAYSAKYASSFYGPFREAAHSAPMFGDRRSYQMD
FT                   PANSNEAMREIELDILEGADIIMVKPALAYLDVIRRAKDRFGVPLAAYNVSGEYSMIKA
FT                   AASMGFLDEKTSVLEALTSIKRAGADLIITYHAKEVARWLTTR"
FT   gene            317977..319851
FT                   /locus_tag="Toce_0323"
FT   CDS_pept        317977..319851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0323"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="COGs: COG0001 Glutamate-1-semialdehyde
FT                   aminotransferase; InterPro IPR005814:IPR006367:IPR004639;
FT                   KEGG: tex:Teth514_0321
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III; SPTR:
FT                   Glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; siroheme
FT                   synthase; PFAM: Aminotransferase class-III; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; siroheme
FT                   synthase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07104"
FT                   /db_xref="GOA:D9S0U0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U0"
FT                   /protein_id="ADL07104.1"
FT                   /translation="MAYYPVMLDLRNKKCLVVGAGAVAYRKIRSLLECGAAVTVIATKI
FT                   NKDIRELGEKGRIVILERCYSVGDLEGFFMAFAASDDPVVNRQVAEEAAQRGIPVNVAD
FT                   DPGLSSFIVPSVLRRGDLAVAVSSGGKSPLLSKVVREWLEGIVPEEVDDLIRDLERARA
FT                   EAKAAKLTPEEKIRLYYSLIKGRGLFRGKGDKMKSSELFQRAKKVMPGGVNSPVRAFGA
FT                   VGGDPVFIKRGFGSRVWDEDGNEYIDYVLSWGPLILGHSHPAVVEALKRQAELGTSFGA
FT                   CTELEVLLAEKIREAVPSMEVVRMVNSGTEATMSAIRLARGYTGRNLIVKFAGCYHGHS
FT                   DSLLIRAGSGLITYGIPDSGGVPEDTARLTLVARYNDVDMLEEIFEEKGPDIAAVIVEP
FT                   VAGNMGVVPPEEDFLRALRELPRKYGALLIFDEVITGFRVSYSGAQGYYGIEPDLTTLG
FT                   KIIGGGLPVGVYGGREDIMRCVSPDGPVYQAGTLSGNPLAMAAGLTTLEVLSKNPGLYD
FT                   ELDRRAERLCSGFKEVMEDAGIPVTVNRVCSMMTVFFTGEKVRNYDTAVKSDTRLYAVF
FT                   FREMLKQGVYLPPAQFEAFFLSAAHSDEDIKKTIEAAWNAAKNLKKNY"
FT   gene            320086..321876
FT                   /locus_tag="Toce_0324"
FT   CDS_pept        320086..321876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0324"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG1231 Monoamine oxidase; InterPro IPR002937;
FT                   KEGG: cbe:Cbei_4105 amine oxidase; PFAM: amine oxidase;
FT                   SPTR: Amine oxidase; PFAM: Flavin containing amine
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07105"
FT                   /db_xref="GOA:D9S0U1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U1"
FT                   /protein_id="ADL07105.1"
FT                   /translation="MSRKKPNIVPSEPGFTPYMPDNPTDEERYGLLRYSLERVGRLEDF
FT                   DNILKVLGPPPDITTIASPGEFRGVKVGIIGGGLAGLSAAFELRKLGFDITVFEALEDR
FT                   IGGRIYTYYFDEEKKYYGELGAMRFPVSHETTWHYINLFKLPTRPFVQTNENAFIYVKG
FT                   VRVRNDAEGRNVMERIYPKFDLNGWERRTPWEDLIFYALETPLLRMLQEVRPETVDVRP
FT                   IYSPAIVYWDYFDVRRVMEEAGLSQDAIYLLGSLSPAVGSFLYNGYIEFLTEVYPAVFN
FT                   FLYEIIGGMARLPLAFYESLTSPNPKEYPGIPDRHLGRVTWRRGTWVDGIFRHGEDGRV
FT                   TLRYKTRYTRDCLQEDFDYVVCAIPFSTLRIVKIDPPFRNRKMQAIKEVNYIEAQKTLF
FT                   LCKFRFWELGGPGERIVGGASYTDLPIQQIRYPSDHARCNSKWKERVRRGFFVSPADSW
FT                   DMRHGYSPDEPGVLLASYNLTLDAARLGNIPDDVAFEIIKRQVEEVHGLPKGYLDPVVV
FT                   DFARISWGRQPTFLGGFCYYFPEQKRIFSWASALPEYDGRVYFAGEHISGTHGWANGAL
FT                   KTGMEAANGIARSAKAAKIY"
FT   gene            321949..322656
FT                   /locus_tag="Toce_0325"
FT   CDS_pept        321949..322656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0325"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663; KEGG: gwc:GWCH70_2215 transcriptional
FT                   regulator, GntR family; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Transcriptional regulator, GntR family; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07106"
FT                   /db_xref="GOA:D9S0U2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U2"
FT                   /protein_id="ADL07106.1"
FT                   /translation="MLDKKSPIPAYFRLKQIIRDEIKRHDLKPGDPLPSEREYCERFGL
FT                   SRMTVRQALKELELEGVIVREKGRGSFVAIPWIEQEGLMSFTEMVRSRGMTPRTEVVEF
FT                   DRLPAGELKAFLGIDLKEEVYRVARLRKADGVPVAVETVYIPVLLVPDFEKIDLSGSLY
FT                   ELLSTRYGIEVRSSRTSFSAVLSTPDLEALLMLEETVPLLKVESVYFHTKPVFYEVSYY
FT                   KSDQFKITVNLNR"
FT   gene            322675..323406
FT                   /locus_tag="Toce_0326"
FT   CDS_pept        322675..323406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0326"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /note="COGs: COG0363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase; InterPro
FT                   IPR018321:IPR018322:IPR006148; KEGG: tex:Teth514_1433
FT                   glucosamine-6-phosphate deaminase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; SPTR:
FT                   Glucosamine-6-phosphate isomerase; TIGRFAM:
FT                   glucosamine-6-phosphate isomerase; PFAM:
FT                   Glucosamine-6-phosphate
FT                   isomerases/6-phosphogluconolactonase; TIGRFAM:
FT                   glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07107"
FT                   /db_xref="GOA:D9S0U3"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U3"
FT                   /protein_id="ADL07107.1"
FT                   /translation="MKIIVAGDYQEMSRIAANIIAEEIKKKPDLVLGLATGSTPLGTYR
FT                   ELVRMYKEGKLDFSRVITFNLDEYYGLSPDDKRSYHYYMYRNFFDHVNVRPENIHIPDG
FT                   TARDVEEECLRYDEEIKKCGGIDLQLLGIGVNGHIGFNEPGDELLTATHLTDLAPDTLA
FT                   ANARFFGSIDEVPRKAITVGLGTIIQAKKILLLASGPEKAAIMAELLDDDAVSTRVPAS
FT                   FLLLHRDVTVVMDKDAAAKKR"
FT   gene            323453..324628
FT                   /locus_tag="Toce_0327"
FT   CDS_pept        323453..324628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0327"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="COGs: COG1820 N-acetylglucosamine-6-phosphate
FT                   deacetylase; InterPro IPR003764:IPR006680; KEGG:
FT                   tte:TTE0232 N-acetylglucosamine-6-phosphate deacetylase;
FT                   PFAM: amidohydrolase; PRIAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase; SPTR:
FT                   N-acetylglucosamine-6-phosphate deacetylase; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   Amidohydrolase family; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07108"
FT                   /db_xref="GOA:D9S0U4"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U4"
FT                   /protein_id="ADL07108.1"
FT                   /translation="MKVLIKNARVITPFEVLDDHWVLVRDGSIAEVKKGREPGENFDLV
FT                   VDAGGNYLSPGFIDIHNHGSYGRDFMEATPGALETIAEFHLKNGVTGFLATVLTAPFEE
FT                   MKRAIKNAAGFIKIQGPDKARAKLLGIYVEGPYFSTAKRGAQPAEYIRKPDTAELDELL
FT                   RLSENSIRVVALAPEAAGAEDAISFLRERGIVAAMGHTNATYDEAKRGIDLGVTLVTHT
FT                   FNGMRGFDHREPGAAGAALTDERVYCEVICDGIHLHPAAVRLILRAKGKDRIVLVSDAM
FT                   MACGLSDGEYTLAGQKVIVRNGEARLQDGTLAGSTLTLDRAVRYMVRTIGVSLCEAVRM
FT                   ASLNPAGAIGLSQKKGSIEVGKDADMIIFDDEIRVKWAMVEGVPFSFSEKI"
FT   gene            complement(324647..325600)
FT                   /locus_tag="Toce_0328"
FT   CDS_pept        complement(324647..325600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0328"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: tpd:Teth39_0296
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: Putative uncharacterized protein;
FT                   PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07109"
FT                   /db_xref="GOA:D9S0U5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U5"
FT                   /protein_id="ADL07109.1"
FT                   /translation="MNLDKVKGYLAGVGFSSIFGFSFMFTKNALERVDPFRFIGFRFAL
FT                   AAFTIGLLAATGVIKFSLRGKSLAPLLAVAFLQPVCYFTFETMGVNLTSSSQAGMMMAL
FT                   IPIFVAILSALVLKERPSLAQAFFIILSVTGVIIIAAFQGVNGGGANLHGLLFLTGAVL
FT                   SAAFYNIASRRFSTKYTPFEVTFVMMWVGALFFNTVAFILHLKSGNPGTFLAPLTDGRV
FT                   LVSLFYLGIGSSVIAFFLVNYSLSRLSASQSAVFSNLTTVISILAGVAFRGEPFFWYHA
FT                   AGALMILAGVWGTNYFSRSPEQTKKSPGFGESSSIE"
FT   sig_peptide     complement(325514..325600)
FT                   /locus_tag="Toce_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            325832..326200
FT                   /locus_tag="Toce_0329"
FT   CDS_pept        325832..326200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0329"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="COGs: COG3682 transcriptional regulator protein;
FT                   InterPro IPR005650; KEGG: cbe:Cbei_1062 CopY family
FT                   transcriptional regulator; PFAM: Penicillinase repressor;
FT                   SPTR: Transcriptional repressor, CopY family; PFAM:
FT                   Penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07110"
FT                   /db_xref="GOA:D9S0U6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U6"
FT                   /protein_id="ADL07110.1"
FT                   /translation="MKKLQRISDAEKQIMEYIWKAGRPVTTSEIMRNLPEDKAWKQNTV
FT                   VTFLTRLMKKGILKATRIGKANYYEPCVTEQEYRNFVTKQFINDVHKGSVLGFITALCD
FT                   NGDLTKEDIESILKRLKE"
FT   gene            326213..327559
FT                   /locus_tag="Toce_0330"
FT   CDS_pept        326213..327559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0330"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="COGs: COG4219 Antirepressor regulating drug
FT                   resistance predicted signal transduction N-terminal
FT                   membrane component; InterPro IPR008756; KEGG: dhd:Dhaf_2876
FT                   peptidase M56 BlaR1; PFAM: peptidase M56 BlaR1; SPTR:
FT                   Peptidase M56 BlaR1; PFAM: BlaR1 peptidase M56"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07111"
FT                   /db_xref="GOA:D9S0U7"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U7"
FT                   /protein_id="ADL07111.1"
FT                   /translation="MNDIYNQLFIMSVVAGGIYLILKVLSAVTLKYFSAAWHYYTNIAV
FT                   YMFFLLPYHRWMSGLDLSFLKMSDKGFELPSITGLNPLTALNFAAGGISQQKGYAGASV
FT                   YFEILPYILMAGTLIFMVVILVHNYNLNRRIFRICRLTDDMQILEVLFKCKQQMGITRQ
FT                   IPVYISPCITTPFLYGIIKPRIVLPDIKLSADELQCVFLHELTHWKRRDGWLKFLMLFI
FT                   NAIHWFNPLAYAARFDIDRFCELSCDESVVKSMSNRERRRYCELMLSVLWNVADQSAKL
FT                   FSAFSGKRKQLERRVDIILKDKVPMSKKWVRMVATAITLAIVLLGAILAGAVETSALER
FT                   KGSSESALPKPKEISNYQYRVNEYGETYGPAIYAEVLGEEPDLIAAIGIDGTFGYVRSS
FT                   DLNPPDPRTPEEAVAQNNLGDKLIPLYDKDGRTVIGQFKIVSGRFEKLK"
FT   gene            327846..328577
FT                   /locus_tag="Toce_0331"
FT   CDS_pept        327846..328577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00313150 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07112"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U8"
FT                   /protein_id="ADL07112.1"
FT                   /translation="MQRIISIATLICLILTTLISSVQAAPIDGDLIPIEEYIKAYSEND
FT                   PKLIKQISSNEYIIDKSITKTDFTRLEVAPGSKIYFLKKHQNNSNPSILSASHVCPELT
FT                   FTYKTDIVDVGSQTCQVAAWSGIGFFGTPVAAKWCGMGASDILTEPSGSYENHLMVKSY
FT                   CYGVGLDFSYGQGLSPGFTLISGSSIQYDEFRENLRFHDAKYHYAYAAGVLTSCGTSTR
FT                   AGLFYDGSYDYIETYINWYTD"
FT   sig_peptide     327846..327917
FT                   /locus_tag="Toce_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            328676..330691
FT                   /locus_tag="Toce_0332"
FT   CDS_pept        328676..330691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0332"
FT                   /product="Prenyltransferase/squalene oxidase"
FT                   /note="InterPro IPR001330; KEGG: tsi:TSIB_1229 hypothetical
FT                   protein; PFAM: Prenyltransferase/squalene oxidase; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07113"
FT                   /db_xref="GOA:D9S0U9"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0U9"
FT                   /protein_id="ADL07113.1"
FT                   /translation="MKRILSLFFVFLIIFFTVSCDNLTRITWEENTKKKIYASQNNDGG
FT                   FKEHFLIQDRDLSSTYYFLEICDMINIPLNKDFKEKTIQWILSIKTKAGYFGSESQYSR
FT                   QIQNTFFAILSLKRLGFEFDENLKQEIKNLFVRLKKPDNLYYEHSAEKEPFLNYFVLES
FT                   VKAIENEEKFLDVKTQFKKLCLTSTSMNTLTKLFFLRYFDEPVKIDENIRQQLTSEMEQ
FT                   GKSSFIEKLWFLSFFEDDRLNSVIKTTLLKYKNLDGGFSAVVEDSSTDRETYYAVSALR
FT                   RLNYKITGPEKNELVNFIFAHMNPAGGFNKPFISPSTPQATYKCLYILTELGYEVKNAN
FT                   IVEQYLNRTLKALLGSPDYHPLVMLNTLKALQILDKDRNLKSTLKDSNQHLYEDFLQNT
FT                   YKNLEEKLNRDNFEQELYDVSNYVEILIMLGEEIPETLKQKIYINAEKVIGDSLKANSI
FT                   VSIVPLYYSVKLIDNINIISSYNEQVDSFAKKLINQELNKAEKGDLLITYYAMMIQKYN
FT                   HVLEEPLFCSYDYLNLFKSDEGGVRQNFESPPSLSLTEKYMQMYSFIKNYSVRTSSRAI
FT                   EASYNGKKGLSVSGYKLRRLKDFDLILLKLYNNEHGHWNEYYITDGKNKILAKAKVSQT
FT                   PEYNDILVFEIPKGKVNERLYFYFSGKGRTEIPRFW"
FT   sig_peptide     328676..328732
FT                   /locus_tag="Toce_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            331286..331846
FT                   /locus_tag="Toce_0333"
FT   CDS_pept        331286..331846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0333"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="COGs: COG3467 flavin-nucleotide-binding protein;
FT                   InterPro IPR011576; KEGG: aoe:Clos_2849 nitroimidazole
FT                   resistance protein, putative; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding; SPTR:
FT                   Nitroimidazole resistance protein, putative; PFAM:
FT                   Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07114"
FT                   /db_xref="GOA:D9S0V0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V0"
FT                   /protein_id="ADL07114.1"
FT                   /translation="MRRKDREMNREFGLKVIDKSIYGVLSMVDEGEPYGIPLSIVRDGN
FT                   TLYFHSAKDGRKVKILEKNPKVSVVFVGETKIPEIYSNEELDEIAKDESKANALISKVF
FT                   TTEFESAVVVGKVKLVEDEDEKIKALKLICEKYTPTKMAYFPIAIKAGLNRTNVDSIEI
FT                   EEITAKRKKFDANGEELKWGRTE"
FT   gene            331993..333468
FT                   /locus_tag="Toce_0334"
FT   CDS_pept        331993..333468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0334"
FT                   /product="transposase IS4 family protein"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; InterPro IPR002559; KEGG: tte:TTE2646
FT                   transposase; PFAM: transposase IS4 family protein; SPTR:
FT                   Transposase; PFAM: Transposase DDE domain; Transposase
FT                   domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07115"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V1"
FT                   /protein_id="ADL07115.1"
FT                   /translation="MWGDEMLTKKNREIIKQVELVSIDSLVPQDHLLRAVEESIDFSFI
FT                   YEEVKDLYSENTGRPSIDPVVLIKLLMLQALYGIRSMRQTIREVEVNVAYRWFLGYGLQ
FT                   EKIPHFSTFGKNYERRFKESDLFEKIFERVLMEAIECGFVKTDAVFIDATHIKASANKN
FT                   KYIEKVAKQRTQKYKEELLKEINAEREANGKKPFEEEDDDDDNNKGENSSKKVRVSTTD
FT                   PESGMFQKGEKERCFAYTASVACDRNNFVLGVKIAPGNVHDSQVFSDLFQEVNDKFSKI
FT                   EAVVVDAGYKTPGICREIIEAGALPVMPYKRSMTKDGYFKKREYVYDEYYDCYICPNNQ
FT                   ILEYSTTNRAGYREYRSNPQICCKCPMRLQCTKSKNYTKIITRHIWEHYIEIAEDIRHT
FT                   QWGKELYKMRGQTIERVFADAKEKHGMRYTNLRGLRKVGHYLTLLFACMNLKKLALWKK
FT                   RRGTFPPTVPALHSFFLKIFFAFNKKPLLGYAS"
FT   gene            complement(333539..335410)
FT                   /locus_tag="Toce_0335"
FT   CDS_pept        complement(333539..335410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0335"
FT                   /product="carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="COGs: COG1151 6Fe-6S prismane cluster-containing
FT                   protein; InterPro IPR010047:IPR004137; KEGG: dae:Dtox_2933
FT                   carbon-monoxide dehydrogenase, catalytic subunit; PFAM:
FT                   Prismane; PRIAM: Carbon-monoxide dehydrogenase (acceptor);
FT                   SPTR: Carbon-monoxide dehydrogenase, catalytic subunit;
FT                   TIGRFAM: carbon-monoxide dehydrogenase, catalytic subunit;
FT                   PFAM: Prismane/CO dehydrogenase family; TIGRFAM:
FT                   carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07116"
FT                   /db_xref="GOA:D9S0V2"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V2"
FT                   /protein_id="ADL07116.1"
FT                   /translation="MEMCTSADKKLIDFMRSKFEVETSFNRVSSQAVKCGFGMQGVCCR
FT                   LCTNGPCRITPQSPKGVCGATADTIVARNFLRSVAAGAACYLHILENTAKNLRALGQGK
FT                   NGLTIKGPETLRELAEMFEIEETDPAQQAVKIAERVLEDLYLPREQQMTLVEKLAYRSR
FT                   FQRWKELNILPGGAKSEVFDAIVKTSTNLSSDPVDMLLHALKLGIATGLYGLTLTNYLN
FT                   DIMLGEPQITTAKVGFSVVDPDYINIMVTGHQHSLIGVLQDKIVTPEADALASKNGAKG
FT                   FKIVGCTCVGQDMQQRGAHYRKAFAGHVGNNFTSEALLATGGIDLVVSDFNCTVPGIET
FT                   ICEQFQVAQICLDDVAKKSNADFIRFDSSEAADIAEKIMHAALESYTRRRGKVQVDIPD
FT                   HGCDDAVTGLSKKSLKSFLGGNFKPLIDLIASGKIRGVAAVVGCSNLTAKGHDVFTVEL
FT                   TKELIKRDIIVLSAGCTSGGLENVGLTSPGAAELAGDNLKEVCRTLGIPPVLNFGPCLA
FT                   IGRLETVAAELAQALDIDIPELPLVLSAPQWLEEQALADASFGLALGLPIHVAIPPFVT
FT                   GSQLVSKVLTEDVEQLTGGKVIVEGEIVPAAEKLADIIEQKRKALLS"
FT   gene            complement(335662..336069)
FT                   /locus_tag="Toce_0336"
FT   CDS_pept        complement(335662..336069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0336"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: drm:Dred_2964 BadM/Rrf2 family
FT                   transcriptional regulator; PFAM: protein of unknown
FT                   function UPF0074; SPTR: Transcriptional regulator,
FT                   BadM/Rrf2 family; TIGRFAM: transcriptional regulator, Rrf2
FT                   family; PFAM: Transcriptional regulator; TIGRFAM: rrf2
FT                   family protein (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07117"
FT                   /db_xref="GOA:D9S0V3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V3"
FT                   /protein_id="ADL07117.1"
FT                   /translation="MKLNQATDYAFRAVLHLSKLPPGEVVEARVIAEQEHIPMRFMLKI
FT                   LRLLTQAGIVKSYRGVGGGYALAKMPRDITMRDVVEAVEGPVYINRCLIAPEECNKRST
FT                   AKCSIHKALFSIQQTINDKLEEYNFEILSKN"
FT   gene            336280..337122
FT                   /locus_tag="Toce_0337"
FT   CDS_pept        336280..337122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0337"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR000281:IPR001347; KEGG: tex:Teth514_0168 RpiR family
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: Transcriptional
FT                   regulator, RpiR family; PFAM: Helix-turn-helix domain, rpiR
FT                   family; SIS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07118"
FT                   /db_xref="GOA:D9S0V4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V4"
FT                   /protein_id="ADL07118.1"
FT                   /translation="MPGSLEKIAAILNGLKPSEKKIAQYILENPQEISDLPIAELAKRC
FT                   GTSEASVVRFCRTLGYKGYQDLKIKISADLAIKTKKIQGLVSVDDDVDAIITKVSRNNM
FT                   LAVENTMDILDRNEVRKAAEVLLRAKKIDFYGVGASGIVAQDAMHKFMRINKACTAYTD
FT                   THMQLTSAANLSPEDVAVGISYSGQTVDTVDALKLAKNAGATTICITKFGHSPITKVSD
FT                   IKLFVTSSEALFRSGAMASRMAQLNVIDILFTIVACRKYDDIINYLENTSEAVASRKY"
FT   gene            337203..337511
FT                   /locus_tag="Toce_0338"
FT   CDS_pept        337203..337511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0338"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="COGs: COG1440 Phosphotransferase system
FT                   cellobiose-specific component IIB; InterPro
FT                   IPR013012:IPR003501; KEGG: amt:Amet_4188 phosphotransferase
FT                   system, lactose/cellobiose-specific IIB subunit; PFAM:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; SPTR: PTS system; PFAM: PTS system,
FT                   Lactose/Cellobiose specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07119"
FT                   /db_xref="GOA:D9S0V5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V5"
FT                   /protein_id="ADL07119.1"
FT                   /translation="MKILLVCSGGMSTSIVLKAVEKKAAELKEDVYVEAASTTQFEERV
FT                   KDFDVVLIAPQVRHRKQFFEEIASKHGIPTGLIEPQAYGPFGGEKILRQAKKLLEEV"
FT   sig_peptide     337203..337259
FT                   /locus_tag="Toce_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            337515..338765
FT                   /locus_tag="Toce_0339"
FT   CDS_pept        337515..338765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0339"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG1455 Phosphotransferase system
FT                   cellobiose-specific component IIC; InterPro
FT                   IPR004501:IPR003352; KEGG: amt:Amet_4187 PTS system
FT                   lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC; PRIAM:
FT                   Protein-N(pi)-phosphohistidine--sugar phosphotransferase;
FT                   SPTR: PTS system, lactose/cellobiose family IIC subunit;
FT                   TIGRFAM: PTS system, lactose/cellobiose family IIC subunit;
FT                   PFAM: Phosphotransferase system, EIIC; TIGRFAM:
FT                   phosphotransferase system, cellobiose specific, IIC
FT                   component; PTS system, lactose/cellobiose family IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07120"
FT                   /db_xref="GOA:D9S0V6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V6"
FT                   /protein_id="ADL07120.1"
FT                   /translation="MEFFLKWVEEKLMPPMAKLAEQRHLRAVRDGIVATLPLIIVGSFF
FT                   LIVASPPIPALAEKIQPYASQILIPFRLSVGLMALYAAHGIGYSLAKSYNLDPVAGGLL
FT                   ALASFIMITLPQNVEKIGFVLPMGGLGGAGLFAAIIMAFFAVEVLRFLTVRKITIKMPE
FT                   GVPESVARSFEALIPAAAIMVIIYIVRVMLNINIQELIMNLFKPLVTAGDSLIGVLVPV
FT                   ILITLLWSAGIHGVSVVGSIARPIWMALLDENTQAAAAGAKILPHIAPEPFFQWFIWIG
FT                   GSGATLSLVLLMLTSKSRYLKNLGKASLLPGVCNINEPVIFGAPIMLNPILAIPFIIGP
FT                   VITAVISYIAMVFNLVGRPYVLAPWTLPAPIGAYLATGGDWRAVVLVLVNIALTTIIYY
FT                   PFFKVYERKMMEEETES"
FT   gene            338813..339178
FT                   /locus_tag="Toce_0340"
FT   CDS_pept        338813..339178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0340"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="COGs: COG1447 Phosphotransferase system
FT                   cellobiose-specific component IIA; InterPro IPR003188;
FT                   KEGG: sha:SH0190 hypothetical protein; PFAM:
FT                   phosphotransferase system PTS lactose/cellobiose-specific
FT                   IIA subunit; SPTR: Similar to phosphotransferase system;
FT                   PFAM: PTS system, Lactose/Cellobiose specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07121"
FT                   /db_xref="GOA:D9S0V7"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V7"
FT                   /protein_id="ADL07121.1"
FT                   /translation="MVDENSIFEMIAYGGNARAKAYEAAARARKGDFELAEKLLKEADE
FT                   EMLKAHHVQTRLIHEEVQGKKHEVSVLLVHAQDHLMTAMAERSLIENMIDLFRRVRELE
FT                   VEVSALKGCLGNEKIDS"
FT   gene            339159..339929
FT                   /locus_tag="Toce_0341"
FT   CDS_pept        339159..339929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0341"
FT                   /product="YdjC family protein"
FT                   /note="COGs: COG3394 conserved hypothetical protein;
FT                   InterPro IPR006879; KEGG: amt:Amet_4184 YdjC family
FT                   protein; PFAM: YdjC family protein; SPTR: YdjC family
FT                   protein; PFAM: YdjC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07122"
FT                   /db_xref="GOA:D9S0V8"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V8"
FT                   /protein_id="ADL07122.1"
FT                   /translation="MKKLIVNADDFGLTPGINRAVKQGVIEGIITDTTLMVNMPAAREA
FT                   MDIAMECFPDRVGIHLNLTCGRPVLDPAEVPSLVDKSGRFYRRRAALMERATLRDIEKE
FT                   LRAQVDKFLRSGLKPSHLDCHHHLHLHPMVAEIVAELALELNVPVRAVDSQTRAFFKSR
FT                   GVITPDQFSVDFYGEGASYQNLVSILDSYSYGVMEIMTHPGYCDQELLEISTYTHFREK
FT                   ELEILTNPFLRGVLEEKDIVLVSFNDLKTEKGSL"
FT   gene            339926..340882
FT                   /locus_tag="Toce_0342"
FT   CDS_pept        339926..340882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0342"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="COGs: COG2971 N-acetylglucosamine kinase; InterPro
FT                   IPR002731; KEGG: tte:TTE0216 N-acetylglucosamine kinase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type; SPTR: Predicted
FT                   N-acetylglucosamine kinase; PFAM: BadF/BadG/BcrA/BcrD
FT                   ATPase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07123"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0V9"
FT                   /protein_id="ADL07123.1"
FT                   /translation="MSYIIGVDAGGSKIEVLALDLERHSANTLIIERSGNAMSAGEDKA
FT                   LYNIKEAVEKVSAPVEKTGSRCLGIYVGAAGAGSKEIRRKIREVLTGLALTDAVFVDSD
FT                   YRIALAGAAGRPYGVVVIAGTGSVVYGVNEAGSEVILGGWGHLIGDEGSGYYIGRRAIR
FT                   EAVKFYEGRGGSKRIYEEVLAHFSVKDLTEIKPILYSGGFSKDIIAGLTVRVSKLCDEG
FT                   ERIARQILEEAGTALSELVSCALKRFVYISDVIVSGSILLKEKLVYDTFAFELKRTCPK
FT                   VKIRRPRYRATAGALILLAGELGIELDSNLLPGAETL"
FT   gene            340894..342057
FT                   /locus_tag="Toce_0343"
FT   CDS_pept        340894..342057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0343"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="COGs: COG2377 molecular chaperone distantly related
FT                   to HSP70-fold metalloprotease; InterPro IPR005338; KEGG:
FT                   tte:TTE0217 anhydro-N-acetylmuramic acid kinase; PFAM:
FT                   protein of unknown function UPF0075; SPTR: Putative
FT                   uncharacterized protein anmK; PFAM: Uncharacterised protein
FT                   family (UPF0075)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07124"
FT                   /db_xref="GOA:D9S0W0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W0"
FT                   /protein_id="ADL07124.1"
FT                   /translation="MERLYALYKKKKKKVIGLMSGTSADGIDAALVEIEGYGPETRAEL
FT                   LVFCNFPYDEPTRREIFHLFDVSRSTVDLVCRMNFKLGRLFGNAAIRLCELAGVDISDV
FT                   DLIGSHGQTVYHIPGEATLQIGEPCVIAEITGRTVVADFRVRDVAAGGHGAPLVPYAEY
FT                   LLYRSDEVNRALLNIGGIANITVLPKSCSVEDITAFDTGPGNMVIDEIVLRGTGGSMKF
FT                   DKDGAVASKGKVDERLIEFLKAHPYLKQRPPKTAGREIFGGGFVEEIIRKSLDLRIGFE
FT                   DLVATVTYFTAYSIARACRDFLMPNHRIDEILISGGGAYNKTLVDMIRKELKGVEIRTF
FT                   EDIGLNSDAKEAVAFAVLANETIGGVCNNVPGATGAGKRVILGKIII"
FT   gene            342080..343006
FT                   /locus_tag="Toce_0344"
FT   CDS_pept        342080..343006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0344"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="COGs: COG2103 sugar phosphate isomerase; InterPro
FT                   IPR005488:IPR001347; KEGG: tex:Teth514_0172 N-acetylmuramic
FT                   acid-6-phosphate etherase; PFAM: sugar isomerase (SIS);
FT                   SPTR: Glucokinase regulatory-like protein; TIGRFAM:
FT                   glucokinase regulatory-like protein; PFAM: SIS domain;
FT                   TIGRFAM: N-acetylmuramic acid 6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07125"
FT                   /db_xref="GOA:D9S0W1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W1"
FT                   /protein_id="ADL07125.1"
FT                   /translation="MELTKLITEQRNPYTEDIDILDTVSMLKKMNDEDKKVAFAVEKEI
FT                   PRIATAVDLITNRLKNGGRLIYIGAGTSGRLGILDASECPPTFGVDPELVQGVIAGGDS
FT                   AIKKAVEGAEDDEYMGRKDLQDRRLSDRDVVAGLTASGRTPYVIGGLKYAREVGALTIG
FT                   ICCNPESPLRDFTDILIAPVVGPEVILGSTRLKAGTAQKMVLNMISTGVMIRLGKVYSN
FT                   LMVDLQATNKKLQQRARRIVKLATGVDDERIDAVLSKTEYNVKLSIFMILSGMDGEKAK
FT                   KILTFHGGNIRKALESIEGVKGVESCG"
FT   gene            342990..344309
FT                   /locus_tag="Toce_0345"
FT   CDS_pept        342990..344309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0345"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /note="COGs: COG1486
FT                   Alpha-galactosidase/6-phospho-beta-glucosidase family 4 of
FT                   glycosyl hydrolase; InterPro IPR019802:IPR001088; KEGG:
FT                   tte:TTE0337 alpha-galactosidase/6-phospho-beta-glucosidase;
FT                   PFAM: glycoside hydrolase family 4; SPTR:
FT                   Alpha-galactosidases/6-phospho-beta-glucosidases, family 4
FT                   of glycosyl hydrolases; PFAM: Family 4 glycosyl hydrolase;
FT                   Family 4 glycosyl hydrolase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07126"
FT                   /db_xref="GOA:D9S0W2"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W2"
FT                   /protein_id="ADL07126.1"
FT                   /translation="MSHVVKKLKIAVIGGGSSYTPELIEGFIKRAPELPVSEIYLVDVE
FT                   QGREKLEIVGNLAKRMLDKAGLNISVHLTLDRREAISNADFVITQFRVGGIDARIRDEK
FT                   IPLKYGVIGQETTGPGGFAKALRTIPVILDICRDIEELAPDAWLINFTNPSGIITETVI
FT                   KHTGVKVLGLCNVPVNMVNYVAKAYGVEMDRVYIQFAGLNHLVWGLRVYLDGEDITQKL
FT                   IEQLASDENMTMKNIPGMQWDKDLLKSLGVLPCPYHRYYYMKDTMLEEEKRKATHEGTR
FT                   GEVVKKVERELFELYKDPKLDEKPPQLEKRGGALYSYTACNLISSIVNDKRDIQVVNVK
FT                   NSGAILDLPEDAVVETNCVIDKNGAHSLSVGRLPAKIRGLIQVVKAYEELTIEAGVNGD
FT                   YNAALQALTIHPLVPSAGIAKKILDDILAENREYLPQFFK"
FT   gene            344517..345047
FT                   /locus_tag="Toce_0346"
FT   CDS_pept        344517..345047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0346"
FT                   /product="protein of unknown function UPF0157"
FT                   /note="COGs: COG2320 conserved hypothetical protein;
FT                   InterPro IPR007344; KEGG: cbf:CLI_0936 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0157; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0157)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07127"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W3"
FT                   /protein_id="ADL07127.1"
FT                   /translation="MRKVVVTDYNPMWPAMFEAEAAKIKEIFGDELIAIHHIGSTSVPE
FT                   MKAKPIIDIMPLVRDINAVDKFNDKMIELGYEPMGEFGLPGRRYFRKGGDNRTHHVHIY
FT                   QFDNKAEVERHLAFRDYLREHKDAAERYGKLKEELAKRFPDDIEAYMDGKDQFVKELEQ
FT                   KALKWYGEKLERN"
FT   gene            345500..348913
FT                   /locus_tag="Toce_0347"
FT   CDS_pept        345500..348913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0347"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119:IPR001330; KEGG: pth:PTH_1483
FT                   hypothetical protein; PFAM: S-layer domain protein;
FT                   Prenyltransferase/squalene oxidase; SPTR: Hypothetical
FT                   membrane protein; PFAM: Prenyltransferase and squalene
FT                   oxidase repeat; S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07128"
FT                   /db_xref="GOA:D9S0W4"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W4"
FT                   /protein_id="ADL07128.1"
FT                   /translation="MHYKIKKRLVALILVFGLLLSISIDGQVLTTALAASGSYTADQLA
FT                   EKAVEFINSKFKSGEKVDGYTAYVLALAGEDLSSEKWTRNDLSLKEEIQKSADLLGNQN
FT                   SLITYILATQNVDGSFGPYANEYGTKASLQALAMVKGDLPEGDISKQVQEAINKAIDYF
FT                   KGRYMKGSLAYDAQGFNFDYRCVEALADASEDLSGWVYGDKSLKNIVIESAEAAADDAA
FT                   VLDAVYLAKELTALYAVEPQSDKIATLAQAIADKKNTDGDSIWFGNSIYDDVMVLTALG
FT                   KADKLSLIDRQKAFNYLEKFKHEHKDAWGKPAGAAWGDFEDEEPDLTAQVITALSYFEE
FT                   ARDTGSDVYKAIEEGLAYLKDIQDADTAAIKARFDNTFATAETLIALKSLGKKYEDYAG
FT                   AGSGWVKRSGTKTIAQHLLALSRMGDEDRVNRLVNLLTERHSSNGFDNSVYTDFWAYIA
FT                   LGEAGKIKEINAEEAKSYILGKQSDEGSWGEKWGDAFYPDFMSTAQAIRALTYLSASGD
FT                   TKVQNAIEKGLAYLKRQLQPDGSVYITQPFPDDPVVDTAEVIVTLKKLGVDPKEWKSGQ
FT                   GLTPVDYMMQKALNSDGSFGSVKNILGAAEALHAFILLKGETGSPGSEPGSSEPVPGEV
FT                   ECTVDIAVVGRDGELLFGPDSVTVSRNGRWGLTALGALDATGLDYECDGGFVKSIEGQA
FT                   NQGMNGWMYKVNGKVPSVAASEKAIGDGDEIIWWYSTDYRSSGPTWEDLINKNTVPEQE
FT                   GVVSEDLEEQNERLPETLRVSKEALKALENVEELLELQKAAGIEEIDKAVVVIGSRGPF
FT                   KRDEFLKLKEKLLQNRVDLQKEVAASEGAAIVDGKEEVALLVPAGALKKDLEISIKETD
FT                   GTIPPGFKALSGIYEIAPEATSLSMPATLAIRAAVSPLVKPENLVLARYDDTEGRWVVI
FT                   PAVADMAKGVIVARIEHFSKVAVFAKEVRKSFADVSDASFGWAKDAVEALAGSGIVTGV
FT                   YGTFFEPGRALTRAEFVTMIVKTLGLEPKAGEGRQFKDVKKGAWYEKAVYAAVDAGLVT
FT                   GYEDGTFRPDGKITREQLAVILARAVGFTPSGENPDFKDGKSISPWSRGSVAAAVAGEL
FT                   LEGFEDGTFRPKAAVSRAQAAVVIYRFLGE"
FT   sig_peptide     345500..345601
FT                   /locus_tag="Toce_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            349019..349849
FT                   /locus_tag="Toce_0348"
FT   CDS_pept        349019..349849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1458 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07129"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W5"
FT                   /protein_id="ADL07129.1"
FT                   /translation="MAFLLAVAVGCVIYAPKIFYDTKERPLTAVKENQALVPGEANTNP
FT                   TKAGTGEAPNASIEGLAVQKDGVLTNTSPKLETGTGSGGTKVEKKVIEKAEPSDGSSKT
FT                   KKEETSGTKKEPFGKGAASTGGAASSSRDDAPRHVPEKKDTDSSGDSTKETDSSSAGAG
FT                   GCRIEIAIVGKGGRVLYGPKTVTVKENNRWGLTALGALDSTGIDYKTGQGYDGFVVSIA
FT                   GETNKGMAGWMYSVNDEVPMAAASEKKIEPGDRIIWWYNESINNPPPTWDSLAE"
FT   gene            349862..350791
FT                   /locus_tag="Toce_0349"
FT   CDS_pept        349862..350791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0349"
FT                   /product="cobalt transport protein"
FT                   /note="InterPro IPR003339; KEGG: mta:Moth_1457 cobalt
FT                   transport protein; PFAM: cobalt transport protein; SPTR:
FT                   Cobalt transport protein; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07130"
FT                   /db_xref="GOA:D9S0W6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W6"
FT                   /protein_id="ADL07130.1"
FT                   /translation="MLDRFFYREKGLFLQSLHPLSALVYIAVLLTLALMFNHPLYLLGL
FT                   LSITVAAVKAVDGFDAWKTFLKVSLGATFVIIIVNAVTVRAGQTVLWRGPYIPVFGRLN
FT                   VSLEAVLFGAVMGLRLLLIMSIFCLYNFMIHPDRVLDMLSRFSSKSGLVLSLAARMFPA
FT                   MVSRLDGIREVLTARGVDFNAGTLKEKMAKYAVLMKILLLTSLEDSMETAQAMYARAFG
FT                   SGRRSYYVRENLRPRDTACLAASLAALATAAYGLEKGLGTFRFYPQSGNLIDGHTGIGL
FT                   LFAVIFLLCFPILLSWGWHTCPFLKSKI"
FT   gene            350764..352428
FT                   /locus_tag="Toce_0350"
FT   CDS_pept        350764..352428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0350"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR017871:IPR003593; KEGG: mta:Moth_1456 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter; TIGRFAM: cobalt transport protein ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07131"
FT                   /db_xref="GOA:D9S0W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W7"
FT                   /protein_id="ADL07131.1"
FT                   /translation="MPIFEIKDLTYFYPESQRPALKDVNMSIEEGEFLLVTGGSGSGKS
FT                   SLARVLAGLIPGFSGGRISGSVFFRGKDIEQIDRRTMAGEVGIVFQDPEKQLVKTSVEA
FT                   EIAFGLENLGLPQQEMARRVAEVMSFLGLADLRREFTAKLSGGQKQKLALAAVLAMQPS
FT                   VLILDEPTSQLDPVAAEDFLNVVKRLNEDMGLTVILIEQRLERCFHLADKVLIMEDGRI
FT                   RFEGTPEQVARRAAFCENPFIPPVARFFGKVGFNTIPVTVKDGRRMLKQNFNPAPGNFS
FT                   MSSSEGMHEREPLIRMEGVWFTYPDGREALQDINLEICAGELVAVIGPNGSGKSTLLKN
FT                   MAGLLKPGRGRVIMMGNKQPKSATRTTWDPSVGYLSQNPNDYLFQDTVEEELLYTLKNF
FT                   GIASNGAVDEIIEKLSLGDFRRVNPRDLSYGERQRVALASVLVTGPKLLLLDEPTKGLD
FT                   YRLKSDLGEVLAEFCRQGAAVVLTTHDVEFAAKYASRVIMLFCGRVICDGPVHQVLSDS
FT                   IFYSTQIGRMCRGFADGILTPEEALAVFKPALAKIIN"
FT   gene            352449..353156
FT                   /locus_tag="Toce_0351"
FT   CDS_pept        352449..353156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1455 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1393)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07132"
FT                   /db_xref="GOA:D9S0W8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W8"
FT                   /protein_id="ADL07132.1"
FT                   /translation="MKKMLSKILFWLGFGIIPIFMAAAMSGKTTISGEWGVASYIVIFA
FT                   AIALMYLGFELETSSPKRIAVIAVLGAVGAAGRIAFAAIPNIQPTTFIAIASGYVFGPS
FT                   AGFMVGSTAALVSNFFLGHGPWTPWQMFAWGLAGSSAGIVKRLSPHIGKWGMAFFCLLW
FT                   GYLFGWILNLWSWIAFVKPLNWQSFLAVCTASFWFDTLHAVGNAAFYLLFGTSFMKILE
FT                   RFRHKMAATQKIS"
FT   sig_peptide     352449..352526
FT                   /locus_tag="Toce_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353298..353861
FT                   /locus_tag="Toce_0352"
FT   CDS_pept        353298..353861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0352"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COGs: COG0212 5-formyltetrahydrofolate cyclo-ligase;
FT                   InterPro IPR002698; KEGG: chy:CHY_0730
FT                   5-formyltetrahydrofolate cyclo-ligase family protein; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase; SPTR:
FT                   5-formyltetrahydrofolate cyclo-ligase family protein;
FT                   TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase family; TIGRFAM:
FT                   5,10-methenyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07133"
FT                   /db_xref="GOA:D9S0W9"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0W9"
FT                   /protein_id="ADL07133.1"
FT                   /translation="MVDKKTLRRTFLEKREGLSREDVKDKSEKIISTLFALEELKKSEV
FT                   VMFYVNARNEVETRKAIEQALSMGKRVVVPKTIKGKGLLAVEIKSLGELVPGTFGILEP
FT                   EKDEGLDPKVIDLVVVPGVAFDRRGYRLGYGGGYYDGFLPKLRPEAKKIAIAFELQLAD
FT                   YIPVEKHDVRMDAIVTEKGVYRFN"
FT   gene            353958..355493
FT                   /locus_tag="Toce_0353"
FT   CDS_pept        353958..355493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0353"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterProIPR017926:IPR004739:IPR001674:IPR000991:IPR
FT                   011702:IPR006220; KEGG: mta:Moth_2105 GMP synthase; PFAM:
FT                   GMP synthase domain protein; glutamine amidotransferase
FT                   class-I; SPTR: GMP synthase [glutamine-hydrolyzing];
FT                   TIGRFAM: GMP synthase, large subunit; GMP synthase, small
FT                   subunit; PFAM: Glutamine amidotransferase class-I; GMP
FT                   synthase C terminal domain; NAD synthase; TIGRFAM: GMP
FT                   synthase (glutamine-hydrolyzing), C-terminal domain or B
FT                   subunit; GMP synthase (glutamine-hydrolyzing), N-terminal
FT                   domain or A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07134"
FT                   /db_xref="GOA:D9S0X0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X0"
FT                   /protein_id="ADL07134.1"
FT                   /translation="MIKDQENVIVLDFGGQYSQLIARRVREASIYCEILPYNTPMDEIL
FT                   KRKPKAIVFSGGPASVYSENAPVCDKRIFDTGIPILGICYGMQLMCHMLGGRVEPAETA
FT                   EYGRAELVVEEEDGIFSGLEKNLTVWMSHGDSIITLPEGFRTLARTKNTPHAAIGNGRN
FT                   LFGVQFHPEVVHTPRGREILNNFLFGIAGCTGTWSMKTFVEEQIRLIRERVGNGRALCA
FT                   LSGGVDSSVAAVITHRALGDNLTCIFVDHGLLRKDEARKVIETFKDKFHINLIAVDASD
FT                   RFLKRLEGVTDPEAKRRIIGEEFIRVFEDEAKKLGKIDFLVQGTLYPDVIESGTQTAAV
FT                   IKTHHNVGGLPQDLNFELIEPLRDLFKDEVRKVGLQLGLPEEIVYRQPFPGPGLAVRVL
FT                   GEVTREKLSILREADAIVTEEVKKAGLDRELWQAFAVLTDVKSVGVMGDERTYAYTVAI
FT                   RAVTSEDGMTADWARLPYDLLDNMSTRIVNEVPGVNRVVYDITSKPPATIEWE"
FT   gene            355583..356539
FT                   /locus_tag="Toce_0354"
FT   CDS_pept        355583..356539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0354"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="COGs: COG0226 ABC-type phosphate transport system
FT                   periplasmic component; InterPro IPR011862:IPR006059; KEGG:
FT                   aoe:Clos_1116 phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Phosphate binding protein; TIGRFAM: phosphate binding
FT                   protein; PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07135"
FT                   /db_xref="GOA:D9S0X1"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X1"
FT                   /protein_id="ADL07135.1"
FT                   /translation="MSSKLKGAKAGYVLALFTLSLAAVLVVTACGASNRNQGGQANLSG
FT                   SIEIDGSSTVYPITEAVAEEFMNTYPDVNITVGVSGTGGGFKRFTAGETDISNASRPIS
FT                   DEEAAKAKESGVEYIELPVAYDGITVVVNKENDWVDHLTVEELKKIWSPGSKVTKWSDI
FT                   RPGWPDEKINLYGPGTDSGTFEYFTEAVNGEAKKSRSDYTASEDDNVLVQGVSGDRYAL
FT                   GYFGFAYYLENSDKVKAVPIDGGSGPVEPTAESIKNGTYKPLARPIFIYVNKKSLERPE
FT                   VKEFVKFYMENAAELVEEVGFVPMPESEYQENLNKIE"
FT   sig_peptide     355583..355669
FT                   /locus_tag="Toce_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            356661..357554
FT                   /locus_tag="Toce_0355"
FT   CDS_pept        356661..357554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0355"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="COGs: COG0573 ABC-type phosphate transport system
FT                   permease component; InterPro IPR000515:IPR011864; KEGG:
FT                   rmr:Rmar_1828 phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Phosphate ABC
FT                   transporter, inner membrane subunit PstC; TIGRFAM:
FT                   phosphate ABC transporter, inner membrane subunit PstC;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: phosphate ABC transporter,
FT                   permease protein PstC; phosphate ABC transporter, permease
FT                   protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07136"
FT                   /db_xref="GOA:D9S0X2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X2"
FT                   /protein_id="ADL07136.1"
FT                   /translation="MVDSAGKGFRGEKGIEILLALAASVSVLVTIGIVVSLFSETAGFF
FT                   KEVSVKEFFTETRWTPLFTPAHYGIAPLVAGTMLVTVIAMIVAAPLGLASAIYLSEYAP
FT                   DGVRRLIKPVLEILAGIPTIVYGYFALTFVTPIIRAILPQTNVFNALSAGIVMGIMLIP
FT                   MISSLSEDAMTAVPNSLREAAYALGATKLEVAYKVVIPAAISGIVASFILAISRAIGET
FT                   MIVALAAGSTPKLTFNPLDSIQTMTAFIAQVMLGDAPFGSIEYKSVYAVAGVLFVVTLS
FT                   LNLIGTWIVRRYKEVY"
FT   gene            357554..358438
FT                   /locus_tag="Toce_0356"
FT   CDS_pept        357554..358438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0356"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="COGs: COG0581 ABC-type phosphate transport system
FT                   permease component; InterPro IPR000515:IPR005672; KEGG:
FT                   afl:Aflv_0881 ABC-type phosphate transport system, permease
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: ABC-type phosphate
FT                   transport system, permease component; TIGRFAM: phosphate
FT                   ABC transporter, inner membrane subunit PstA; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: phosphate ABC transporter, permease
FT                   protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07137"
FT                   /db_xref="GOA:D9S0X3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X3"
FT                   /protein_id="ADL07137.1"
FT                   /translation="MTVQDEMFSPGLQNRQRRNRIFMWLFLSANLLGLLVLVVLLAKVL
FT                   RDSWGWLDLQFITSFPSRSPEKAGILPALYGTIYVMIITAVFAIPLGIAAAVFLEEYSK
FT                   KSKFLSFIQVNIYNLAGIPSIVYGILGLTVFVRWMMLGRSLLAGGLTMGLLILPVIIVT
FT                   AQEAIRAVPQSWRHASYALGASKWQTIRYVVLPSALPGILTGIILALSRAIGETAPLIP
FT                   IGALTFVRVIPRSLFDSFSVLPIQIYNWTSRPQDDFRAIAAAGIVVLLVVLLGMNSAAI
FT                   LLRNKYQGRIKKV"
FT   gene            358435..359190
FT                   /locus_tag="Toce_0357"
FT   CDS_pept        358435..359190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0357"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /EC_number="3.6.3.27"
FT                   /note="COGs: COG1117 ABC-type phosphate transport system
FT                   ATPase component;
FT                   InterProIPR003439:IPR015850:IPR017871:IPR005670:IPR 003593;
FT                   KEGG: chl:Chy400_0279 phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Phosphate ABC transporter, ATPase subunit; TIGRFAM:
FT                   phosphate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter; TIGRFAM: phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07138"
FT                   /db_xref="GOA:D9S0X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X4"
FT                   /protein_id="ADL07138.1"
FT                   /translation="MNLERIITVRNLFVSYGHHRVLKGINLDIYKNRITAIMGPSGCGK
FT                   STLLRCLNRMIDLSEGARIKGQVLYRGENIYSPKVDPAHIRFRIGMVFQKPNPFPKSIF
FT                   ENVAFGPRINGYKGDLSALVEQSLQRAGLWDEVKDRLHENAYMLSGGQQQRLCIARALA
FT                   LEPEVLLLDEPCSALDPISTMHVEELIRQLKERLTIVIVTHNIQQAARVADYTAFLLQG
FT                   ELVEFGETSAMFTVPKDKRTEDFITGRFG"
FT   gene            359221..360354
FT                   /locus_tag="Toce_0358"
FT   CDS_pept        359221..360354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0358"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COGs: COG0082 Chorismate synthase; InterPro
FT                   IPR020541:IPR000453; KEGG: tal:Thal_0092 chorismate
FT                   synthase; PFAM: chorismate synthase; PRIAM: Chorismate
FT                   synthase; SPTR: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase; PFAM: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07139"
FT                   /db_xref="GOA:D9S0X5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X5"
FT                   /protein_id="ADL07139.1"
FT                   /translation="MLRFLTAGESHGKALVAVIEGLPANLAVDVDFINRELSRRQMGYG
FT                   RGGRMKIEKDAVEVISGLREGRTTGSPVAFIIPNLDYPNWKDKALEPVTRPRPGHGDLA
FT                   GALKYRQDDIRNILERASARETAARVAVGAVAKQLLAIFNIEVLSHVIAIGGIKANVKD
FT                   PLLEDLRRADESPVRCLDRIAEQKMMEAIDNAKRDGDSLGGVFEVVAFNVPVGLGSHAH
FT                   WDRKLDGRIVWSLMSVQGIKGVEIGLGFEAAARKGSQVHDEIFYDSESRRFYRKTNNAG
FT                   GLEAGITNGCPLVVRAAMKPIPTLYRPLLSVDIKTKEQFAAGVERSDVCAVPAASIVGE
FT                   AAVAWVLAGALVEKFGGDTVEEMREGFERWMKYLQEF"
FT   gene            360376..361473
FT                   /locus_tag="Toce_0359"
FT   CDS_pept        360376..361473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0359"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="COGs: COG0337 3-dehydroquinate synthetase; InterPro
FT                   IPR000623:IPR016037:IPR016303:IPR002658; KEGG:
FT                   drm:Dred_1021 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; PRIAM: 3-dehydroquinate
FT                   synthase; SPTR: 3-dehydroquinate synthase; TIGRFAM:
FT                   3-dehydroquinate synthase; PFAM: 3-dehydroquinate synthase;
FT                   TIGRFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07140"
FT                   /db_xref="GOA:D9S0X6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X6"
FT                   /protein_id="ADL07140.1"
FT                   /translation="MESLTVELGARSYLIHIGPGNLDEIGKILRALIGPEKILVITDEN
FT                   VRDLYAGRVLESLKEAGFDAHIAVIPPGEPSKTLKEAERLYIKALDYGLDRNSAIIALG
FT                   GGVVGDLAGFVAATYMRGIRYVQVPTSLLAQVDSSVGGKVAVNLKLAKNIVGAFHQPVA
FT                   VIIDPLTLKTLPDREFREGLAEVIKYGIIWDGDFYEWLEKNVTILRQGGEKLIYAIKKS
FT                   CAIKAAVVSLDERDEGTRMLLNYGHTVGHALESLLGYGALLHGEAVAAGMIIEAAIALE
FT                   IGLLGRRDYERIVTILKQAVPVKIPGPVDTSDLIEAMARDKKNKGRRVAFVLPEKPGRA
FT                   GLYYDIPGEILYKILDQFFKKSTVP"
FT   gene            361600..362685
FT                   /locus_tag="Toce_0360"
FT   CDS_pept        361600..362685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0360"
FT                   /product="fructose-bisphosphate aldolase ;D-fructose
FT                   1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG1980 fructose 1 6-bisphosphatase; InterPro
FT                   IPR002803; KEGG: chy:CHY_1039 hypothetical protein; PFAM:
FT                   protein of unknown function DUF100; SPTR: Putative
FT                   uncharacterized protein; PFAM: Fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07141"
FT                   /db_xref="GOA:D9S0X7"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X7"
FT                   /protein_id="ADL07141.1"
FT                   /translation="MSKITLTVIKADIGGYVGHCSVHPDLIEEAKSVLEEKGKGLLEDY
FT                   VVTHVGDDINLIMTHRKGVDNTEIHKLAWDTFLSCTQIAKKLKLYGAGQDLLSDSFSGN
FT                   IKGMGPGVAEMEFEERPSEPVIVFMADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHQ
FT                   GFKFEVLDTIENKKIVFSCPEELYDLLVFLGAANRYAVKAVYSKSGEPAAVSSTQRMNL
FT                   MAGRYVGKDDPVLIVRCQSGLPAVGEALEPFANPHLVAGWMRGSHFGPLMPVSCNGATP
FT                   SRFDGPPRVVALGFQLAGGKLVGPQDMFADVSFDRAREKALEMADYFRQLGPFEPHRLP
FT                   LDEMEYTTLPQVMEKLKDRFE"
FT   gene            362920..364425
FT                   /locus_tag="Toce_0361"
FT   CDS_pept        362920..364425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0361"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: amt:Amet_0580
FT                   sodium:neurotransmitter symporter; PFAM:
FT                   sodium:neurotransmitter symporter; SPTR: Transporter; PFAM:
FT                   Sodium:neurotransmitter symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07142"
FT                   /db_xref="GOA:D9S0X8"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X8"
FT                   /protein_id="ADL07142.1"
FT                   /translation="MEESKAQWSSRVGFILASLGMAFGTGNIWRFPRVAAANGGGAFLI
FT                   AFLIATILWAVPLLMMEMVMGKTTRLGTVGAFRNFCGKKYTWFGAWIGFCSVAIMFYYS
FT                   VVMGWALRYFVYGITGAIKPGIDSETMWKAFLNDPSQTILFHFISIAIAGFIIYRGVKE
FT                   GLEIANKTIVPSMLVLLIVVMVWALTKPNAVQGLEYLYNPNLSQLLDAKVWLNAFTQAA
FT                   WSVGAGWGLMLTYAVYMRDEDDIGANSFVVAFADSGSSLISAMAVLPLVFAVSPSVEVA
FT                   KKALESGHTGMTFIYLTKFFPNLPGGTFFAALFFLALSIAALASLLSMVELATLNLQDM
FT                   GIDRKKAAILVTVVTFLLGIPSAYSSWFLDNQDMVWGVGLLIAGVLYSLAAYRYGIDRV
FT                   RTEIINPNSYVHIGKWWNYAIGGFPIMFAFVFGWWILQSITWYPKTWWNPFEQYSPATM
FT                   VIQWSVVALVFYLANNWLAEKIKAPYKEVSARESSADRGEGRK"
FT   gene            364422..364529
FT                   /locus_tag="Toce_0362"
FT   CDS_pept        364422..364529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07143"
FT                   /db_xref="GOA:D9S0X9"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0X9"
FT                   /protein_id="ADL07143.1"
FT                   /translation="MSTTAVIWMILMLFIYFGGFIYFALQDGSGKKANN"
FT   sig_peptide     364422..364493
FT                   /locus_tag="Toce_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            364663..365484
FT                   /locus_tag="Toce_0363"
FT   CDS_pept        364663..365484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR006035; KEGG: bcu:BCAH820_2443
FT                   hypothetical protein; SPTR: Conserved domain protein; PFAM:
FT                   Arginase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07144"
FT                   /db_xref="GOA:D9S0Y0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y0"
FT                   /protein_id="ADL07144.1"
FT                   /translation="MALPAVNIVRSDESLSFQKNLMKKANVILDLTGATGLRFCSEKKH
FT                   FMKVKQKLAPSKPGITFLGPGDFHHLSAHFIDGIKPKPVLVLFDHHSDMLGSPDGFVTC
FT                   GSWVAHVLREGKVKKCLVAGISSKDEALFKVSSDCRAVFLPEDLPHDKVVSAIVEELVK
FT                   SGGPVYISIDKDVLSQKDAATNWDQGCMSLDELLDFIEVIGETAPVAGADVCGEWRVPV
FT                   DRVFLNREDVEKTGLNEQANIKILEKLLKVWQKNSKIAYIKPELGRGIYGV"
FT   gene            365474..366277
FT                   /locus_tag="Toce_0364"
FT   CDS_pept        365474..366277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0364"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="COGs: COG0005 Purine nucleoside phosphorylase;
FT                   InterPro IPR010044:IPR000845; KEGG: cth:Cthe_0622
FT                   methylthioadenosine phosphorylase; PFAM: purine or other
FT                   phosphorylase family 1; SPTR: Methylthioadenosine
FT                   phosphorylase; TIGRFAM: methylthioadenosine phosphorylase;
FT                   PFAM: Phosphorylase superfamily; TIGRFAM:
FT                   5'-deoxy-5'-methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07145"
FT                   /db_xref="GOA:D9S0Y1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y1"
FT                   /protein_id="ADL07145.1"
FT                   /translation="MEYKADIGVIGGTGFYAFLDDVKEITVETPYGAPSDKIALARIKD
FT                   KTVAFLPRHGKDHRYPPHMINYRANIYALKQLGVTRILGPCASGSLQPHIKPGDFVICD
FT                   QFVNRTWGRKDTFYDGPITTHIGGAEPYCPELRKIAIEAAKDMGLPVHERGTVVVVQGP
FT                   RFSTKAESREFSSHGWEVINMTQYPEVVLAREMEICYANITLVTDYDVGLEGHPDVEPV
FT                   SHEMVLKVFNENLGKLKDLIYSIIERIPENRGCRCKEELKTARMG"
FT   gene            366393..367049
FT                   /locus_tag="Toce_0365"
FT   CDS_pept        366393..367049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0365"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro
FT                   IPR000169:IPR001303; KEGG: drm:Dred_2062 class II
FT                   aldolase/adducin family protein; PFAM: class II
FT                   aldolase/adducin family protein; SPTR: Class II
FT                   aldolase/adducin family protein; PFAM: Class II Aldolase
FT                   and Adducin N-terminal domain; TIGRFAM:
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07146"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y2"
FT                   /protein_id="ADL07146.1"
FT                   /translation="MLLLKIKQKVVEYGEKIVKEGLVVATWGNISARNGHDDVFVITPS
FT                   GMSYTILEPDDIVEVDINGNPLSPGRKPSVETPMHAAIYRARPDVRAIIHTHSTNACAC
FT                   AVARMDIPCIMEDMACMVGGPVKVADYAPTGSQELARNVVKALGDRNAVLLANHGVVTV
FT                   GRDLEEAFKLSLLVEKSAEIFIKAKLIRFPFSLNESEVQFLRNFYRTSYGQGDKK"
FT   gene            367124..368713
FT                   /locus_tag="Toce_0366"
FT   CDS_pept        367124..368713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_2344 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07147"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y3"
FT                   /protein_id="ADL07147.1"
FT                   /translation="MQRKSRKKASKVDYSLLIKREILAYLEALKNKDYTVGQLDKSMKK
FT                   LFSMGDLVVPVCLSKLKESDEELAPIVCYALEYANDYRLVGPLMDILVMPQVSDKVKAR
FT                   ILTVLSHYGVDTGDLPLNNIMSDFERIATQSLVEMIEDINRDYFLIPYILDDLQEFPLE
FT                   ARLAYIKDIGEHRLEKAVVLLEILAKTDDVPVAEEAARALGRIKTGRALYALNKLSREV
FT                   TNDRVKKTVERESLRLKFSGVVEEPYDPPVTLKKPTKIVLSSIDGLGSRALWIAWRNPS
FT                   KNRKLCSMNLLLNSSAGIKDCWSILQITSREFNNSVRDLSRSTVIMETNAEHAVSLIRD
FT                   AYFWNCQVGNPVPYQFFFWKGIIEQSMSCHITPKIYKPDFSEYDLEAIKENKDYLKNTF
FT                   DLFNYRIFEDWFVAEPRVYDYAEEHKSKNGFYIKKMTISKAENLFARFTSELIEPRAAV
FT                   LMRMLELASDFLNKMGERELVKVVLSAMLHMDIKPLHHHPFIQRMIIESLRVALVNMKN
FT                   GFDMRVNPEAFD"
FT   gene            368736..369929
FT                   /locus_tag="Toce_0367"
FT   CDS_pept        368736..369929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0367"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: csc:Csac_0857
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase; PRIAM: Methionine adenosyltransferase; SPTR:
FT                   S-adenosylmethionine synthase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07148"
FT                   /db_xref="GOA:D9S0Y4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y4"
FT                   /protein_id="ADL07148.1"
FT                   /translation="MGRKFLFTSESVTEGHPDKICDQISDAILDAILEKDPMARVACET
FT                   AVTTGLVLVMGEITCDCYVDIPKIARETIREIGYTRAKYGFDCDTCAVITSIDEQSPDI
FT                   AVGVDAAYEIREEGCGDELDRIGAGDQGMMFGFAVDETPELMPMPIMMAHKLARRLAEV
FT                   RKTRLLPYLRPDGKTQVTVEYEDGRPVRVDKVVVSAQHKSTVDLTTLRHDIIEAVVKKV
FT                   IPEELIDKNTKFYINPTGRFVVGGPHGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTK
FT                   VDRSAAYAARYVAKNIVAAGLAKKCEVQVAYAIGVAHPVSIMVDTFGTGVIPEEKIQKL
FT                   VIENFDLRPGAIIRDMDLRRPIYKQVAAYGHFGRTDLDVPWERTDKAEILRKQASSL"
FT   gene            370038..371513
FT                   /locus_tag="Toce_0368"
FT   CDS_pept        370038..371513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0368"
FT                   /product="transposase IS4 family protein"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; InterPro IPR002559; KEGG: tte:TTE2646
FT                   transposase; PFAM: transposase IS4 family protein; SPTR:
FT                   Transposase; PFAM: Transposase DDE domain; Transposase
FT                   domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07149"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D9RXN1"
FT                   /protein_id="ADL07149.1"
FT                   /translation="MWGDEMLTKKNREIIEQVELVSIDSLVPQDHLLRAVEESIDFNFI
FT                   YDEVKDLYSENTGRPSIDPVVLIKLLMLQALYGIRSMRQTIREVEVNVAYRWFLGYGLQ
FT                   EKIPHFSTFGKNYERRFKESDLFEKIFERVLMEAIECGFVKTDAVFIDATHIKASANKN
FT                   KYIEKVAKQRTQKYKEELLKEINAEREANGKKPFEEEDDDDDNNKGENSSKKVRVSTTD
FT                   PESGMFQKGEKERCFAYTASVACDRNNFVLGVKIAPGNVHDSQVFSDLFQEVNDKFSKI
FT                   EAVVVDAGYKTPGICREIIEAGALPVMPYKRPMTKDGYFKKREYVYDEYYDCYICPNNQ
FT                   ILEYSTTNRAGYREYRSNPQICCKCPMRLQCTKSKNYTKIITRHIWEHYIEIAEDIRHT
FT                   QWGKELYKMRGQTIERVFADAKEKHGMRYTNLRGLRKVGHYLTLLFACMNLKKLALWKK
FT                   RRGTFPPTVPALHSFFLKIFFAFNKKPLLGYAS"
FT   gene            371635..372825
FT                   /locus_tag="Toce_0369"
FT   CDS_pept        371635..372825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0369"
FT                   /product="DegS sensor signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR016381:IPR003594:IPR008595:IPR 011712;
FT                   KEGG: tte:TTE1682 sensory transduction histidine kinase;
FT                   PFAM: Sensor DegS domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Sensor protein DegS; PFAM: Histidine
FT                   kinase; Sensor protein DegS; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07150"
FT                   /db_xref="GOA:D9S0Y6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008595"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016381"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y6"
FT                   /protein_id="ADL07150.1"
FT                   /translation="MKKNRLDVKYLDSIIKTTIEAVEKGHEETFRIAEHAKKECERLQK
FT                   EVEQLKVRISETIQTVDELQKKERASRNKLMVVSREFNKYSEEDIKAAYEHAREIQIKL
FT                   TVQREREIQLREKRDQMERSLKNMQDILKQAEQLTLQMGVALNFLKGNLLDLSEKLTDI
FT                   NQKQAIAAQIIKAQEEERKFIAREIHDGPAQTMANVLLQVDVCEKLYEKDSDRARKELR
FT                   DLKELVRNCIREMRKIIFNLRPAALDDLGLEAVTRRYCAEFQEDTGISVDLSIIGDKRR
FT                   LDSTVEITLFRVIQEALSNVKKHAGAKNVSVKLEFASDVVNLRIEDDGVGFEFEEVKLL
FT                   SEDSKHFGLVNMRERVDLLKGTIKIKSEPGRGTGIYISIPLSERRNLNVKDFRGSG"
FT   gene            372797..373438
FT                   /locus_tag="Toce_0370"
FT   CDS_pept        372797..373438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0370"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR000792:IPR001789; KEGG: cth:Cthe_1267 two
FT                   component LuxR family transcriptional regulator; PFAM:
FT                   response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; SPTR: Two component transcriptional regulator, LuxR
FT                   family; PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07151"
FT                   /db_xref="GOA:D9S0Y7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y7"
FT                   /protein_id="ADL07151.1"
FT                   /translation="MSKISVVLADDHVLVRKGLKKILEMESDIEVVGEASNGLEAVEEV
FT                   RTKAPDVVLMDINMPKLNGVEATRVLKKESLKTKVIILTIYDDREYLLELLKTGISGYI
FT                   LKDIDPQALVEAVRAVSRGETYIQPTLTRALIAEYNRLSQPISRASRPLTAREKEVMAY
FT                   IAEGMSNIEISEKLGISEKTVKNHVSSILRKLNLMDRTQVAVYALKNNLV"
FT   gene            373505..373960
FT                   /locus_tag="Toce_0371"
FT   CDS_pept        373505..373960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_2758 hypothetical protein; SPTR:
FT                   Hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07152"
FT                   /db_xref="GOA:D9S0Y8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y8"
FT                   /protein_id="ADL07152.1"
FT                   /translation="MPAVGEKLDPALAILMVFAVIGIYRVLELLAISFFGQTTSRRKPK
FT                   IVLIVRDMEEKIEGIIRSLARRSIFENSETVVVVDEGSMDGTLEILKRLSSEFGFEIAE
FT                   KCRLDFQKSPFTVLLDCCRLEPREIEAFLGCFTSPKKVEMGLKSYEN"
FT   gene            374198..375910
FT                   /locus_tag="Toce_0372"
FT   CDS_pept        374198..375910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0372"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160:IPR003018; KEGG: tte:TTE2335 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: GGDEF domain containing
FT                   protein; GAF domain protein; PRIAM: Diguanylate kinase;
FT                   SMART: GGDEF domain containing protein; GAF domain protein;
FT                   SPTR: Diguanylate cyclase/phosphodiesterase domain 1
FT                   (GGDEF); TIGRFAM: diguanylate cyclase; PFAM: GAF domain;
FT                   GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07153"
FT                   /db_xref="GOA:D9S0Y9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Y9"
FT                   /protein_id="ADL07153.1"
FT                   /translation="MISRARYTNVLGIVGTGLLIIFIALYGFELRQPWWQYLLFLLFMF
FT                   ISEINAIQFNNTYLTMEFGFIYAAIFIFGFIPAAVMKAISTLLSQGYIRYNNGNLRETL
FT                   DLICFNVGQYMISFFGGAGAYLLLKRTGLTEAFAQAVGIFIYFIINNLLVEIYVTFGTG
FT                   DNTFRKSLRSLCADLTTYAISVPGGLLMVELYRYFDYYHHSFPHLRFLAVLLGLIPYIV
FT                   LVYIYKIYMGLITTNRELTALYDVAATMTSTLNTQEVLRIIFDSVKNVAPWDTISLFVY
FT                   QQDALVPLMYEGFYSDSIKDFRLKPGEGITGSTLVSGRGEIINNYKKDSRFRDDPGLPP
FT                   NTKSVMSVPMINNNEIIGAITLTSNKKNAYNSKHLKIMSILANQATVAISNARLFDKTS
FT                   KLAVTDSLTRLYNLRYIYEELERMVNRVKNNGGVFSLIIIDIDHFKSYNDRYGHLVGDS
FT                   ILKKLAEVLKDNVRDNDIVGRYGGEEFVIILPDTPGAEAYAIAERIREVVESTEFAQTD
FT                   TGKKIFITISAGVASCPDDALTVKELVRKADQALLFGAKQKGRNRVVEFKKMN"
FT   gene            376013..378202
FT                   /locus_tag="Toce_0373"
FT   CDS_pept        376013..378202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0373"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit - helicase superfamily I member; InterPro
FT                   IPR006345:IPR003583:IPR003593:IPR004365; KEGG:
FT                   nth:Nther_2311 helicase, RecD/TraA family; PFAM: nucleic
FT                   acid binding OB-fold tRNA/helicase-type; PRIAM:
FT                   Exodeoxyribonuclease V; SMART: AAA ATPase;
FT                   Helix-hairpin-helix DNA-binding class 1; SPTR: Helicase,
FT                   RecD/TraA family; TIGRFAM: helicase, RecD/TraA family;
FT                   PFAM: Putative ATPase (DUF699); Viral (Superfamily 1) RNA
FT                   helicase; TIGRFAM: helicase, putative, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07154"
FT                   /db_xref="GOA:D9S0Z0"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z0"
FT                   /protein_id="ADL07154.1"
FT                   /translation="MVELEGIVERITYYNEENFFTVARVQVRDTDEIVTAVGYFPSLEV
FT                   GEVLRLRGRWVMHEKHGCQLKIESYETLVPATVREIENYLASGAIKGIGPATAKKIVER
FT                   FGENTLEIMSSSPHRLMEIAGIGQKRLEMIVRSFAEQKETREIMLFLQQYGIGPGVAVK
FT                   VYKAYKEKAIEVVKQNPYRLADEVYGIGFKTADKIARMMGIEMDSPERLAAGVKYALHR
FT                   AADEGHVFLPEKELLKRASSLMEVDEDRISEVLPALEEKGDIVADGPPEKREVYLAPFY
FT                   VSEKSVARKLFLLAGLGETRSLEVTPEEISEIEERCGIKLAARQREAIEKAASSGVLVI
FT                   TGGPGTGKTTVIRCLIEFFQGRNLKVVLAAPTGRAAKRMTEATGMEAKTIHRLLEYKAY
FT                   GEGGMAFGRNRDNPLDEDVVIIDETSMVDIIMMHHLLSALKPFARLVLVGDKDQLPSVG
FT                   PGSVLREIIDSGRIPVVMLDEIFRQARESMIVVNAHRINRGLFPYLNVKGRDFYFEQAV
FT                   EPEEVLNKTLDLVCTRLPRFGGYDPMEDIQVITPMKKTPVGVLSLNLQLQERLNPPAPG
FT                   KKEFPFRSFVFREGDRVMQIKNNYEKEVFNGDLGRIVEIDEDEGVLVSFPDARGERTLI
FT                   YAGEELEELSLAYALSVHKSQGSEFPVVVMPVTTQHFVMLQRNLLYTAITRARKLMVLV
FT                   GSKEALAIAVRNSRAAMRYSRLAERIAREFEESLL"
FT   gene            378502..379302
FT                   /locus_tag="Toce_0374"
FT   CDS_pept        378502..379302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0374"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR002638; KEGG: mta:Moth_1779
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase; SPTR: Nicotinate-nucleotide
FT                   pyrophosphorylase (Carboxylating); PFAM: Quinolinate
FT                   phosphoribosyl transferase, C-terminal domain; Quinolinate
FT                   phosphoribosyl transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07155"
FT                   /db_xref="GOA:D9S0Z1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z1"
FT                   /protein_id="ADL07155.1"
FT                   /translation="MDIRDFLFAPLTGRTFMLEITARQRGVLAGTDRLQKIAQELGLKL
FT                   EDLSPDGTKMAEGSCICRARGDAWQVARAEEQLLGVIGKASGVATAAAEMVYQARSRAR
FT                   VVCGAWKKVPPEVRHDLRQAIATGGAGIRIVDEPFVYLDKNYVRMFGGVGPAVRRAREL
FT                   EGRVVVVQLRGEEASLAEEAVEAAAEGAHILMVDTGRLQDLVLVRDVASKKGFREKIRL
FT                   AFSGGVVKDELDEIIAAGADIVDVGRAIIDAPLLDFTLDVKKLE"
FT   gene            379308..380231
FT                   /locus_tag="Toce_0375"
FT   CDS_pept        379308..380231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0375"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="InterPro IPR001453; KEGG: mta:Moth_1778
FT                   molybdopterin binding domain-containing protein; PFAM:
FT                   molybdopterin binding domain; SPTR: Molybdopterin binding
FT                   domain; PFAM: Probable molybdopterin binding domain;
FT                   TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07156"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z2"
FT                   /protein_id="ADL07156.1"
FT                   /translation="MEWDLLEKTTFWVENVDLRGADLGQVAAAAAKALGLDAHEVMVVD
FT                   VRPGLVAFDVLRRRVQAESVAGREGEILKRLQEVPGVILGPKAGVHSEGVLGLIALKPD
FT                   EAQEVLSASARMTSEISQAVARRALVFASGSEVLAGKIRDTNSPYLIEALTGAGFRAEF
FT                   GGILEDDVVAVVNRLEGALERGYGLIITTGGVGAEDKDCNIEAVLRLDPRAHTPWILKF
FT                   TPDYKRHYKEGVRIAVGRVGMARLIALPGPHEEVRLACRALLEGLSQGLDDAGLAEKIA
FT                   GVLRRRWYERMGKGGSEHHGFSGHSY"
FT   gene            380206..380979
FT                   /locus_tag="Toce_0376"
FT   CDS_pept        380206..380979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0376"
FT                   /product="2-oxopent-4-enoate hydratase"
FT                   /EC_number="4.1.1.77"
FT                   /EC_number="4.2.1.80"
FT                   /note="COGs: COG3971 2-keto-4-pentenoate hydratase;
FT                   InterPro IPR002529; KEGG: mta:Moth_1777 4-oxalocrotonate
FT                   decarboxylase; PFAM: fumarylacetoacetate (FAA) hydrolase;
FT                   PRIAM: 2-oxopent-4-enoate hydratase; SPTR: 4-oxalocrotonate
FT                   decarboxylase; PFAM: Fumarylacetoacetate (FAA) hydrolase
FT                   family; TIGRFAM: 2-oxopent-4-enoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07157"
FT                   /db_xref="GOA:D9S0Z3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z3"
FT                   /protein_id="ADL07157.1"
FT                   /translation="MDFQAIATNLLEAEETRKAIEPLTSTYPNLTVEDAYRIQLAGVEM
FT                   RLKQGRRVIGKKIGLTSKAMQDLLGVKEPDYGHLLDNMLLLEGEPCRREDFIWPRVEGE
FT                   LAFVLKDTLKGPGVTIADVFRATEGVMPAIEIVDSRIRDWKISLADTIADNASSARFVL
FT                   GSRMVPIKDLDLRLLGMVLEKNGEVVSTGTGAAVWGHPAAAVAWLANKLAAFDIALEAG
FT                   EIVLSGAITAAVDAAAGDVFTVSFYGLGTLNLRFI"
FT   gene            381002..381877
FT                   /locus_tag="Toce_0377"
FT   CDS_pept        381002..381877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0377"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="COGs: COG4569 Acetaldehyde dehydrogenase
FT                   (acetylating); InterPro IPR003361:IPR000534:IPR015426;
FT                   KEGG: mta:Moth_1776 acetaldehyde dehydrogenase; PFAM:
FT                   Acetaldehyde dehydrogenase ; Semialdehyde dehydrogenase NAD
FT                   - binding; PRIAM: Acetaldehyde dehydrogenase (acetylating);
FT                   SPTR: Acetaldehyde dehydrogenase; TIGRFAM: acetaldehyde
FT                   dehydrogenase (acetylating); PFAM: Semialdehyde
FT                   dehydrogenase, NAD binding domain; Prokaryotic acetaldehyde
FT                   dehydrogenase, dimerisation; TIGRFAM: acetaldehyde
FT                   dehydrogenase (acetylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07158"
FT                   /db_xref="GOA:D9S0Z4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z4"
FT                   /protein_id="ADL07158.1"
FT                   /translation="MDKIKVAVIGPGNIGSDLMYKILRSEYLCMEMMAGIVESEGIKRA
FT                   RSLGIRTTTEGIKPILEDESIKIVFDATGAKHHLKHAPLLKEAGKIAIDLTPAAVGPYV
FT                   VPPVNLKDLHEEPNLNMVTCGGQATVPIVYAINQVAGARYAEIVACIASKSAGQGTRQN
FT                   IDEFTQTTAKALCAIGGAKKSKAIIILNPADPPIIMTNTIYVDVENPDEKAIREAVDKM
FT                   VRAVQSYVPGYRLRVPPILEGNKVTTIVEVEGAGDFLPKYAGNMDIITSAAVAVAEKLA
FT                   ARIMGKEAVA"
FT   gene            381874..382893
FT                   /locus_tag="Toce_0378"
FT   CDS_pept        381874..382893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0378"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase; InterPro
FT                   IPR000891:IPR017629:IPR012425; KEGG: mta:Moth_1775
FT                   4-hydroxy-2-ketovalerate aldolase; PFAM: pyruvate
FT                   carboxyltransferase; DmpG communication domain protein;
FT                   SPTR: 4-hydroxy-2-oxovalerate aldolase; TIGRFAM:
FT                   4-hydroxy-2-oxovalerate aldolase; PFAM: DmpG-like
FT                   communication domain; HMGL-like; TIGRFAM:
FT                   4-hydroxy-2-oxovalerate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07159"
FT                   /db_xref="GOA:D9S0Z5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z5"
FT                   /protein_id="ADL07159.1"
FT                   /translation="MNGTKFVHIVDTTLRDGSHAVAHQFTREQIKAIAGGLDAAGVEYI
FT                   EVSHGDGLAGSSYNYGWAALSDEEMLKAAAEVIKKAKLTVLLLPGIGTREDLKLAIECG
FT                   AKAVRVATHVTEADIAEQHIGMAKKMGLEAFGFLMMAHTAPPEKVVEQALLFESYGADY
FT                   IYIADSAGAMLPEDVKARVGAVVEKVKVPVGFHAHNNLTLATANCLAALEAGATFLDGA
FT                   CRGLGAGAGNAQTEALIGVLDKAGYRTGVDFYKIMDVAEDVVEPIMQRPQVVRNAPLML
FT                   GYAGVYSSFLLHTYRAAEKFGLDPRDILVELGRKGMVGGQEDMIVDVAYQLAKQREGN"
FT   gene            382896..383510
FT                   /locus_tag="Toce_0379"
FT   CDS_pept        382896..383510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0379"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="COGs: COG4231 Indolepyruvate ferredoxin
FT                   oxidoreductase alpha and beta subunits; InterPro
FT                   IPR017896:IPR017900:IPR007419; KEGG: chy:CHY_1274
FT                   iron-sulfur cluster-binding protein; PFAM: BFD domain
FT                   protein [2Fe-2S]-binding domain protein; SPTR: Iron-sulfur
FT                   cluster-binding protein; PFAM: 4Fe-4S binding domain;
FT                   BFD-like [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07160"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z6"
FT                   /protein_id="ADL07160.1"
FT                   /translation="MKLVNLLAVVDEEKCRGCKTCEKVCPVLAIKMVDRKAKVDEEKCR
FT                   GCAACEQRCPFYAISMAKREQPVAVGVDVSGVDYSRVEELCRRAKLHPEQIVCYCTATR
FT                   AEEVAAAVLQGARSPEDVSLVTGARTGCKVECIQPILRLLETAGIKPEPPKGGWQWYGR
FT                   TPTVWEVPNEVKKKYASRGFYFDEDIKLLDGVAAAPLQGEE"
FT   gene            383514..384962
FT                   /locus_tag="Toce_0380"
FT   CDS_pept        383514..384962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1773 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07161"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z7"
FT                   /protein_id="ADL07161.1"
FT                   /translation="MMRPPIPPIPPRKSQYGIDPSLVKKRVSELPGMTSVLLKDLFPDL
FT                   PEVIYPGERGIAAVRRATEEALKKVDMSMIKPEHSVNILASHHGFTLLGGEPYAEMLKT
FT                   LKDVIQARTGCKDIRLRAGVGLRFRETEEYIKRYGLDKHFEGKAIGVAPIDEGIPIETE
FT                   IGTLYGIKKVYDADWIVHAHNSDVREVHFHRQVDRAVKPFGMSYARIETRSTYHQNLGP
FT                   RAANFTARAIFDSPFVQSKFAFASFLSVAPNGIVGVDADNDLYALNDRITVLGCRYYGK
FT                   MMTLFGEIDECIAALDFPCPVVYVFAAGVIYANFAGANTDLYDLDMPLPAYTWYTEAFY
FT                   GKNGKPLLKEIPPLNPAIKMCVHNYAWTGYPSAFFSEHIPTVVVGYEQADLFNRDPQNL
FT                   NYMKHAVVAETTEAAMEFAYRVTGTRKVLIFDGAVGGINLSEPLAEFLLKKAPEVNERV
FT                   ESELLPKWLRQRGVDLLELKKCAG"
FT   gene            385033..386283
FT                   /locus_tag="Toce_0381"
FT   CDS_pept        385033..386283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0381"
FT                   /product="benzoate transporter"
FT                   /note="COGs: COG3135 Uncharacterized protein involved in
FT                   benzoate metabolism; InterPro IPR003016:IPR004711; KEGG:
FT                   mta:Moth_1772 benzoate transporter; PFAM: Benzoate membrane
FT                   transport protein; SPTR: Benzoate transporter; TIGRFAM:
FT                   benzoate transporter; PFAM: Benzoate membrane transport
FT                   protein; TIGRFAM: benzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07162"
FT                   /db_xref="GOA:D9S0Z8"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z8"
FT                   /protein_id="ADL07162.1"
FT                   /translation="MSVVIKTSLKNEPVWEKGPGFQEGLRDLRSKLNANTFTAGVVAAI
FT                   FGCTGPALIVMNAAQNGKLTDAQTISWLFSVYFFGGLISIILGFYYKMPINGAYSIPGA
FT                   VMLASALPLFSFNEAVGAYFIAGVLVLLLGFSGLIGRVMRWIPLPIVMAMIAGAMFRFG
FT                   LEIVTSAQKAPVIAGAALAAYFIGYRLNKKISPILWSLIVGVVAALLTGGFEFENIKIA
FT                   WIMPRIFAPTFSMGAFFGIAIPLAVLVIGAENAQAYGVLTAQGYKAPINAMTVISGIGG
FT                   IVTSFFGGHNANIAGPMTAICSSEEAGPDKSGRYAATIVNGILFGSFGLFASAAVPFVK
FT                   ALPSNLVSMLAGLAMIGVLISAFEQAFAARKFKFGAFFALIIAMSGLTLFKISAPFWSL
FT                   VGGVLASLIMEPDDFER"
FT   gene            386330..386794
FT                   /locus_tag="Toce_0382"
FT   CDS_pept        386330..386794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0382"
FT                   /product="Fe-S-cluster"
FT                   /note="COGs: COG0437 Fe-S-cluster-containing hydrogenase
FT                   components 1; InterPro IPR017896:IPR017900; KEGG:
FT                   pth:PTH_0486 Fe-S-cluster; SPTR: Fe-S-cluster; PFAM: 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07163"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9S0Z9"
FT                   /protein_id="ADL07163.1"
FT                   /translation="MSKMLMVDPSLCTGCHRCEMWCSFTKYGEINPSRSHIYVIRREPA
FT                   VDVPVVCIQCGLCINACPIGALKRDRISDAVVVDPDLCAGCGICVRVCPYGVLRIDDET
FT                   GMAAKCDLCGGSPSCAGHCPHGAIRYEDVDKAAARRRELWARAHAVKIRD"
FT   gene            386814..388700
FT                   /locus_tag="Toce_0383"
FT   CDS_pept        386814..388700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0383"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="COGs: COG2414 Aldehyde:ferredoxin oxidoreductase;
FT                   InterPro IPR013983:IPR001203; KEGG: chy:CHY_1712 aldehyde
FT                   ferredoxin oxidoreductase, tungsten-containing; PFAM:
FT                   aldehyde ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; PRIAM: Aldehyde ferredoxin oxidoreductase;
FT                   SMART: Aldehyde ferredoxin oxidoreductase; SPTR: Aldehyde
FT                   ferredoxin oxidoreductase, tungsten-containing; PFAM:
FT                   Aldehyde ferredoxin oxidoreductase, N-terminal domain;
FT                   Aldehyde ferredoxin oxidoreductase, domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07164"
FT                   /db_xref="GOA:D9S100"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D9S100"
FT                   /protein_id="ADL07164.1"
FT                   /translation="MWYGFAGKLLRVNLTNGEVKTEELDRDELRKYMGCTGFAAKILYQ
FT                   EMPGGTDPLAPEAKVVVATGPVTGTLCPSGGSYEVCYKSPLTGTWNQARSGGAFGPKLK
FT                   YAGFDFVVLEGKAAEPVYLYINDGHAEIKSAKHLWGLTVEETTDALIRELDDPEISIAA
FT                   IGPAGEKGVLYAALINDRGRAAGRGGIGAVFGSKNLKAVAVKGRGGIKVSRPKQFAEAV
FT                   EKAEQWLENYPFASIPAFGTVGLVSLLNSLGMLPTKNFQTAHFEGADRISGEYLNRKYQ
FT                   IKRRACYGCTFACGRYTSVNSGKFATPPMEGPEYETVNMFGANCGVDDLETVIKANYLC
FT                   NAYGLDTISTGMSIGFAMECYEKGLLTDKDTEGMPLRWGDGEVVVKLVEKIAHREGIGE
FT                   FLAQGVKRMAEQLGPEAEELAVHVKGLEAPAHEPRSESKVLAIQYAVSPRGACHMHPNW
FT                   ASTWDFGQLDGGMKDFGLPWPPAGIPEETSQKGMVYRYVALQGEISEILGACIFYSWGT
FT                   EGSCITPQLYAEIVSALTGWDVTAEELLLAAERSWNLKRCFNAREGFTRKDDRLPKRFS
FT                   QAIPDGPSAGARVDNLDVMLDAYYEAMGWDKDTGLPTPEKLKELGLDFAIES"
FT   gene            388765..388995
FT                   /locus_tag="Toce_0384"
FT   CDS_pept        388765..388995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0384"
FT                   /product="thiamineS protein"
FT                   /note="InterPro IPR003749; KEGG: chy:CHY_1711 hypothetical
FT                   protein; PFAM: thiamineS protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: ThiS family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07165"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D9S101"
FT                   /protein_id="ADL07165.1"
FT                   /translation="MKVKVKLLGILSLRCPAFSRFQCLELEEKKTVGDLREYLGLTGEV
FT                   CFVSVNGKVVEEGHELAEGDEVIFIPAASGG"
FT   gene            389182..389967
FT                   /locus_tag="Toce_0385"
FT   CDS_pept        389182..389967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0385"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471:IPR014757; KEGG: mta:Moth_1780 IclR family
FT                   transcriptional regulator; PFAM: Transcriptional regulator
FT                   IclR ; regulatory protein IclR; SMART: regulatory protein
FT                   IclR; SPTR: Transcriptional regulator, IclR family; PFAM:
FT                   IclR helix-turn-helix domain; Bacterial transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07166"
FT                   /db_xref="GOA:D9S102"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S102"
FT                   /protein_id="ADL07166.1"
FT                   /translation="MEKTSQIRSVAKALKIVDVLAEAKGELALGEIATKLGLAKSTVHG
FT                   LLSTLRDFGYVEQSVFTGKYKLGLRLFELGNIVAHGWDVHSVAAPYIQRLVDELGETVH
FT                   LVVLDKGEVLYIDKRESRHSLRIVSQVGMRLPAHCTGVGKVLLASLPPDEVRRIVAAKG
FT                   LPRFTKNTITDLETLEKELARVRAQGYAIDNEEIMDSLRCVAAPIRDHSGKVCAAISIS
FT                   GPVARLEGEKLALAIKQVTRTAAEISADLGYQADKSIRV"
FT   gene            389994..390830
FT                   /locus_tag="Toce_0386"
FT   CDS_pept        389994..390830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0386"
FT                   /product="PP-loop domain protein"
FT                   /note="COGs: COG1606 ATP-utilizing protein of the PP-loop
FT                   superfamily; InterPro IPR005232:IPR011063; KEGG:
FT                   chy:CHY_1281 hypothetical protein; PFAM: PP-loop domain
FT                   protein; SPTR: ExsB family protein; PFAM: NAD synthase;
FT                   TIGRFAM: conserved hypothetical protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07167"
FT                   /db_xref="GOA:D9S103"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:D9S103"
FT                   /protein_id="ADL07167.1"
FT                   /translation="MAEMEKLERLKSCIKNLGRVVVAFSGGVDSTFLLKVCLDVLGKEN
FT                   VLAVTARSSTYPARELEEARKLAEKFGANHEIIVSEELDIPGFSENPPERCYHCKKELF
FT                   GKLVAIARERGFNFVLDGSNMDDTGDFRPGMRAKDELGVLSPLKEAGLTKADIRALSRE
FT                   MGLPTWNKPSFACLASRFPYGERITAEKLSRVERAEDLLRELGFIQYRVRSHGDLARIE
FT                   VSPDEIDRFFDKTLREKVVSGLKGLGFIYVSLDLAGYRTGSMNEGLEEEEKAPWKN"
FT   gene            390818..391588
FT                   /locus_tag="Toce_0387"
FT   CDS_pept        390818..391588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0387"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="COGs: COG1691 NCAIR mutase (PurE)-related protein;
FT                   InterPro IPR000031; KEGG: cth:Cthe_0368 NCAIR mutase
FT                   (PurE)-related protein; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; SPTR: NCAIR mutase (PurE)-related protein;
FT                   PFAM: AIR carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07168"
FT                   /db_xref="GOA:D9S104"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D9S104"
FT                   /protein_id="ADL07168.1"
FT                   /translation="MEKLREILERVHRGEMAVDDAIQLLRDLPYEDLGFAKIDHHRALR
FT                   RGVPEVIFCQGKTPEQVARITRRMLEKGVNIMGTRADLKVYEEVRKIAPDAEYYKDARI
FT                   FAVKREKIVQNKGTIAVVSAGTSDIPVAEEAAVTAELLGNKVERLYDVGVAGIHRLFMN
FT                   MEVLKRAQVIIVVAGMEGALASVVAGLVDKPVIAVPTSVGYGANFSGLSALLTMLNSCA
FT                   GGLTVVNIDNGFGAGFAAHQINRLGGQADGCALS"
FT   gene            391569..392744
FT                   /locus_tag="Toce_0388"
FT   CDS_pept        391569..392744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0388"
FT                   /product="protein of unknown function DUF111"
FT                   /note="COGs: COG1641 conserved hypothetical protein;
FT                   InterPro IPR002822; KEGG: aco:Amico_1793 protein of unknown
FT                   function DUF111; PFAM: protein of unknown function DUF111;
FT                   SPTR: UPF0272 protein DICTH_1434; PFAM: Protein of unknown
FT                   function DUF111; TIGRFAM: conserved hypothetical protein
FT                   TIGR00299"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07169"
FT                   /db_xref="GOA:D9S105"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D9S105"
FT                   /protein_id="ADL07169.1"
FT                   /translation="MDVLYLDCFSGISGDMFLGALLDLGVDVREFLAELKKLPLSGYEI
FT                   EIKKSVKKGIFGTDVYIKCHEHHPHRGLKEIYGIIDGSSLKPEVKQKSKEAFLKLAVAE
FT                   GKIHGKPPEEIHFHEVGAVDSIVDIVGACILVDMLNPAKVSASPVNVGCGTVACAHGVL
FT                   PVPAPATMELLKGVPVYSSGEEGELATPTGALLLSVFAEEFGPMPRGIPAKIGYGLGKK
FT                   DRRIPNVLRAVLLKAEEDDAETDRVVVMEANIDDMNPQLYEEIMESLFQKGALDVFLTP
FT                   IIMKKSRPAVKLSCIAPPDKRRELAEAILKETTTIGVRFYEAHRMKLEREIETRSTPLG
FT                   EVRVKVSKRGGEIVRVTPEYDDIREISRKFGIPVLEAYRDIVGFLNKDKCK"
FT   gene            392798..394288
FT                   /locus_tag="Toce_0389"
FT   CDS_pept        392798..394288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0389"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase; InterPro
FT                   IPR001412:IPR004527:IPR020058:IPR020060; KEGG:
FT                   mta:Moth_1132 glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; SPTR: Glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: tRNA synthetases class I (E
FT                   and Q), catalytic domain; TIGRFAM: glutamyl-tRNA
FT                   synthetase, bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07170"
FT                   /db_xref="GOA:D9S106"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D9S106"
FT                   /protein_id="ADL07170.1"
FT                   /translation="MTDKVRVRFAPSPTGSLHIGGARTALFNLLFARHNNGVFVLRIED
FT                   TDTERSTEESVAQILRSMKWLGLDWDEGPEKGGDYGPYFQSQRLELYRKEAQRLLDEGK
FT                   AYYCYCTPEELAARREAMMKAGKAPRYEGLCRNLCDEDRKRYEAEGRKPVIRLKVPQEG
FT                   QTVVEDIIRGTVVFENSVLDDFIIMKSNGMPTYNFACVVDDHAMKITHVIRAEEHLSNT
FT                   PKQIQVYKALGYELPRFAHVPMILAPDRSKLSKRHGATSVEEFRDQGYLSQAIINYLTL
FT                   LGWSPLDSEEIFDMEKAIREFTLERVNKTAAIYDIKKLTWINGHYLRELDLDYITDQVI
FT                   PFMVKKGIIAEEDAGKRYEYIKQVVAVSRDRAKTLDELADAIAFFFKDVAEYEEKGVKK
FT                   HFFKENAAELLIKGAEALERLDEFTHESTERAFRSLTDSIGLKAAELIHPTRLAITGRT
FT                   VGPGLFEIIVLLGKEETVKRMRKAADWIKNHGTGASAS"
FT   gene            394378..394959
FT                   /locus_tag="Toce_0390"
FT   CDS_pept        394378..394959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0390"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2316 hydrolase (HD superfamily); InterPro
FT                   IPR006675:IPR006674; KEGG: chy:CHY_1871 HDIG
FT                   domain-containing protein; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: HDIG domain protein;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM: HD domain;
FT                   TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07171"
FT                   /db_xref="GOA:D9S107"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D9S107"
FT                   /protein_id="ADL07171.1"
FT                   /translation="MGKIPTRQEAFELLKKYNQNESLIKHALAVEAVMRHFAKLFGEDV
FT                   EKWGIIGLVHDLDYEKFPEQHCRKVREILAEEGWPEEYIKAVQSHGWKICVDVEPTERM
FT                   EKVLYTIDELTGLIAATALMRPDRSIMSTTVKSVKKKWKQKSFAAGVNREVIEEGAGML
FT                   GMDLDWIIEETIKGMQKVAGEIGLKGDFQG"
FT   gene            395146..395523
FT                   /locus_tag="Toce_0391"
FT   CDS_pept        395146..395523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0391"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524; KEGG: tit:Thit_2160 transcriptional
FT                   regulator, GntR family; PFAM: regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH; SPTR: Transcriptional
FT                   regulator, GntR family; PFAM: Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07172"
FT                   /db_xref="GOA:D9S108"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S108"
FT                   /protein_id="ADL07172.1"
FT                   /translation="MKIVISNTSGEPIYEQIKRQLKESILKGELKEGELLPSIRQLAKD
FT                   LHISVITTKRAYDDLEREGYITSVVGKGSFVAKQSKESLREIRLKWIEEKMAEIVSESK
FT                   SLNITLEELQEMLRILYEEDT"
FT   gene            395602..396477
FT                   /locus_tag="Toce_0392"
FT   CDS_pept        395602..396477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0392"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR017871:IPR003593;
FT                   KEGG: pth:PTH_0278 ABC-type multidrug transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07173"
FT                   /db_xref="GOA:D9S109"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S109"
FT                   /protein_id="ADL07173.1"
FT                   /translation="MEDVVVLDGVTKIYPGFQLDSLSFTIKKGFIHGFIGRNGAGKTTT
FT                   IKLMMNLVKRDAGTIQIFGLDNRMHEKEIKQRIGFVYAENHFYEELTVEQMKRVVASFY
FT                   RKWDEQTFQRYLKLLDVPLKKKIKHLSKGMKVKFSIALALSHNADLIVMDEPTSGLDPV
FT                   VRREILELMSELIQDGEKTVFFSTHITSDLEQIADYITFIHEGRIYFSLTKEEIADLYG
FT                   IVKGGPDLLNRENRKLFIGLRETPYGFEGLTKEMKKAREIFGDRAIYEAPSLDEIMVYT
FT                   VKGNTKHQEA"
FT   gene            396482..397108
FT                   /locus_tag="Toce_0393"
FT   CDS_pept        396482..397108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_4532 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07174"
FT                   /db_xref="GOA:D9S110"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D9S110"
FT                   /protein_id="ADL07174.1"
FT                   /translation="MLTLIYKEFLITRITLIFYIVISLLYNFNILSPGPPLPLVTMLAT
FT                   FFQFMVAGQEDKNNSHIFINSLPVTRKQVVVAKYLFSILVGLLLIGLTVVIQWLMPMYP
FT                   SGNGFVEIIYAVSAICFFTAAFYPLYFWLGAQFVRIGIFAFFIFVFAVAPILVNIAMKK
FT                   NCWGILGLFLAMPDHLLAALVLGMTIVLMVISAALSIRIYGRKDF"
FT   gene            complement(397331..398101)
FT                   /locus_tag="Toce_0394"
FT   CDS_pept        complement(397331..398101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0394"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="KEGG: cbl:CLK_3770 putative ABC transporter,
FT                   permease protein; SPTR: Putative ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07175"
FT                   /db_xref="GOA:D9S111"
FT                   /db_xref="UniProtKB/TrEMBL:D9S111"
FT                   /protein_id="ADL07175.1"
FT                   /translation="MFTLFKYEMRGRYKGILGVCGAIILWSLYLFTIYDGGWRFINISL
FT                   FYLMSIPAVLVGVFISGVNLFRRDLYQDTGYLVFSLPQKAYAIVGSKLLTSLVEFIIFS
FT                   FLSGSMVLIHVLNFQEFSRHHLLEALNQLWPEFIYVYLYPIIVLLSALIIAYFAFTLGK
FT                   AAFCNSRFGLIVSFGVFIISVILINKIHLYLTKVFPYNLMLHIGTVVNEINGQHISTIP
FT                   VTVSVNVAGLIFQVLVHLCLFIVTLYLLDNKVDI"
FT   gene            complement(398101..398796)
FT                   /locus_tag="Toce_0395"
FT   CDS_pept        complement(398101..398796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0395"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593; KEGG:
FT                   cno:NT01CX_0787 ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07176"
FT                   /db_xref="GOA:D9S112"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S112"
FT                   /protein_id="ADL07176.1"
FT                   /translation="MDFILKAKKLSKNYYSKKVLKDIDIEVPRGKILGLLGPNGSGKTT
FT                   FIKIVAGLIRPSSGEILIDGQKPGVYTKSIVSYLPDVNFLFKWMRIKDAMSFFKDFYPD
FT                   FDIEKARRLLEFMELTEDKRITTLSKGMVEKLHLTLVLSRKAKLYILDEPLGGIDPVAR
FT                   EKIIDAIVDNLNEESSMIISTHLVKDIERLFDEVAFISKGEIVLRGNAEELRVEKHKSI
FT                   EEIFREVFQ"
FT   gene            complement(398781..399167)
FT                   /locus_tag="Toce_0396"
FT   CDS_pept        complement(398781..399167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0396"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524; KEGG: dth:DICTH_0467 transcriptional
FT                   regulator, GntR family; PFAM: regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH; SPTR: Transcriptional
FT                   regulator, GntR family; PFAM: Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07177"
FT                   /db_xref="GOA:D9S113"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S113"
FT                   /protein_id="ADL07177.1"
FT                   /translation="MIIEFDEKQPIYLQIMDLIKRDIVSGKLKGGDKLPSVREMAEKLK
FT                   VNPNTVQRAYQELEREKVTFTQRGMGTFITKDEGMISALKKKMAKDVLDAFINGMRELG
FT                   FSGDEILHIVKNYVEKGDPDWISY"
FT   gene            399408..400154
FT                   /locus_tag="Toce_R0009"
FT   CDS_pept        399408..400154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_R0009"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR020904:IPR002198:IPR002347;
FT                   KEGG: chy:CHY_1186 short chain dehydrogenase/reductase
FT                   family oxidoreductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Oxidoreductase, short
FT                   chain dehydrogenase/reductase family; tmRNA as predicted by
FT                   Rfam (RF00023), score 216.66; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_R0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07178"
FT                   /db_xref="GOA:D9S114"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S114"
FT                   /protein_id="ADL07178.1"
FT                   /translation="MDFKDKVVVVTGAGRGIGRSIARMYACHGAKVVIADRNFKDAQET
FT                   ERLIKEEGGEAFAVLADVSRPEDVVKLMEKTEEMYGRLDILINNAGFGCWKSPYDLKVE
FT                   EWDSVINTNLRGTFLCSREAAKIMRKNGGGSIVNIASTRAIMSEPDSESYAASKGGILA
FT                   LTHALAVSLGPDRIRVNAISPGWIETGDYEKLREIDHLQHPAGRVGKPEDIARACLFLT
FT                   ADENGFITGANLVIDGGMTRKMIYEP"
FT   gene            complement(400580..402094)
FT                   /pseudo
FT                   /locus_tag="Toce_0398"
FT   gene            complement(402075..402527)
FT                   /locus_tag="Toce_0399"
FT   CDS_pept        complement(402075..402527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0399"
FT                   /product="protein of unknown function DUF955"
FT                   /note="COGs: COG2856 Zn peptidase; InterPro IPR010359;
FT                   KEGG: cbi:CLJ_B2579 hypothetical immunity region protein 2;
FT                   PFAM: protein of unknown function DUF955; SPTR:
FT                   Hypothetical immunity region protein 2; PFAM: Domain of
FT                   unknown function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07179"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D9S115"
FT                   /protein_id="ADL07179.1"
FT                   /translation="MDVKNVVRKLVKKYKTSDPFEIMDALDIIYIKHPLPENVRGFYFS
FT                   KLRRKIVVINSIYEKRRQIVTAAHELGHCLLHPKMNAIFLELNTLLVTSKYENEASKFA
FT                   AELLMYNIDLTKYEGYVMEQIACALDIPENVLKLIVREGSYERSKS"
FT   gene            complement(402541..402948)
FT                   /locus_tag="Toce_0400"
FT   CDS_pept        complement(402541..402948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0400"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: ckr:CKR_2925 hypothetical
FT                   protein; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Immunity repressor
FT                   protein; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07180"
FT                   /db_xref="GOA:D9S116"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9S116"
FT                   /protein_id="ADL07180.1"
FT                   /translation="MDFGERLQELRKEKGISREELARALQVSYSAIAKYETNVRKPDQE
FT                   TLKKIADYFDVTVDYLLGRSNHRQLTRRDERDIEKIIEETRHRIENTEGLLLDGEILSQ
FT                   EDVDAIINAMRVGLEMAKLRNKEKYGRKKKK"
FT   gene            403088..403300
FT                   /locus_tag="Toce_0401"
FT   CDS_pept        403088..403300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0401"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: drm:Dred_0917 XRE family
FT                   transcriptional regulator; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07181"
FT                   /db_xref="GOA:D9S117"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9S117"
FT                   /protein_id="ADL07181.1"
FT                   /translation="MREALNTARKVKGFTVKDIATKLGISESFYYKIEKGLRNPTISLA
FT                   KKISELLEKDIEELFFDEKLDGSSS"
FT   gene            403315..403497
FT                   /locus_tag="Toce_0402"
FT   CDS_pept        403315..403497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0704 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07182"
FT                   /db_xref="UniProtKB/TrEMBL:D9S118"
FT                   /protein_id="ADL07182.1"
FT                   /translation="MKIAILKTTISRKKLLKGDFTPDSEEIVGYEEVDEDEFYGPLVRL
FT                   FSQKLKEAYKESVSN"
FT   gene            403592..403756
FT                   /locus_tag="Toce_0403"
FT   CDS_pept        403592..403756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07183"
FT                   /db_xref="GOA:D9S119"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="UniProtKB/TrEMBL:D9S119"
FT                   /protein_id="ADL07183.1"
FT                   /translation="MIPKIIEMEADLPDGMTEEQLEKLLRPNLLAFARILARDIKNQNV
FT                   AETRPKRKE"
FT   gene            403949..404479
FT                   /locus_tag="Toce_0404"
FT   CDS_pept        403949..404479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0404"
FT                   /product="Sigma-70 region 4 type 2"
FT                   /note="InterPro IPR013249; KEGG: sli:Slin_3339 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: Sigma-70
FT                   region 4 type 2; SPTR: RNA polymerase, sigma-24 subunit,
FT                   ECF subfamily; PFAM: Sigma-70, region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07184"
FT                   /db_xref="GOA:D9S120"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9S120"
FT                   /protein_id="ADL07184.1"
FT                   /translation="MQRWSSWSEMEDQYREGALALKTARDRLKDEDYQRTIADREIMGS
FT                   MIRDLEDTARVLKRKVLYEFGSLSEDELALLTDRQRQIAELRQRYSYREIAEKTGLAVN
FT                   TVFYIYQQAVRKLKQAKRKKKEGIPPGLSPQQKEIYVLYSRGVKPKEIASKLNISREVV
FT                   YVQLNRIKSLTKI"
FT   gene            complement(405027..405608)
FT                   /locus_tag="Toce_0405"
FT   CDS_pept        complement(405027..405608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2071 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07185"
FT                   /db_xref="GOA:D9S121"
FT                   /db_xref="UniProtKB/TrEMBL:D9S121"
FT                   /protein_id="ADL07185.1"
FT                   /translation="MGIVDFIGFLVYGVGIRGIIFWILTGFIILNFPCNFSRYFLWLIF
FT                   SLWLALKPISRFFVYIRTGKHKISLQMNTFSSFPIIIGNPINRSLNLIYKDFVNSAFPE
FT                   IMKTAKEGDEIIVKTHLIPHKFIKKLPGNPKIKEIKASMLTIIINISLAAISFIIRKYV
FT                   YKLNKGNLLEYLRKLNKHRYYVVIWKKVKK"
FT   gene            406066..406872
FT                   /pseudo
FT                   /locus_tag="Toce_0406"
FT   gene            407018..407746
FT                   /locus_tag="Toce_0407"
FT   CDS_pept        407018..407746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0407"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: csc:Csac_2637 hypothetical protein;
FT                   SPTR: Cobyrinic acid ac-diamide synthase; manually curated;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07186"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S122"
FT                   /protein_id="ADL07186.1"
FT                   /translation="MNPKTISFWSAGGNAGKTSLAIAFALALRKHKTEVVLADFKEVTP
FT                   HIHKYFGIDFREKSDIYEAIENGQEVVEVVKRHLYKKQSIWIFPGVGLEDFAKFEVKHF
FT                   SAIIEVLKKEFDHIVIDTSPGIFFSSTYASLKNSDLVYAVLLSNRWSLEDTAMMIDFIY
FT                   SRWNVEKSRFKALLNMADSGEIDVHTVERVLEVEAFSVRHGQKHITHDVDRLAKVLFEK
FT                   ETVKGYPIRATKTCYEKSIG"
FT   gene            complement(407783..409006)
FT                   /locus_tag="Toce_0408"
FT   CDS_pept        complement(407783..409006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0408"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="COGs: COG3547 Transposase and inactivated
FT                   derivatives; InterPro IPR003346; KEGG: pth:PTH_2606
FT                   transposase; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; SPTR: Hypothetical transposase; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07187"
FT                   /db_xref="GOA:D9S123"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9S123"
FT                   /protein_id="ADL07187.1"
FT                   /translation="MFYGGIDVAKHSHEVCLVNDSGDIVLKMHLDNNHKGMNKLLQALE
FT                   RLGLKPDDVKFCLEATSHYWLPIYCYLTNQGFELHVINPIQSDALRNLYVRKTKTDQKD
FT                   ALLLADLLRLGRAPETRLPSETTLKLQSLSRLRFEFVRQVGGLKNRVLGILDRIFPEYP
FT                   DCFSDVFIRTSRELLKSYPEPEELAEVDLSELSAFLKEHSRGRFGEERAKKIQSLAKGT
FT                   FGITMALDAFTLQLRLLVEQIEFIEEQIKVIEDAINEVMEELRPSKDTPYRHVIETIPG
FT                   IGPVLAAAIIGEIGDISRFPNPRALVAYAGLDATVRASGLFEGTRNRMSKRGSPVLRNS
FT                   LWLAAVSARRFNPELRAYYEQKRSQGKHSNVATGAVARKLVHLIYSLWKDNRPYDPDYQ
FT                   WSPPGKNA"
FT   gene            409323..410477
FT                   /locus_tag="Toce_0409"
FT   CDS_pept        409323..410477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0409"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR001482; KEGG: csc:Csac_2636 type II
FT                   secretion system protein E; PFAM: type II secretion system
FT                   protein E; SPTR: Type II secretion system protein E; PFAM:
FT                   Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07188"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S124"
FT                   /protein_id="ADL07188.1"
FT                   /translation="MALINPFAPENTDYQPELEIDSTVNSAVEEVVAEIVAECPELVAG
FT                   VESGACSRALLESKIKDVIVGKKIYRGSIDAFVRKVMDALFGYGPLHPYIEDPEVSDIL
FT                   VNAFNIVYIKKFGKKFRVSVDFGSEENLTRYCYKVAALCGGKLDENYNAEAILTDRKRN
FT                   LRIVISLKPINVLSPSISIRKPTTGFSLPELVERNMLTDEQADFFRNAVLEKKTIVIAG
FT                   KGGSGKTTLLGALIDMVPHDERGLLIQETFEIKPRHPDVICKLVRISDNPEVKDYTLFE
FT                   LTKIGLLMSLDRIFIGEIKDKEAMDFFNAVYTGHRGSMATVHANSAGEVVNRLILLMKR
FT                   SGTDVPVDDLREMLYASLDLIVFMEDYRVKEIFEPKGGGGFCTM"
FT   gene            410465..411367
FT                   /locus_tag="Toce_0410"
FT   CDS_pept        410465..411367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1906 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07189"
FT                   /db_xref="GOA:D9S125"
FT                   /db_xref="UniProtKB/TrEMBL:D9S125"
FT                   /protein_id="ADL07189.1"
FT                   /translation="MHYVAFLQFAVLSTLIYITATEILRAKFRRRLFESYFSRYRKAFG
FT                   FLESRSNVLKGIDALVARSGIKGKLPFLDAKNMVFASCILFLAGIYFFGRLGFAALFYA
FT                   AALVYIPYAGMMFLATMNAKKVKAAYLTFLSTFTGFYNIEGNIINALKSTAAYVSEPLR
FT                   SFLKRNVFLFEKTQRSIAECLDNIAFEVGDKEFRKFINFAKMNAKYGGNFGKALTKLRE
FT                   QAEKLHSLEAIESANAFVGSLVILFMIVINLVLMLNVSNDPEVALAIRNTVTGQAIAIS
FT                   NAAAIIFGLYMIKNINSSA"
FT   gene            411377..412201
FT                   /locus_tag="Toce_0411"
FT   CDS_pept        411377..412201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0411"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="InterPro IPR018076; KEGG: rhi:NGR_b03740 pilus
FT                   assembly protein TadB; PFAM: Type II secretion system F
FT                   domain; SPTR: Type II secretion system protein; PFAM:
FT                   Bacterial type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07190"
FT                   /db_xref="GOA:D9S126"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D9S126"
FT                   /protein_id="ADL07190.1"
FT                   /translation="MKIIYSLLLVPVLAYALYNLLREYEIYSLKKRIYRIRSVHEISKL
FT                   VGKTVRRDILERINANLKAAGRPLGLTAEAYILARAGLFLFSLIYVYLTHMEGIQAVMM
FT                   LFLGLFGLDIYIHFAKKERLEAFRREMPEIVDLFELGAAADVPLEDIFLITAESAQTKE
FT                   VRNALTRLAAEYVMTREKEGCLRRFCNEVNLPEANILAMALLQGERTGRTLEILSTLSS
FT                   SLFNTATAKIARQDKAMEYKVLAATFFLMASIVTLYMYPYFTNIQGGLKLLF"
FT   gene            412216..412419
FT                   /locus_tag="Toce_0412"
FT   CDS_pept        412216..412419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_1059 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07191"
FT                   /db_xref="GOA:D9S127"
FT                   /db_xref="UniProtKB/TrEMBL:D9S127"
FT                   /protein_id="ADL07191.1"
FT                   /translation="MFNMLRNLFQRVKEAVCNKKGNEIVAIALILLFIILAAAPYIRNL
FT                   GQTTSTGISNLNTQMEQVLNGQ"
FT   gene            412463..412888
FT                   /locus_tag="Toce_0413"
FT   CDS_pept        412463..412888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2630 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07192"
FT                   /db_xref="UniProtKB/TrEMBL:D9S128"
FT                   /protein_id="ADL07192.1"
FT                   /translation="MLDKSFWKRGSAEIVAFVLILPFLILPIANTVNMLTDLTRYDVLR
FT                   QTAREAILRMEIEGGMTQDALYALEAFLQTKGIDLNKVHIDYTPYPVSYGEEVRLRLAY
FT                   DYTIRRYTITLGGIRRIDQNATMVYGPISSVSKKYER"
FT   gene            412833..413384
FT                   /locus_tag="Toce_0414"
FT   CDS_pept        412833..413384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2629 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07193"
FT                   /db_xref="GOA:D9S1B6"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1B6"
FT                   /protein_id="ADL07193.1"
FT                   /translation="MLQWFTGLSARLARSMKDKRGSGTIIFGLLFLIPFMTFSLFLIES
FT                   RLLYTVKNAADDAVTAAALAALKSTNPVDIAYGEYMLDINTARETFYEYLRKNMKLDAG
FT                   MNPLPGSIAAGAVYVEEFTVYNPGSYPTFCSRGTYIQNTAIHVVVRFKTRRAALKGLFG
FT                   EYVDITIHRDVDNYYNLQEE"
FT   gene            413388..414032
FT                   /locus_tag="Toce_0415"
FT   CDS_pept        413388..414032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0415"
FT                   /product="SAF domain protein"
FT                   /note="InterPro IPR013974; KEGG: aco:Amico_1202 Flp pilus
FT                   assembly protein CpaB; PFAM: SAF domain protein; SPTR: SAF
FT                   domain protein; PFAM: SAF domain; TIGRFAM: Flp pilus
FT                   assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07194"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1B7"
FT                   /protein_id="ADL07194.1"
FT                   /translation="MFAFKRKTVLIVISLLLATGLTFLQYRYFKSMAESDRKIQVVVAA
FT                   ADIEAGEDITGRIGLKTIPQSAYVKGMYLPNEKVSGYAKVNISAGSYILKEMVSTEKVP
FT                   VVENGMRRVTIGVNLTSSLAGKIRPGDVVDVGWVPKEQEKGAGSKVIAQKVQIYDVVNK
FT                   MGEDTTKKGDKKNQYEKDMLIPSAVTLIVTPEQAVMIKYHEVIGSLFLVGY"
FT   sig_peptide     413388..413459
FT                   /locus_tag="Toce_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            414100..414543
FT                   /locus_tag="Toce_0416"
FT   CDS_pept        414100..414543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0416"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="COGs: COG5483 conserved hypothetical protein; KEGG:
FT                   dal:Dalk_2515 protein of unknown function DUF1130; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function, DUF488"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07195"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1B8"
FT                   /protein_id="ADL07195.1"
FT                   /translation="MSVNIVYTIGYEGIDLEQFINIIKKNHIDTIIDVRKNPVSRKKGF
FT                   SKSILNKILFENGIKYKHIEELGTPKDLREKLYRTKDFIMFINEYEKMLQSNMSLLEEL
FT                   LNEIHQENCCLLCYEKNYSKCHRSILAWNIKKMDGNGLIIKHL"
FT   gene            414554..415336
FT                   /locus_tag="Toce_0417"
FT   CDS_pept        414554..415336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tme:Tmel_1110 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07196"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1B9"
FT                   /protein_id="ADL07196.1"
FT                   /translation="MGSTYKWETKRILITVKAYPQPSRRYGEAVCVAGITDEGKWIRLY
FT                   PVQFRDLPQEKQFRKYEWIEAKVIKSSDDTRPESYHVDPDSIRKLHFVDTKDNWAERKK
FT                   IVLPLLNKSLEELIEKCKNENISLGLIKPKEVLDLIIQEEPENWRPEKEIYLRQISLFS
FT                   SVQKQVLEKIPWSFAYKFICDDKKCNREHILSYVDWEIYQSYRSWRKKYNDKVLNKIKN
FT                   KYFDYFKNRDLYFYVGTVHKFHRFATFVVIGTFYPPKS"
FT   gene            415793..416002
FT                   /locus_tag="Toce_0418"
FT   CDS_pept        415793..416002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssa:SSA_1170 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07197"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C0"
FT                   /protein_id="ADL07197.1"
FT                   /translation="MKGHQMDYELSYILWRGIHDALEKAIERRDKKAVEPLKRAVEYYN
FT                   KHFVTSGKYLEDLLSKLESLKGGN"
FT   gene            415995..416411
FT                   /pseudo
FT                   /locus_tag="Toce_0419"
FT   gene            416401..417090
FT                   /locus_tag="Toce_0420"
FT   CDS_pept        416401..417090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0420"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro
FT                   IPR006675:IPR003607:IPR006674; KEGG: tpd:Teth39_0041 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: HD domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07198"
FT                   /db_xref="GOA:D9S1C1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C1"
FT                   /protein_id="ADL07198.1"
FT                   /translation="MKDSMRLFTTMARGEDGLYSVEITRGYCDGKCVFCRRCYENRDIL
FT                   KPVNSYEADFYEEHFVNHQARVAGLCAKVAEYIALEQKKATVLIQAALLHDIGKIFIPS
FT                   AVFMKKGRLTPEEFEVVKCHAVLGAFYLKGRGFPASVTEAVKHHHERYDGAGYPDGLKG
FT                   DHIPLLARIIAVCDAADAMLVGRHYRAAISRKMVIDELLRNSGSQFDPDVVNVMVEIIN
FT                   EEAVVNV"
FT   gene            417083..418108
FT                   /locus_tag="Toce_0421"
FT   CDS_pept        417083..418108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0421"
FT                   /product="plasmid segregation actin-type ATPase ParM"
FT                   /note="KEGG: tpd:Teth39_0078 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07199"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C2"
FT                   /protein_id="ADL07199.1"
FT                   /translation="MFKIGLDLGYGYVKGVNEAGKVAVFPSLVGNAYERPLKSLFENNQ
FT                   EKVIDNMHLVVVNGEKLEFFVGELARRESRNVSYAFDQNKINHPNTRALLAAASILLFP
FT                   AEDLPIHLVSGLPLEEYIHKKDEFKEMLKGYKVLACFKGDEKVKVIKFDKVTIFPQAAG
FT                   AVYYAIWGDLQNYLIRGSYLGLIDIGFKTTDFIVFLVDNRLVLREDLSGTIDIGISSLY
FT                   NMADKLFTQKTGGKLDIPELMRLICDGRIFFRGRQLDFSEELKAKKAEIAQVIKDRLKA
FT                   VWGNKLDFFNTVFLAGGGAKDLQEFLTDIYENTVIVKDPQLANARGFLKVAELEEKKVA
FT                   K"
FT   gene            418105..418275
FT                   /locus_tag="Toce_0422"
FT   CDS_pept        418105..418275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0422"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07200"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C3"
FT                   /protein_id="ADL07200.1"
FT                   /translation="MIYNPYENAWNLMKQMAEEYMREKNYLTSREFKYIIRLCEKSINM
FT                   FTALSPDDTTV"
FT   gene            418576..418857
FT                   /locus_tag="Toce_0423"
FT   CDS_pept        418576..418857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0046 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07201"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C4"
FT                   /protein_id="ADL07201.1"
FT                   /translation="MKVYSFRLGKGDEDIEQLLKGLARNERSQYIKNALRFYRDFGEKI
FT                   SKIEAMLEKIEASGFYPPGPREEAEPEQAGYDTAEKMLIESLENILSF"
FT   gene            419119..419487
FT                   /locus_tag="Toce_0424"
FT   CDS_pept        419119..419487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0050 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07202"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C5"
FT                   /protein_id="ADL07202.1"
FT                   /translation="MKKVTVYLSENTYDVLNNLSSKRKESMSLIARKILEKGLTEEAAK
FT                   DGIDAVTDAVRRAMRDILKPTEDRLAKLAAKAAVAAATAMYLNTQCIADLGKNNALELY
FT                   QIARTKAVAYLREKDEEA"
FT   gene            419484..421973
FT                   /locus_tag="Toce_0425"
FT   CDS_pept        419484..421973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0051 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07203"
FT                   /db_xref="InterPro:IPR041073"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C6"
FT                   /protein_id="ADL07203.1"
FT                   /translation="MSRAPFIIKIAFYKASQKNQAKNVAHIQYIATRPGADRGEFNIGD
FT                   DLDADPGTAAGHAKYMDERPGSHGLFGPENKTPDLREVQRELKDHNGIVWRMVLSLKEE
FT                   DAIRLGYTARESWEKALKATMPEAAAKMGIRESNLKWVAAFHQAQGHPHVHVVMWEKTP
FT                   QRTRGVLSLGERKDLRRVFVREIYAEERLALTAKKSAIRDLIRETARKDVFSVIREIEK
FT                   ARLEVRALAGQEPGLPPVLHTVTQEELINKLNGLAKIMPGHGRVALKYMPVEVKKEARE
FT                   IADWILSQPGFTGSVERYKDLARQLAGYHTFQEQRLNEAAQKAYEDMRDRVAQIVLQGA
FT                   VKVQQIESFIESRPQMTEHEATEYEAVKISEQALERKEIENIPQEGTIGGRRIGAGSAD
FT                   EAAKRLWRTTHYSLNRVYLQENPGADILKPRLNENFRKEIAERLQDIASSMPDLQGKPA
FT                   YTYLPDELKQKARETAEWLLTRQELQNRFSEIGPLKAERLTRRMAEQVAIRAYDLVPKE
FT                   VPDVEMVLHSRRAEEAVNKLRSVRSDFVKDDLEEARWTVGAIYRALTYLGKEKEAREVA
FT                   ERFGKEAGLQHNEILKALEKEIERIQFIADKSQEKGQYQRHMSRNDWQQLTENLGLEEE
FT                   ELLFPWFGVKKVEENEAEEKQRVKEELKVTLIEDRVSPAVAVLEQAGGKPEDLKELRWT
FT                   LVTMTSVLKALGVDEAGRERIVRGWCERAGVDILEARLKDVLDRTTISKDDIWLGKRSW
FT                   ERLMANLGIKDAPDLPWSVGSPIPMSARVASDVWKAAWRALERERLRAEAQVLLAAERE
FT                   MQRKKREAEREGKSREG"
FT   gene            421963..423804
FT                   /locus_tag="Toce_0426"
FT   CDS_pept        421963..423804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0426"
FT                   /product="TRAG family protein"
FT                   /note="COGs: COG3505 Type IV secretory pathway VirD4
FT                   protein; InterPro IPR003688; KEGG: tpd:Teth39_0052 TraG
FT                   family protein; PFAM: TRAG family protein; SPTR: TRAG
FT                   family protein; PFAM: TraG/TraD family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07204"
FT                   /db_xref="GOA:D9S1C7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C7"
FT                   /protein_id="ADL07204.1"
FT                   /translation="MKVRMAIAAIILIFDLFFMPFLCSLPIYAKDYGLQKGFQTWKTYV
FT                   IENPISGVFLLDKEAIRTPWLWLQPAVAAAVLSVLFPIYGRRRRRTDEMGLPEAAGQGQ
FT                   HGTARWRTKKEISNTLTIWETKNDNPPKGGFVVGAELGRNFKAWLDTGDTHCMVIGSTR
FT                   SGKSRRTILPTIWTLARSGESMIITDPKGELFNFSSGYLKGLGYKVILIDLRDPYRGNQ
FT                   WNPLLSVASALQDGNYSAASQAAWDIANILTNQQLHVGDSIWPQSQESLTAALILAVAS
FT                   FAPDDSKHLGSVYEMLHRLGANGGDMLDDYFRSLPKGHPASSAYGVAALSEDRLRSSIF
FT                   TGTAAQLRLWADPAVVWLTSRQDHNLNIAGREKASIFIVIPDERGTRNVIAALYIAQSY
FT                   QALVDLANANGGKLPQKVNFLLDEFGNLPPIPEFDRKITVAAGRGMRFLLAVQDLSQIK
FT                   AKYKELSQTITGNCATWVYILTTDLDTARVISGKTGQYTVRTESYSSQVRHTDYSHSTT
FT                   EGLTGRPLLLPDEVLRWPADRALVLQARCNPAWLPLPDLSKWPAAKDLTPSFSSEEKEK
FT                   EVVTAPPVWVPGVSAGEEEKKTEITSRENENLLSKLR"
FT   sig_peptide     421963..422049
FT                   /locus_tag="Toce_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            423817..424059
FT                   /locus_tag="Toce_0427"
FT   CDS_pept        423817..424059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0053 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07205"
FT                   /db_xref="GOA:D9S1C8"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C8"
FT                   /protein_id="ADL07205.1"
FT                   /translation="MPDFISGAADLLNDVLTWILYIIPAASGAAIGYHALMKQMGDGDP
FT                   SVTAAHNRSIRNVLVGGAIGMSAASLVKVFLSYFQ"
FT   gene            424110..424964
FT                   /locus_tag="Toce_0428"
FT   CDS_pept        424110..424964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0054 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07206"
FT                   /db_xref="GOA:D9S1C9"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1C9"
FT                   /protein_id="ADL07206.1"
FT                   /translation="MNVISNLINTAITDFITNLLDSILSVFVAFAGDEMALALKILETP
FT                   YVVNAISLSRTLAGSLLGVKVAAEAVKSYILYSSGDPGADPLNLLRRTAFSAFMIGAGP
FT                   WAVTNVYKFGGELARAVAKLPSTNADNPLNTIFSLSASFSAALVVTSFAAVIIWALILI
FT                   QTGIRAVEIAFLAVSGPIMAVGLTRPDEGVWSAWWRELIVLSLSQAVQTFMIRGFLSTA
FT                   ANIFFSSPMLNMLMLIGWLWVAFKTPAVLRQFAYHSGMGSAIGHAGQTAGSMYILRRMM
FT                   MRG"
FT   sig_peptide     424110..424202
FT                   /locus_tag="Toce_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            424971..425264
FT                   /locus_tag="Toce_0429"
FT   CDS_pept        424971..425264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0055 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07207"
FT                   /db_xref="GOA:D9S1D0"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D0"
FT                   /protein_id="ADL07207.1"
FT                   /translation="MYQVPKNISAKFEFFPGFGWKELFFVLAGLLTGFLFYLLLGIFTQ
FT                   SPARYLAIFVPAGLSYFLSVPGPDGNSVISLIKCYLKWSKKQKKYLYIQEGM"
FT   gene            425265..425909
FT                   /locus_tag="Toce_0430"
FT   CDS_pept        425265..425909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0059 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07208"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D1"
FT                   /protein_id="ADL07208.1"
FT                   /translation="MLKKLLKDKTSKAEKAKIEDQKKKSVQEWLPVIDITENFVKLKDG
FT                   RYVSILKVRPLNIGLKSDNEKKRIIHSVFEALNGLKEPLQIFSMGRPVDLDPYIQSLNT
FT                   KSREEINITKKRLLQEYLKYVASIATGGEAIERRFFIMLSGKEKDELKTKAHELAANLD
FT                   KSGLKAEMCTDQDIIDLLFCFSHPSQAAFERPPAFTGPYLPPTYFSGGDRL"
FT   gene            425906..427690
FT                   /locus_tag="Toce_0431"
FT   CDS_pept        425906..427690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0431"
FT                   /product="type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /note="COGs: COG3451 Type IV secretory pathway VirB4
FT                   protein; KEGG: tpd:Teth39_0060 type IV secretory pathway
FT                   VirB4 components-like protein; SPTR: Type IV secretory
FT                   pathway VirB4 components-like protein; PFAM: Domain of
FT                   unknown function DUF87; CagE, TrbE, VirB family, component
FT                   of type IV transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07209"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D2"
FT                   /protein_id="ADL07209.1"
FT                   /translation="MKRQKNTNILTGLIDMLSPQALKFNARQLTFNDQLARIMVVSGYP
FT                   PKVNAAWLSRIASMPGVVCAVHIEPTDPTNLVLSINKAIGEYAGRLEMGGNALTIQRTE
FT                   QALKDAQDLLRKIDQEQQQVFYVTVVLMVLAPDQQTLDRRTRQVEAALAASGMRGRTLV
FT                   FRQEDGLKAVGPWCILPDEVKEAGARNMPAETVAASFPFTASGINDGSGIVLGKDRDGG
FT                   LVLVDIWKRGGDRTNSNWTILAKPGAGKSFAAKMLLLREFIQGSRVIIIDPEREYKEMC
FT                   RLLGGSWVNCAGGEGRINPLQVRLRPVGEDEEGDAIFQSPLALHIQTLRTFFSLYLRDL
FT                   TDIEKAALEDALVEVYRDAGITWDTDPADIPSDKWPTTKELYKYCIGQAKTNNETYGRL
FT                   AVLLKRCAEGADANLWAGPSTAKAESDLIVLDVHDLQNADEGVRKAQYFNVLSFAWNII
FT                   ERDRQERTILVVDEAWLLVDPQTPQALAFLRDTSKRIRKYMGSLVVISQNVIDFLAPEV
FT                   QRYGQALLDNPTYKLLLAQGEKDLEAITGLLNLSEAEHDLLATAKRGEGLLVAGSQRIH
FT                   LKIEAAPYELQYLTGGGS"
FT   gene            427690..428625
FT                   /locus_tag="Toce_0432"
FT   CDS_pept        427690..428625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0432"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   tpd:Teth39_0061 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07210"
FT                   /db_xref="GOA:D9S1D3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D3"
FT                   /protein_id="ADL07210.1"
FT                   /translation="MHFVGKLILAFLPEPEKIIKFLLIAFFIPALLLILLFAGPITAYE
FT                   RVPLATPSQIKIYVDAAVKVSESTKNPYSEGVKVDWKPLVAIDAVRFMQDFSKSTPAGA
FT                   EKLAEMFIEKTDEIEVKEGDPPVTKRYPIYRLKSLDEVLDYLKFSAQEKEKVKEFLSID
FT                   LSFLFVADSGVLDGWIPLEGSLKWPLPGVYKITSRYGPRIDPVYGGSGFHRGIDIAAAT
FT                   GTPVVAAADGRVAYAGWCGGYGIAVFIWHGDGMETRYAHLSGTAVRQGAVVKAGDIIGY
FT                   VGSTGKSTGPHLHLEVRVGGKAVNPLDFFK"
FT   sig_peptide     427690..427818
FT                   /locus_tag="Toce_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428676..429005
FT                   /locus_tag="Toce_0433"
FT   CDS_pept        428676..429005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0047 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07211"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D4"
FT                   /protein_id="ADL07211.1"
FT                   /translation="MDKLYSILKPHDSWCNDEGEEKNLEARKALQDFYRELKKLKPSRK
FT                   YEKNILHLSYIPYLVRIKKALNEKKYMRACNELISLMHYEPFLQGRIYYNILNLLGKEV
FT                   MKDYT"
FT   gene            429118..429699
FT                   /locus_tag="Toce_0434"
FT   CDS_pept        429118..429699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0048 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07212"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D5"
FT                   /protein_id="ADL07212.1"
FT                   /translation="MKEDKILILDFMLDVIKEDLKYDFLTNIFYREEYFDRGIRIPPPF
FT                   PYSYYDETEKKISIFERKIGIKNVDLAKECVLVFPWHRGRMRESIKNIGSNEFRYDKYN
FT                   HKAFYFSPVNICFIYNGKHSITAGVGFKKGCIEAPEYDVTGLFKHVYTDGVYWYNSHNN
FT                   QKFEDELLDFRIGIIYELSKLKYQIEKGLE"
FT   gene            429760..430113
FT                   /locus_tag="Toce_0435"
FT   CDS_pept        429760..430113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xal:XALc_2255 putative atp-dependent helicase
FT                   protein; SPTR: Putative atp-dependent helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07213"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D6"
FT                   /protein_id="ADL07213.1"
FT                   /translation="MDALEKYEEDAKLYGAFLDAARIAGEKANISRQELLLIDPDNPIL
FT                   KLSMREYALLKSHPILMLAEVLFGGSEGPGRKNISPQMAFLAASVAVGQGYSVDRVFRV
FT                   LERLFARELERRV"
FT   gene            430118..431203
FT                   /locus_tag="Toce_0436"
FT   CDS_pept        430118..431203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2347 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07214"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D7"
FT                   /protein_id="ADL07214.1"
FT                   /translation="MLISVILTKQRSEKVIEAAKELGEIILEQVGTLDSQGIKDVLNSA
FT                   ARVASDILILDLDIGSGRDIVAALQSFRIARPHTRIIILAPAREPGDVIVSSLVGLGIY
FT                   DIISGSKDSDWGKLVKDALARQPATYAQAARWHTGQFLGIPPVKEQVIIEERPSGVVTI
FT                   AVAGTAHGLGCTYTALSIAYFLARLGHSAAIIEDSQRPSLGFLCSVLKARSGRVQGSFM
FT                   IHGLDIFPLDESATDVNSNYDILLKKIRAGQYEYIVRDIGVLDPVRVKEIYKADFAFIV
FT                   ASAAKWRWQELIDKIDSEFSIIFPLASQNDIEDLSFYAGIKGTALPHCPNPFSKDNDLL
FT                   FLKLLAPILPNRKRKKSLFGL"
FT   gene            431673..431927
FT                   /locus_tag="Toce_0437"
FT   CDS_pept        431673..431927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0437"
FT                   /product="YcfA family protein"
FT                   /note="KEGG: dae:Dtox_3871 YcfA family protein; SPTR: YcfA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07215"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D8"
FT                   /protein_id="ADL07215.1"
FT                   /translation="MSKREKLIKKMRENPKGIRFEEVDNLLVGIGFHRRQPRKGSSHYI
FT                   YRMGPHKLVIKRENPVKPVYIKEAIEIIDLIEKGENLNE"
FT   gene            431920..432264
FT                   /locus_tag="Toce_0438"
FT   CDS_pept        431920..432264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0438"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="InterPro IPR005357; KEGG: pth:PTH_2782 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0150; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0150)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07216"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1D9"
FT                   /protein_id="ADL07216.1"
FT                   /translation="MSKKDLEYYLNLKYPFIVRPLTEEEGGGFAVEFPDLPFCIGTGDT
FT                   IEEAIEDAQKAKNAWLEVSYEDGDEIPEPGSSKKAVKIPGDLYRAMENRAKREGKTVDE
FT                   YVEEILKKVV"
FT   gene            432305..433285
FT                   /locus_tag="Toce_0439"
FT   CDS_pept        432305..433285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0439"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="InterPro IPR012854; KEGG: cth:Cthe_0402 copper amine
FT                   oxidase-like protein; PFAM: copper amine oxidase domain
FT                   protein; SPTR: Copper amine oxidase domain protein; PFAM:
FT                   Copper amine oxidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07217"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E0"
FT                   /protein_id="ADL07217.1"
FT                   /translation="MRKIVVLFLSALLMLYASTPVLAVQEITPDKAFDKEALMRKFTYN
FT                   GKEYDDLVLVIQGTEGIYASYLSEFLEWRLESGVVYDLDDEEERDLLIKEFFSRKTTGF
FT                   WMYPSVEIISINGEPWQITEYAEHIKEAVHNNLNPGDLLYDKNGEAWKYFCNPKYNGVA
FT                   SILLKGKTSLSFPVLWEDRISMYNPLNGGKPVKIETDVKDGAVLKLGSPKVTITKNGIS
FT                   KVNTLSVAPLALGGRTLVPIRGVIDEFGYDLGFKKNIVTVTYDGHKIELPVNSKKAYID
FT                   GKEVILDQPVIIKNGRTLIPLRFIAENIGFDVAYKDGTINLIKTK"
FT   sig_peptide     432305..432373
FT                   /locus_tag="Toce_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433328..438799
FT                   /locus_tag="Toce_0440"
FT   CDS_pept        433328..438799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0440"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601; KEGG: csc:Csac_2638 PKD
FT                   domain-containing protein; PFAM: PKD domain containing
FT                   protein; SMART: PKD domain containing protein; SPTR: PKD
FT                   domain containing protein; PFAM: PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07218"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E1"
FT                   /protein_id="ADL07218.1"
FT                   /translation="MPKKAIATILIVILLVGIFPPSFVYQSKVYGATISDPKDINPPAG
FT                   AQLKVGNSTDWYSAGFWKIYVDGELTGDDLCVVDDLKLSRTGNLWNMLHKNTINAWLDA
FT                   FTPVPSPTGYYSGATFSKKLGSYDPYYIKTITYGGKSSQRLHIREAGKIAGVASITYDE
FT                   NKKEVYVQTTQFPTGGISFPSGVKEGDNITFQLRGTAYANIDTKKISYEFYIDGKKAAS
FT                   NTLSKTTFNDSVTKTLTAGTHSLVLKVTDGVGRTTTYTKSITVQPGSPPPPPPGNINAD
FT                   LKMTLNPPKLKTGTTGDINVSLDASGCTSTGSGPFAYRWWVKLNGTYITPSDGVNPGDG
FT                   SPYFSIVAKKAKPGDVIWAKVKVHDYSLNKSSEAETQRTVLEEGVEPPEEPEPEPDPGP
FT                   TNTPPVARFSMPSKTGQGTTVNVTNRSYDLDGEIVDVEWDVSPSSGVDENLGFDGGTIT
FT                   FDRTGTYDVTLTVWDDFGDSDSTTKTIEVTNEPPEAVISAPVEVIQGDDVVIRSNSYDP
FT                   DGEISTHRWSILPSEGVMGTLDGEKSTIWFDKTGEYTISLTVEDEFGLEDTTQKTITVK
FT                   PAIPVAYFDYSGTLKENRKIVLDASGSRTSERYPMVWEATEWQIIPPAGGSESDIKIVS
FT                   SPDMKTRTVLFKKAGDYTVRVRVKNSAGHYSEWYEKVLTIYPDLPPIADFYVYKTVLRN
FT                   PDDENYASIQLFDISYSSDGDTINSRIWRYKYDSDNDGSFDDESWVVLDDGNNLSPILK
FT                   TKNVGKYLFELSVKEGFGEETIPEFISPSDYRTADTSDKPINDKVCELINLRPVVDFEV
FT                   LKKVKADVVFTIGQAGQKTQDLDSKINQYIKPKLAAKNIDAQISSIQTRIIDSKTNFTW
FT                   EKYDHGKGKVIGNDIYFYGYTQRGYSDFWYSDDQTPGKKTFTFVLNENQVYYHSFYGGG
FT                   FIFGAKKYTDGTFEGYVLLFDQSTASIKRIPRVSMSQYSNTDGDFGYVHLIGVPKQKGV
FT                   HNIKVEIDGIKVKVWDNNNLIIDYTLPQKIGEGFGIVADHNSHDCDETSTFIFGNLVMN
FT                   FENGKSLDEALKTTTWRDNSIRFLVNISDIELPELNDPIKLGDILSRTLSADAYFVGLG
FT                   TDTNRAQYQTFIARNDGKGTFFYNTNMDTALNQTADYIISVIESIPKLLEQYVLLGEEV
FT                   TYNTYYSDPETDPKYQERWIYQHDPNYFENSLGLAPFSGQYLSGPVTVFDKVGKYEVQF
FT                   QARDNPKADNRFDNYRLWSYMPLNKLVLYVHRKPVASFTANLTPVGTASQTIIEDFEDT
FT                   NYEFSFSGNWGRSTAQRYAGQYSYKSASISHSSTTSTQFTFTIPSGATNAKISFYYLVR
FT                   SEANYDFFNFYINGNRLIHDSGYGSWKYFSYPLSPGTYTFKFEYTKDGSVNRYDDAAYV
FT                   DNITVQHDGVITSYNVQLSSTSYDLDHQSEPGKGITQEEWKWKEVTATSWNSGKPSTLG
FT                   VNKTYIVWLRVKDKEEAWSDPYVSVLSTMQVNLAPIAMFTVDPNTQVVNKTISISDMSY
FT                   DPNGDPIAEWSWRVQKPDGTWINYGSTPPTNIPSLGVGTYTIELKVRDNPQFGTTLWSE
FT                   PYTQQVTVIADNNKPVARFTISPNPVVADEPYTISDTSYDPDGDPIVAREWKVQKPDGT
FT                   WVTINQWKPTFGDDGTYKIQLRVLDDPSRRHPALTPMWSDPYVVTVQVQGRLIVIGDSN
FT                   KTTYKAGEAMILYARTEGKAYRVEARMWYPKNEFSSSNVTTLVPDTPLTSPPQDVMTWH
FT                   TKHTKAEGRDVVVIIPKNMPDGNYQVVFTAYKQLAGGGTKTATDTITVRVKGTIYDHSK
FT                   SQIIGPRF"
FT   sig_peptide     433328..433399
FT                   /locus_tag="Toce_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            439963..440106
FT                   /pseudo
FT                   /locus_tag="Toce_0441"
FT   gene            complement(440267..440374)
FT                   /locus_tag="Toce_0442"
FT   CDS_pept        complement(440267..440374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07219"
FT                   /db_xref="GOA:D9S1E2"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E2"
FT                   /protein_id="ADL07219.1"
FT                   /translation="MTITEVILLLQLILDVISLTIMVTNTNIKTEKKAA"
FT   gene            complement(440956..441297)
FT                   /locus_tag="Toce_0443"
FT   CDS_pept        complement(440956..441297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0741 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07220"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E3"
FT                   /protein_id="ADL07220.1"
FT                   /translation="MNSLYSSLIAPMIQCDNRLAELKAAKYSWLDSEKIINYLKHCKES
FT                   PLSDNPKAKRKIIETFVDKIIIHPDRIDTSLKINIKFETERGNLGGGEPCLTIPLSVEW
FT                   KIIYSDNYV"
FT   gene            complement(441489..441854)
FT                   /locus_tag="Toce_0444"
FT   CDS_pept        complement(441489..441854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0444"
FT                   /product="CrcB protein"
FT                   /note="COGs: COG0239 Integral membrane protein possibly
FT                   involved in chromosome condensation; InterPro IPR003691;
FT                   KEGG: CrcB protein; PFAM: Camphor resistance CrcB protein;
FT                   SPTR: Protein crcB homolog; TIGRFAM: CrcB protein; PFAM:
FT                   CrcB-like protein; TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07221"
FT                   /db_xref="GOA:D9S1E4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E4"
FT                   /protein_id="ADL07221.1"
FT                   /translation="MFLVGVGGIIGAISRFVLGKWITSKASSAFPFGTWIINISGSFIL
FT                   GILAVLHFNNAISEGLWLLFCTGFLGAYTTFSTFGYETILMLQKKDTRNAVIYISTSVL
FT                   LGVIFAWIGGSITHIIL"
FT   gene            complement(441854..442255)
FT                   /locus_tag="Toce_0445"
FT   CDS_pept        complement(441854..442255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0445"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="COGs: COG0239 Integral membrane protein possibly
FT                   involved in chromosome condensation; InterPro IPR003691;
FT                   KEGG: dhd:Dhaf_3267 CrcB protein; PFAM: Camphor resistance
FT                   CrcB protein; SPTR: Protein crcB homolog; TIGRFAM: CrcB
FT                   protein; PFAM: CrcB-like protein; TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07222"
FT                   /db_xref="GOA:D9S1E5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E5"
FT                   /protein_id="ADL07222.1"
FT                   /translation="MDVFAVGVGGFFGAIMRYLVGMWIPVTNSFPLGTLTINLLGCFFL
FT                   AWFYTITEKRWHINPTLKLAIGTGFTGAFTTFSTFSVETLNLIKSNHLVMALIYVLLSI
FT                   LGGIGLAITGFKLATLTVQPSGGMEGELE"
FT   gene            complement(442779..443150)
FT                   /locus_tag="Toce_0446"
FT   CDS_pept        complement(442779..443150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1827 helix-turn-helix, fis-type;
FT                   SPTR: Similar to tr|Q01VE7|Q01VE7_SOLUE Hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07223"
FT                   /db_xref="GOA:D9S1E6"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E6"
FT                   /protein_id="ADL07223.1"
FT                   /translation="MEKFSTNLNSLSSRLSYFFFILILTSISISRPNNDRTAFIARIIS
FT                   PHPLPCSVVKFHTAKHRHLLVRLLGIEPLSLSKKGGFFFPANKQHRSTIIEQSHYMGFN
FT                   QISPYCAFLIYFAKILLCT"
FT   gene            443363..443683
FT                   /locus_tag="Toce_0447"
FT   CDS_pept        443363..443683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nth:Nther_2678 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07224"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E7"
FT                   /protein_id="ADL07224.1"
FT                   /translation="MRITAVIPRQDQVGALVDSLENMGFRRKDMIITDMVKSESKFEED
FT                   PDEIIDIKTEREGLGEKEPYTNAFSDRIKYGILVSVEVPEKNAARVMEIMEQNGAVEII
FT                   KE"
FT   gene            443784..444704
FT                   /locus_tag="Toce_0448"
FT   CDS_pept        443784..444704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dda:Dd703_0812 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07225"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E8"
FT                   /protein_id="ADL07225.1"
FT                   /translation="MYTTETKIINVWRIDIKPDIQREVDPVKLCLNEGIIGIGWRVYGR
FT                   PTSKEDYWEKAKAIYAKDADWVRAATPFLFQMKEGDLVWIRDLMGIYYLGRIEGDWEYR
FT                   DEPVYMQADIVNVRKCKLFKVGANVPGGVSNSFRTRGTVQGINDQTVNLFSRFVYNKLA
FT                   GQEIYDTKHEIYGKRDIFSFLTETDLEDIVALFLQHEGYLLIPSSLSSRNDIPFYELQL
FT                   IHRSTGELAFVQVKSANIVLNPDYYARFPHKIFLFSPAGYSTPSNPYEHVITLKRDDIE
FT                   KFIFNFKHIMPAHVRLWLEYIEEVK"
FT   gene            445002..446522
FT                   /locus_tag="Toce_0449"
FT   CDS_pept        445002..446522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0449"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR017929:IPR004459:IPR011698; KEGG: tpd:Teth39_1900
FT                   cobyric acid synthase; PFAM: CobB/CobQ domain protein
FT                   glutamine amidotransferase; SPTR: Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07226"
FT                   /db_xref="GOA:D9S1E9"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1E9"
FT                   /protein_id="ADL07226.1"
FT                   /translation="MGAKCIMIQGTGSSVGKSRIVTGLCRILKEDGFKVAPFKAQNMAL
FT                   NSYITREGLEIGRAQATQAEACGLEPSVLMNPVLLKPTSDKNCQVIIRGKVYGNLSAMD
FT                   YHEFKAKLKKVVTETYEELKSQYDVIVIEGAGSPAEINLRENDLVNMGMAEIADAPVVL
FT                   VGDIDKGGVFASLYGTIMILEEKERERIKGVIINKFRGDIKLLEPGIKMLEDLIKRPVL
FT                   GVVPFDHSYIDEEDNPGFEMYRLKLKGSREGVVIKILLLPHISNFTDFVPLSNFENASI
FT                   EYVRPGQSIGDADAVIIPGTKNTIGDFIKVREWGWDGEIKELAKKGTVIMGICGGFQML
FT                   GKLIKDPHGVEGDIREIEGIGLLDVETELLGEKVTKKAAGHVLEHEKGLAAYLSNSPFE
FT                   GYEIHMGRTLNRGGSNFSMIKRKGEDEHLPDGAVDETGNIIGTYVHGIFESGEFTKRFM
FT                   NYLCERKGLKQAGGNIDFRRFKEEQFNNWAKILRQCLNMDEIYRIIGL"
FT   gene            complement(446665..447951)
FT                   /locus_tag="Toce_0450"
FT   CDS_pept        complement(446665..447951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0450"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701; KEGG: mta:Moth_1590 major facilitator
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: Major facilitator superfamily MFS_1; PFAM: Major
FT                   Facilitator Superfamily; TIGRFAM: Oxalate/Formate
FT                   Antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07227"
FT                   /db_xref="GOA:D9S1F0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F0"
FT                   /protein_id="ADL07227.1"
FT                   /translation="MTTSTPQTSDRKGVYGSFIWNTWTQLILAMIGMIMIANLQYAWTL
FT                   FVPELEKGFNASRAAVQLAFSLFIALESWGQPIAGYFIDRYSPRLLLTIAALMVGIGWT
FT                   AMGIVKTLSALYVAYSLAGIGAAFIYSGAVAAGVRWFEPSRRGLASGLVSAAFGSGAAL
FT                   FIPFIAMALRNQGYASAFVTTGIIQGILIFIAAQLMRVPPKKPASGAKADTSTEQHQFT
FT                   TLEMFRTLHFWLIYIMFLFIVTGGMVVTAQTKPFGQDAGIPAGIIVLAATVNTVANGAG
FT                   RIFWGSVSDKLGRYQTMFLAFTLNGVAMALVPFLGQSPAMFVFLFALIMFTWGELYALF
FT                   PAVNADIFGTKYAATNYGFMYSAKGVGGIVGSYVAALVAQLSGWSPVFFTGAAMSALAG
FT                   LGALVLLRLPRPVPPNTKKVDTGASTPVH"
FT   gene            complement(448122..449069)
FT                   /locus_tag="Toce_0451"
FT   CDS_pept        complement(448122..449069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0451"
FT                   /product="pyruvate ferredoxin oxidoreductase, beta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: mta:Moth_1591 pyruvate ferredoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; SPTR: Pyruvate
FT                   ferredoxin oxidoreductase, beta subunit; PFAM: Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07228"
FT                   /db_xref="GOA:D9S1F1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F1"
FT                   /protein_id="ADL07228.1"
FT                   /translation="MLEPITSLRKAPEEEYYLPGHRTCAGCGPALCYRLVAKAAGPNTI
FT                   FVGPTGCMYVANTSYGCGPWRVPWIHAQITNGGAVASGIEAAYKALIRKKKTDAEFPNI
FT                   IVMAGDGGAVDIGLQALSGMLYRGHDVLFICYDNESYANTGIQTSPTTPYGAATTFTPP
FT                   GPVVPEGKKLFPKDNPKVVAHGHPELKYVATASIGWPVDLMNKVRKGLNQKGPAYLHIH
FT                   APCPKGWQFPANKTIEMAKLAVETGMFQLYEYENGEYKLSVKIEKRKPVSEYMRLQGRF
FT                   KHLKPEHIEKMQAFIDARCAEVGLTVPVVTPKAK"
FT   sig_peptide     complement(448953..449069)
FT                   /locus_tag="Toce_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(449095..450282)
FT                   /locus_tag="Toce_0452"
FT   CDS_pept        complement(449095..450282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0452"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR002880; KEGG: mta:Moth_1592 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase-like; PFAM: pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein; SPTR:
FT                   Pyruvate flavodoxin/ferredoxin oxidoreductase-like; PFAM:
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07229"
FT                   /db_xref="GOA:D9S1F2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F2"
FT                   /protein_id="ADL07229.1"
FT                   /translation="MGKVKNISGCVAVANGVRLADVDVICSYPIRPYTGIMSELARMVA
FT                   DGELDAEFVHGEGEHAQLSVVYGASAAGARVFTGSSGVGVTYAFEVYSPISGERLPVQM
FT                   AIADRTLDPPGDFGSEHTDAECCRDQGWIQGWASTPQEALDNTLIFYRVGEDPRVLLPQ
FT                   FACLDGYFVSHILGPVDIPEPEQVKEFLPPYKNHHVLDPRKPQIIGPQIEPAMGPPLQY
FT                   QRYQVMKNVFKVLEEACDDFARIFGRRYDPYMEEYYTGDAEVVIFGQGAHMETVKAVVK
FT                   RLRNLGEKVGAVRLRTFRPFPTEQVKERLSRFKAVGVLDNSSNFGISGGGGVLLSEVRT
FT                   ALYDFGDKVKTVGFVAGLGGEVITHDEFYRMFQKLKEIAKTGKVEKTAYWLPFEL"
FT   gene            complement(450303..451250)
FT                   /locus_tag="Toce_0453"
FT   CDS_pept        complement(450303..451250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0453"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR017896:IPR017900:IPR011898:IPR019752; KEGG:
FT                   mta:Moth_1593 2-oxoacid:acceptor oxidoreductase, delta
FT                   subunit, pyruvate/2-ketoisovalerate; PFAM:
FT                   Pyruvate/ketoisovalerate oxidoreductase, catalytic domain;
FT                   SPTR: 2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate; TIGRFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, delta subunit; PFAM:
FT                   4Fe-4S binding domain; Pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; TIGRFAM: 2-oxoacid:acceptor oxidoreductase,
FT                   delta subunit, pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07230"
FT                   /db_xref="GOA:D9S1F3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F3"
FT                   /protein_id="ADL07230.1"
FT                   /translation="MSSNELFLEPNLKQVTVWSRGVIMNKDARDVVVALTEAAAKEGKY
FT                   VQAWENYVDLPDRINVPVRAYARISSDPIASRYVYENEAPDIVVVLEETLVKGVPVLKG
FT                   IKPGATLVVNTKRSIDSILKFLGDTGNLGQIATVDASSMAEAVVTLSGSEGATDATGIG
FT                   AGIAAPIAGAVARVTGIVDVENLAQVVKNPAAMRRGYEEVQVRKLEVRPVARESQTTAK
FT                   ELLKQMPFAGTVPSPQEENEGMVTGNWRMKRPILNTEACTQCWTCWIYCPDTCIKKGED
FT                   GPLFNLKYCKGCGLCAAVCPTGAITEVPELDFED"
FT   gene            complement(451422..453623)
FT                   /locus_tag="Toce_0454"
FT   CDS_pept        complement(451422..453623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0454"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR003960:IPR005938:IPR003593:IPR003338:IPR
FT                   004201:IPR003959; KEGG: mta:Moth_1594 AAA family ATPase,
FT                   CDC48 subfamily protein; PFAM: AAA ATPase central domain
FT                   protein; AAA ATPase VAT domain protein; cell division
FT                   protein 48 CDC48 domain 2; PRIAM: Adenosinetriphosphatase;
FT                   SMART: AAA ATPase; SPTR: AAA family ATPase, CDC48
FT                   subfamily; TIGRFAM: AAA family ATPase, CDC48 subfamily;
FT                   PFAM: Cell division protein 48 (CDC48), N-terminal domain;
FT                   ATPase family associated with various cellular activities
FT                   (AAA); Cell division protein 48 (CDC48), domain 2; TIGRFAM:
FT                   AAA family ATPase, CDC48 subfamily; 26S proteasome subunit
FT                   P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07231"
FT                   /db_xref="GOA:D9S1F4"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F4"
FT                   /protein_id="ADL07231.1"
FT                   /translation="MRNDDADFTVRSVSPDSIAHGVIWQMSAEKSLQFRVCEAEIQDAR
FT                   KGIVRIPAEALKALELNPNDVVAITGKRTTVARVLPGFPESCPAGCIQMDGIVRQNAAA
FT                   GIGEIVVVTPIECERAKAVVLSPLLPVWQGAEKGSAFLKKSILGRVVIVGDQITISQFS
FT                   GGDEAFMVEGTAPQGAVVITRDTIVRFKGADNTDSSRGGVTYEDIGGLAKEVKKIREIV
FT                   ELPLKYPQLFNRLGIEAPKGILLYGPPGTGKTLIARAIASETEAHFLLVNGPEIMHKYY
FT                   GESEARLRQVFDEAKKKAPSIIFLDEIDAIAPRRTEVYGDVEKRVVAQLLALMDGLEAR
FT                   GNVIVLAATNVPDLIDPALRRPGRFDREILIDVPDQRGRKEILAIHTRGMALAEDVSLE
FT                   YLAAITHGFVGADLAALCREAGMHALQRVLENLPPGFPPPVELDLKVTMRDFISALDEV
FT                   EPSATREFAAELPTARWEDIGGMTAIKERLQALVQWPLTHPELFKQFGLRPPKGILLYG
FT                   PPGTGKTLMVRALAGESGINFIPVNGSLLFSRWRGQAEKILHEVFRKARQASPCLLFFD
FT                   ELDALVPVRRGGEETAGRLVSQFLLEFDALEEMREVVVIGATNRIDLIDPALLRPGRFD
FT                   EVLEFPYPDESDRQAIFGIHLGARPLAADVDLELLALQSEGLTGAEIEAVCRRAAFMAA
FT                   AEFASRSDASKESGAIRRQHLERALEEVRKKRDLIPVKG"
FT   gene            453829..454269
FT                   /locus_tag="Toce_0455"
FT   CDS_pept        453829..454269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0455"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835; KEGG: cce:Ccel_1609 transcriptional regulator,
FT                   MarR family; PFAM: regulatory protein MarR; SMART:
FT                   regulatory protein MarR; SPTR: Transcriptional regulator,
FT                   MarR family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07232"
FT                   /db_xref="GOA:D9S1F5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F5"
FT                   /protein_id="ADL07232.1"
FT                   /translation="MEDRGSHYLRELIRMLVRNLGVLEKSEASCCGTTLSQCHTIVEIG
FT                   RAGEISLNELAELLNLDNSTISRSVNNLVKQGLVVRETDPEDRRYVRIRLTKEGYGVYE
FT                   AVESSMEAYFERIFTTIPEEKREQVLESLQILIDAVRKNKCC"
FT   gene            complement(454327..455955)
FT                   /locus_tag="Toce_0456"
FT   CDS_pept        complement(454327..455955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0456"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /EC_number="1.3.7.8"
FT                   /note="COGs: COG1924 Activator of 2-hydroxyglutaryl-CoA
FT                   dehydratase (HSP70-class ATPase domain); InterPro
FT                   IPR008275:IPR010327:IPR002731; KEGG: tte:TTE1113
FT                   2-hydroxyglutaryl-CoA dehydratase activator; PFAM: ATPase
FT                   BadF/BadG/BcrA/BcrD type; 2-hydroxyglutaryl-CoA dehydratase
FT                   D-component; PRIAM: Benzoyl-CoA reductase; SPTR:
FT                   CoA-substrate-specific enzyme activase; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase, D-component;
FT                   BadF/BadG/BcrA/BcrD ATPase family; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07233"
FT                   /db_xref="GOA:D9S1F6"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F6"
FT                   /protein_id="ADL07233.1"
FT                   /translation="MIGYVCKYTPVEIIEALGEEPVRLDSACKSYERAEALIHSNICSF
FT                   AKGVLENIIENNIEEVVLTSCCDSMRRLYDVLKDRVKFIYMLDLPRKKDSLAVDLFYNE
FT                   ITKFIDVYKEFKNRTFVEENLLKILEGKSSSKKKQPSESIAILGARLKDDVVEKIKNSS
FT                   KANIINYTCTGEERMFNIEAKDNLLKGYAESLLDLTPCMRMAEDRSKLTNKEFKGIIYN
FT                   TIKFCDFYSYEYAELKNKVDIPLLKIETDYTDSNSGQILTRVDAFLESTGIKKVEKKGA
FT                   QKGYFAGIDSGSTSTNAVIIDENKNIISYSIIPTGPRAVESASKAFEIALNNAGLSKKD
FT                   IASIVATGYGRVSIPFADRIVTEITCHGKGAFFIDNAIRTVIDIGGQDSKVIRLDDSGN
FT                   VVDFVMNDKCSAGTGRFLEVMARTLGVPIDEMAKVHKEVKENITITSMCTVFAESEVIS
FT                   LIAQNKDQRDIIYALNKAVASKAVSLVERIGRKGKYMMTGGVAKNWGVVHAIESKLGEK
FT                   LIIPPEPQIIGALGAALISLEGKLG"
FT   gene            complement(455981..457240)
FT                   /locus_tag="Toce_0457"
FT   CDS_pept        complement(455981..457240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0457"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="COGs: COG1775 Benzoyl-CoA
FT                   reductase/2-hydroxyglutaryl-CoA dehydratase subunit
FT                   BcrC/BadD/HgdB; InterPro IPR010327; KEGG: tpd:Teth39_0844
FT                   2-hydroxyglutaryl-CoA dehydratase, D-component; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase D-component; SPTR:
FT                   2-hydroxyglutaryl-CoA dehydratase D-component; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase, D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07234"
FT                   /db_xref="GOA:D9S1F7"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F7"
FT                   /protein_id="ADL07234.1"
FT                   /translation="MTKMDPVRMYSNIIKRNMKKSEKVNKLINFGLTVAYYYVSFFKDK
FT                   RLPKSLQYLNKCCIKNIKDSLENPQNSAWVNLFSPCEFLIAMDIRPLFVEAYSSFMSGF
FT                   FIEDYLIDTAESRGISNTLCSYHKTFIGANELNILKKPGFMITTSMICDANIPTFRYLS
FT                   RKTGVPLYIIDIPYRYSKEAVAYVENQLVEMVKRLEEAYKRRLDIDKLREVVKTENKTR
FT                   ALMNEYLNYAAEKALLTTMTFEMYMLFASHVFIGSREMLNFYEMLIDDIKKAPERRGKS
FT                   IFFVHLLPMFEKNFKDYFNFSDKFHIAGSDINYDFLGEIDENEPFRGIAEKLVLTSFNG
FT                   EINRKVTRIRELIEKTKPDGIIQFCHLGCKQSIGGTFIIKNLASEMGIPFLYLDGDCVD
FT                   KRNNQEGQNRTRLEAFLEML"
FT   gene            complement(457428..457547)
FT                   /locus_tag="Toce_0458"
FT   CDS_pept        complement(457428..457547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Chaperone protein
FT                   dnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07235"
FT                   /db_xref="GOA:D9S1F8"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F8"
FT                   /protein_id="ADL07235.1"
FT                   /translation="MAEVGGGGFGGGFGGGFFKDRQAFLVFLILILLLLGDNF"
FT   gene            457765..458964
FT                   /locus_tag="Toce_0459"
FT   CDS_pept        457765..458964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0459"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR005467:IPR003594:IPR004358; KEGG: cbe:Cbei_4175
FT                   signal transduction histidine kinase regulating
FT                   citrate/malate metabolism; PFAM: ATP-binding region ATPase
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; SPTR: Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07236"
FT                   /db_xref="GOA:D9S1F9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1F9"
FT                   /protein_id="ADL07236.1"
FT                   /translation="MPVVFFAEIYFYPFEGKFKFSAGVIILNLIILAVDNVSKFWIVIL
FT                   SGLAIFAVRTAVLFFQGISFDTALAVNYPSLVYYVIFAFLVKISDVDKRKNYVFGAIML
FT                   LSLVDFSSNLFEAAIRNEISPSGVQLILMVGFLRSILAYFIYQLYERQKLFILSSEHQK
FT                   RYTQLNMLISNIQAEMFYLKKSMKDIENVMRKSYSLYESNELDGKLKEMALDIAKDVHE
FT                   IKKDYYRVVLGFESFIKGLENEDVMKLSDIFTIIRDNIERYLKAKNKEIKIFFNCGSDF
FT                   SVGPYYNMFNLLNNLLTNSIDACKSGDTIAVSVTNLEENVCLEVRDSGEGIEEDILPYI
FT                   FNPGFTTKYDEDTGRPHTGIGLCHVKNIVEELGGSIEVTSKPGVGTKFKILIPKKSLVR
FT                   "
FT   gene            458969..459856
FT                   /locus_tag="Toce_0460"
FT   CDS_pept        458969..459856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0460"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0784 FOG: CheY-like receiver; InterPro
FT                   IPR001789:IPR013972; KEGG: cbe:Cbei_4174 response regulator
FT                   receiver; PFAM: YcbB domain protein; response regulator
FT                   receiver; SMART: response regulator receiver; SPTR:
FT                   Response regulator receiver; PFAM: Response regulator
FT                   receiver domain; YcbB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07237"
FT                   /db_xref="GOA:D9S1G0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G0"
FT                   /protein_id="ADL07237.1"
FT                   /translation="MDKTFMIIDDDVNVRKMLAILIRKNRLGKVLTELDSGKHAAQEIL
FT                   FFNPDIVLIDLLLPAMDGIEVINEARSKGYKGKFIMISQVEDENMVAKAYESGILFFIN
FT                   KPINNIEVVSVIKGVCRIIDLENSLALIKNTVMNYDAENHKIKDTNDKNIETRINKIFS
FT                   DLGIIGVAGSNELLKVIYTVHELKLENPNAEYQLQDIYEKVLEEDDDNIEKLNVKSLEQ
FT                   RVRRTIQKALQTLAELGLSDFDNDIFLEYSTLLFDFKQVRQQMRHIENPKEEPGKINIK
FT                   KFIEGIIAKLRYSQ"
FT   gene            460000..461205
FT                   /locus_tag="Toce_0461"
FT   CDS_pept        460000..461205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0461"
FT                   /product="sodium/glutamate symporter"
FT                   /note="COGs: COG0786 Na+/glutamate symporter; InterPro
FT                   IPR004445; KEGG: cno:NT01CX_2103 sodium/glutamate
FT                   symporter; PFAM: sodium/glutamate symporter; SPTR:
FT                   Sodium/glutamate symporter; TIGRFAM: sodium/glutamate
FT                   symporter; PFAM: Sodium/glutamate symporter; TIGRFAM:
FT                   sodium--glutamate symport carrier (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07238"
FT                   /db_xref="GOA:D9S1G1"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G1"
FT                   /protein_id="ADL07238.1"
FT                   /translation="MTVQLDMLQTTALAVIVLFLGELIRNKAPILKKYCIPSPVIGGLF
FT                   FAVLFLVLKQYNILTITFDTTLQTFFMNMFFTTVGFTASLRLLKKSGIPVLVFLTISIV
FT                   LIFLQNGLGIALAKVFNLNGLLGLATGSIPLVGGIGTSGAFGPLLEKAGAEGATTVAVA
FT                   AATFGMIMGSIIGNPLAKNLIEKHGLMKNHKTAAFEPGLSAELAVSDEVGEVKAENFYP
FT                   AFAQILLAMGIGTIISSFFTKVGFTFPPYIGAMFAAAIIRNLADFTGMYKVPEDEIKVV
FT                   GDISLSIYLAIALMGLKLWQLADLALPLVVMLVAQTILMMLMAYFITFNLMGRDYEAAV
FT                   LTSGFCGFGMGATSNAMANMRALVEQYAPAPRAFFIVPLVGSLFIDFFNGILIVVFMNM
FT                   IK"
FT   gene            complement(461246..462754)
FT                   /locus_tag="Toce_0462"
FT   CDS_pept        complement(461246..462754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0462"
FT                   /product="protein of unknown function DUF92 transmembrane"
FT                   /note="COGs: COG1836 membrane protein; InterPro
FT                   IPR000374:IPR002794; KEGG: hmo:HM1_2282 hypothetical
FT                   protein; PFAM: protein of unknown function DUF92
FT                   transmembrane; phosphatidate cytidylyltransferase; SPTR:
FT                   Putative uncharacterized protein; PFAM:
FT                   Cytidylyltransferase family; Integral membrane protein
FT                   DUF92; TIGRFAM: conserved hypothetical protein TIGR00297"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07239"
FT                   /db_xref="GOA:D9S1G2"
FT                   /db_xref="InterPro:IPR002794"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G2"
FT                   /protein_id="ADL07239.1"
FT                   /translation="MKDFIGVVISILFVFGVIIISEVLRKAGGSSAEVTRKFVHIGVSH
FT                   WWPLAMFLIDDIRYALIPPALFVAVNYYSHKKNVFKGMERKGASSDLGTVYFPVSLIVL
FT                   ILLTWDGGLLGRGFEYLGLAGVLAMGYGDGLAAIVGWKFGKSKYRAFKSEKSLEGSVTM
FT                   LAFSFIAIAVALGSFLGFTPHVLRVSFVAALIATISEALSPSGTDNLTVPVVTSLASNY
FT                   FLYILKNSNLFLFIYMAGIGFVLSFFIAYAAYRKNSLTLDGSVGATILGTMMYATSGIF
FT                   GSFLMVLFFISSSLLSYFKKSAKSRATQSFDKTGCRDVFQVLANGGVGLLYSVLYYITK
FT                   NPSYLVLLAVSFAAANADTWATELGILSKARPISLRTFRRVEKGTSGAVSLSGTLAALM
FT                   GALLIGISAAAGFKLMDFGDLAFTPVQSLLMVTLGGFLGSLIDSILGATLQGVYYSEEL
FT                   EGETEKRFTNGKPNRLVRGLGFVNNDLVNFLSIGLSSALFAGII"
FT   gene            462907..464118
FT                   /locus_tag="Toce_0463"
FT   CDS_pept        462907..464118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0463"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair; InterPro IPR017963:IPR001126; KEGG:
FT                   mta:Moth_1229 DNA-directed DNA polymerase; PFAM: UMUC
FT                   domain protein DNA-repair protein; PRIAM: DNA-directed DNA
FT                   polymerase; SPTR: DNA-directed DNA polymerase; PFAM:
FT                   impB/mucB/samB family C-terminal; impB/mucB/samB family;
FT                   IMS family HHH motif"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07240"
FT                   /db_xref="GOA:D9S1G3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G3"
FT                   /protein_id="ADL07240.1"
FT                   /translation="MLSILHVDMNAFYASCHQALDPSLKGKPVIVAGDPKKRNGIVLTA
FT                   SYEARKFGVKTAMPNWQARKLCPHAVFIKPDYRLYVATSHRVLEILQRFSPVVEVFSID
FT                   EAWLDVTGCEGLFGDAVTIAEKIQRTVIEELSLPCSVGVSCNKLLAKMASDMKKPMGIT
FT                   VITPEDVPDVIWPLPVDELFGVGPRLAERLKKMNINTIGDLAAVPVEMLEAAFGLVGRH
FT                   IHLFANGIDDSPVDPHSMDDARSMGHSITLPRDVETWDEAEAVLLSLAEQVGRRVRRGN
FT                   YVGRVVTVTLRDSSFSTITRSTTIPHTSATEDIYAAAKRLLRSNWDGRTPLRLLGVSLS
FT                   GLIREFDQISVFEADEKKKRLNRVIDEIRERFGDNAIFRAKLKSRDLIGQKGSPAIGPF
FT                   ARRN"
FT   gene            464189..464971
FT                   /locus_tag="Toce_0464"
FT   CDS_pept        464189..464971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0464"
FT                   /product="protein of unknown function DUF72"
FT                   /note="COGs: COG1801 conserved hypothetical protein;
FT                   InterPro IPR002763; KEGG: mta:Moth_0268 hypothetical
FT                   protein; PFAM: protein of unknown function DUF72; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07241"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G4"
FT                   /protein_id="ADL07241.1"
FT                   /translation="MILVATSGYAYKDWKGRFYPENMKDGDMLAFYSREFPFTEVNSSY
FT                   YSMPTPYMFYHMMKKTPGNFIFVVKAYGGMTHQRDLGDITVGRFHDALKPLVEAGRLGC
FT                   VLAQFPYSFHNNEKNRDYLKKLRERMKDLPLAVEFRSDDWLRLEVIRLLRENDMAFVCV
FT                   DEPPIRGLLPPVVVATSSIGYVRFHGRNIRKWYNHEKSYERYDYLYTEMELSEWVPRIR
FT                   ELSRKTKVVFIAMNNHFNASAVINARQLLGLLKEAGNI"
FT   gene            complement(465027..465479)
FT                   /locus_tag="Toce_0465"
FT   CDS_pept        complement(465027..465479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0465"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="COGs: COG0782 Transcription elongation factor;
FT                   InterPro IPR018151:IPR001437; KEGG: pth:PTH_0541
FT                   hypothetical protein; PFAM: transcription elongation factor
FT                   GreA/GreB domain protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Transcription elongation factor, GreA/GreB,
FT                   C-term"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07242"
FT                   /db_xref="GOA:D9S1G5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G5"
FT                   /protein_id="ADL07242.1"
FT                   /translation="MQRTYTLSKTAFEALIKHLADLEAGKSRLIDEHFSNSPREARELE
FT                   HLLDNYIKFMDEFISSVQQEDTADESFPYVVINSRVQVQDIENDETYNFRVVLPSGNIA
FT                   SDPEIYSVSVLSPVGKSLLLKKPGEKVQVNAPGGMFLYEIKAIYFP"
FT   gene            complement(465633..466607)
FT                   /locus_tag="Toce_0466"
FT   CDS_pept        complement(465633..466607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0466"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COGs: COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp protein; InterPro IPR011761:IPR011095; KEGG:
FT                   tpd:Teth39_2176 D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; PRIAM:
FT                   D-alanine--D-alanine ligase; SPTR: D-alanine--D-alanine
FT                   ligase; PFAM: D-ala D-ala ligase C-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07243"
FT                   /db_xref="GOA:D9S1G6"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G6"
FT                   /protein_id="ADL07243.1"
FT                   /translation="MKVGVFWRKFRNVELQLKLSGENIYDDAYEEAYQHFSAIKEAGFD
FT                   AVMIEWKKDNPQETLRKVLEEKVDLVFNASSLEEVAFLEAFGIPFAGSGLDLVATDKAT
FT                   RKKIVAYHKLPTPRFIVVEDPNEIPDHDLKYPLFVKPVRGRGSAGISEENIIERHEDLA
FT                   RVVSKITDKIGQPALVEEFIRGREITVGIIGYKNPRVLPPVEIEYNSTRTNTFEHKMFD
FT                   NEIIHCPARLSPEEEEKVKSTALSIYKVLNAKDFSRIDMILGDDGIPYFLEINTFAGLT
FT                   MSKDGTHHGYMGYMAKTAGMTRADFIGSIVRSALERYRICHKL"
FT   gene            466863..467849
FT                   /locus_tag="Toce_0467"
FT   CDS_pept        466863..467849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0467"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="COGs: COG2423 ornithine cyclodeaminase mu-crystallin
FT                   homolog; InterPro IPR003462; KEGG: cbl:CLK_1960 ornithine
FT                   cyclodeaminase; PFAM: ornithine
FT                   cyclodeaminase/mu-crystallin; PRIAM: Ornithine
FT                   cyclodeaminase; SPTR: Ornithine cyclodeaminase; PFAM:
FT                   Ornithine cyclodeaminase/mu-crystallin family; TIGRFAM:
FT                   alanine dehydrogenase, Archaeoglobus fulgidus type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07244"
FT                   /db_xref="GOA:D9S1G7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G7"
FT                   /protein_id="ADL07244.1"
FT                   /translation="MLILTKSDVEKALSMEEAINAMEEAFAAYSTGRTIVPLRTVIHIG
FT                   GAEGDALFMPGYVEGIGVAVKLVSVFPGNARFGKPTISSVVVLEDRETGEPVALMDGAY
FT                   LTALRTGAASGAASKHLARKDSKVAAVIGAGVQGKTQLWAVCCVRNIEEARIYNRDPKK
FT                   VGQYIAEMKTKLSGVRFVECQSADEAVRGADIIIAATTSETPVFSASSVKKGAHINAIG
FT                   SYTPKMQEIPTELLKMASKIVVDSREAVLSEAGDFIIPISSGDFSPENIYGELGEITSG
FT                   RLRGRESDDEITLFKSVGIAVQDVACAARIYEKAVKMGLGIKIDLSN"
FT   gene            467871..469514
FT                   /locus_tag="Toce_0468"
FT   CDS_pept        467871..469514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0468"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR004010; KEGG: mta:Moth_2029
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; Cache domain protein; SMART:
FT                   chemotaxis sensory transducer; SPTR: Methyl-accepting
FT                   chemotaxis sensory transducer; PFAM: Cache domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07245"
FT                   /db_xref="GOA:D9S1G8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G8"
FT                   /protein_id="ADL07245.1"
FT                   /translation="MKKKVILKLVLPISLLPAILLLAAYLAAGISLRVHLVPILAVTGL
FT                   VLFINYFVINSAFIKLRILAEVISEFSRGEIPSFEKLHRNGGLFDFLVEPVLKAFEHVF
FT                   TLMGRMQRTAEEIKYFSGKFEDSMDQISHAAHQISASIEEIALGAGEQAEAAQETSNNI
FT                   NTLSALAEKIAGEAREGEEGIKAMVERVRETRGVLEGLISNLSLSSQTSSLSASKMRDL
FT                   ENLTTMINGFVKVITDIADQTNLLALNAAIEAARAGEQGRGFAVVAGEVRKLAEQSAKA
FT                   AEEIKELSERIQKEARETALQVEKNLEVVNENIEKGNESMTAFDDIVSAIKSFEVSIER
FT                   INRMAGEQVEKVVKVSEAAEKMAAVSEETAAGVQEIAASSQEQKNLLGAISEETGRLST
FT                   MSSELMEISEAYTRNYRIPESARVKLSAIKQQLSLLAGKDFVVNRDVEVLKREFEKVKR
FT                   ETPEILELITLDEKGDIIYVTSDIPVKNLAFRPWFQEAVRGNEFISKPYIDISANRMTV
FT                   TISVPVRNEEGSVVGVIGADVNLNKTLNLL"
FT   sig_peptide     467871..467954
FT                   /locus_tag="Toce_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(469564..471573)
FT                   /locus_tag="Toce_0469"
FT   CDS_pept        complement(469564..471573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0469"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR003660:IPR004010; KEGG: mta:Moth_1487
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; Cache domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SPTR: Methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: Cache domain; HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07246"
FT                   /db_xref="GOA:D9S1G9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1G9"
FT                   /protein_id="ADL07246.1"
FT                   /translation="MKKLKGIKISGGIRTRLTVLFLLISLVPLIVLSFFNYSTSKNNLT
FT                   HAADRELLGKAVSAASVIDLWVSERMEILETLAENPVIKSGNLESLIPILKTVQPAAPD
FT                   VQLLWYATPDGKVYSYLNDDITKPITDINDRQYFKEIMSTGKTTVSELVIDKVTGDKIL
FT                   VIVAPVKGQGGITGIVGADVNANALINIINSVKYGTTGYAFLVDKMGTTIAHPDEKMVM
FT                   NMNITKTESESLNRVGERMIKGEEATVRYEYSGEYKLAAFSPVKNTGWSLCVTASSDEV
FT                   YAGLKSFFWSTITLILVVTVIVIAAAVVFSRQLSSPILKLTAVADTLATGDLRVEVPEG
FT                   FFGELGTLGSSLKKMLENTKTVLGFMGTAIANLEKAIREISQGAQDTAQAAEQVAETVS
FT                   QISAGAQDMAQNTGNISAAVEDTTTMMQALVENLESITQNTMDTVKRTEQGEKIMKELS
FT                   QKLELTTTKAENIKSAMTSLIEQAKEIAGITDVITGIAEQTNLLALNAAIEAARAGEAG
FT                   RGFAVVAEEIRKLAEQSSQQASQITKIVKQVTENINLSNTATEEAVVLIEEQAIIGGET
FT                   MNHFAEISAGARRVADLLSDIEKKARSVSEHSRKISEEVSNAAAISEENAASSQEIAAS
FT                   AQEMSSAAQTISASTTELINLVEKLKEASAKFIL"
FT   sig_peptide     complement(471454..471573)
FT                   /locus_tag="Toce_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(471551..472027)
FT                   /locus_tag="Toce_0470"
FT   CDS_pept        complement(471551..472027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0470"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: tte:TTE0700 chemotaxis
FT                   signal transduction protein; PFAM: CheW domain protein;
FT                   SMART: CheW domain protein; SPTR: Chemotaxis signal
FT                   transduction protein; PFAM: CheW-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07247"
FT                   /db_xref="GOA:D9S1H0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H0"
FT                   /protein_id="ADL07247.1"
FT                   /translation="MRQVVVFGLGKELYGIDIFDLQEIIRMMEITHIPRAPHFIEGVIN
FT                   LRGRIIPVIDLKKRFGLADGEITRDSRIIVVNIDETTAGLIVDYVTEVAALEEEDLEKP
FT                   PEALTIDARFIHGLAKMGDNIVILIKTSEILNVAEKDQLKNFSKEDTYEKAEGN"
FT   gene            472500..472904
FT                   /locus_tag="Toce_0471"
FT   CDS_pept        472500..472904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0471"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR016131:IPR012827:IPR012312; KEGG: ate:Athe_0453
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein; SPTR: Hemerythrin-like
FT                   metal-binding protein; TIGRFAM: hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain; TIGRFAM: hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07248"
FT                   /db_xref="GOA:D9S1H1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H1"
FT                   /protein_id="ADL07248.1"
FT                   /translation="MAVMWTEDLSTGVSLIDEQHKELFKRVNDLLLACSKGKGREEAVK
FT                   AIDFLGEYIVMHFGAEEKYMRENDFPGYQAHKKQHDGFVAEFKEIKQRMEQNGPTVDLV
FT                   VKINHFLIDWLINHIKKTDKALGAFLKNKI"
FT   gene            473072..474145
FT                   /locus_tag="Toce_0472"
FT   CDS_pept        473072..474145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0472"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="COGs: COG2201 Chemotaxis response regulator
FT                   containing a CheY-like receiver domain and a methylesterase
FT                   domain; InterPro IPR001789:IPR000673:IPR008248; KEGG:
FT                   ate:Athe_2235 response regulator receiver modulated CheB
FT                   methylesterase; PFAM: CheB methylesterase; response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver modulated CheB
FT                   methylesterase; PFAM: CheB methylesterase; Response
FT                   regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07249"
FT                   /db_xref="GOA:D9S1H2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H2"
FT                   /protein_id="ADL07249.1"
FT                   /translation="MGRGEIHEVFVVIRVLVADDSALMRLIIKDLLEKDPEIKVVDTAG
FT                   NGREAVEKAERLKPDVITLDVNMPEMDGLSALKKIREKKLGNVLMLSSLTREGASVTIK
FT                   ALELGAFDFVAKPGGSISPDIKEFADEIIAKVKAGYNARDIRERPVNPPAPGIHFTSEM
FT                   KAVVIGISTGGPRNIMHVLPFIPPDINAAIFLVQHMPPGFTGPLARRLDERCALKVVEA
FT                   EDGMEVKPGTCYVGKGGYNMLLSSERNGFRLVVTDTPKYRFMPSADVTMDSVLTIFREN
FT                   TIGVLMTGMGDDGAGAMVRIRKAGGRTIAESKETAVIFGMPRAAIERGGAEFILPSYEI
FT                   PAKITELTGVRRLNAKE"
FT   gene            474132..475574
FT                   /locus_tag="Toce_0473"
FT   CDS_pept        474132..475574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0473"
FT                   /product="diguanylate cyclase and metal dependent
FT                   phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro
FT                   IPR000160:IPR006674; KEGG: nth:Nther_2110 diguanylate
FT                   cyclase and metal dependent phosphohydrolase; PFAM: GGDEF
FT                   domain containing protein; metal-dependent phosphohydrolase
FT                   HD sub domain; SMART: GGDEF domain containing protein;
FT                   SPTR: Diguanylate cyclase and metal dependent
FT                   phosphohydrolase; TIGRFAM: diguanylate cyclase; PFAM: HD
FT                   domain; GGDEF domain; TIGRFAM: PAS domain S-box;
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07250"
FT                   /db_xref="GOA:D9S1H3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H3"
FT                   /protein_id="ADL07250.1"
FT                   /translation="MQKSDGVTVDFLKTLLDSINVNLCVIGESGEILLVNKRWEEFALK
FT                   NGIDNVGTVGPGVNYLEVLENAVRNEHTDSEVARAAREGIREVLEGKSEGFYLEYPCRS
FT                   ESEDRWYLMVVSRIDWDPVAAAICHINITETKRKQVQLRLNIYDELTGLYNRWMFRKEL
FT                   KKLRRTDELPAAVIVYDLDGLKLITDVLGSEAGDKLLKAFADILKSSCREKDVVARIGG
FT                   DEFGIIMRGCDEKIVDSFIKRIMAKIENFNSKNEDLHLSASFGYSVKHHGFQDIYKVFN
FT                   EARCNMYTNKLLKRRSAKNAIARIITRKLQERNRAREERIERLIRLAEAFGKKLDLPPE
FT                   DMEKFLLLCRYHDVGEISLPPNLVKKGRMTWEEREILQKHCVAGYRIAISVPSISGIAD
FT                   LILSHHEHYDGSGYPFKLRGKEIPFLSRVFAIIDAYEAVVGQRPYRKPLSHEEAVEELK
FT                   RCAGTQFDPDLVKLFTEMGPVI"
FT   gene            complement(475591..476184)
FT                   /locus_tag="Toce_0474"
FT   CDS_pept        complement(475591..476184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_0695 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07251"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H4"
FT                   /protein_id="ADL07251.1"
FT                   /translation="MKDTEVLIKAGIAAVVPVYEAGAGNVTLVITSDGKEHLIGNTTRT
FT                   VIRRIARAYGVDLAAVRENYGRAVNRRNYVPVPLSPSLILIPVKFRERPLGENDGTVGY
FT                   LSYYEIRDIEENGSFCRVLLACGKWLRVLLGKATLLEYMKDARLIAGIYEEKHRVAAKA
FT                   EQVREPEPACLQESGKLREELINLLVRLLSKSGG"
FT   gene            complement(476261..476770)
FT                   /locus_tag="Toce_0475"
FT   CDS_pept        complement(476261..476770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0475"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="InterPro IPR002502; KEGG: dau:Daud_1669
FT                   N-acetylmuramoyl-L-alanine amidase; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SPTR:
FT                   N-acetylmuramoyl-L-alanine amidase, family 2; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07252"
FT                   /db_xref="GOA:D9S1H5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H5"
FT                   /protein_id="ADL07252.1"
FT                   /translation="MERFYPRFIVIHHTAGHDVSALQINRIHAARGFGVKITEPLSLVE
FT                   EYRERGFPCCNGGVVISIGYHYLIRADGSVEKGRPDFAPGAHCTASGMNMRSIGIALTG
FT                   NFSSRDNPSGKKGHPEPTAAQLKALKKLVSFLMDVYSIPPSGVLGHSKVPGARTECPGD
FT                   RFVFSF"
FT   gene            complement(476793..476954)
FT                   /locus_tag="Toce_0476"
FT   CDS_pept        complement(476793..476954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0721 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07253"
FT                   /db_xref="GOA:D9S1H6"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H6"
FT                   /protein_id="ADL07253.1"
FT                   /translation="MEDFMAQVANVGFPIAVSVYLLVRIEAKMESLTASIHELAMVIEG
FT                   LKNPSRSA"
FT   gene            complement(477010..477231)
FT                   /locus_tag="Toce_0477"
FT   CDS_pept        complement(477010..477231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1792 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2922)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07254"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H7"
FT                   /protein_id="ADL07254.1"
FT                   /translation="MAQILEMSFQNESGRTTRIQIPDPKENLTPQEIQPVMDLVVSRNL
FT                   FATSGGDIVKALGARILIRDAVEIIPGE"
FT   gene            complement(477271..477495)
FT                   /locus_tag="Toce_0478"
FT   CDS_pept        complement(477271..477495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0478"
FT                   /product="protein of unknown function DUF1659"
FT                   /note="InterPro IPR012454; KEGG: mta:Moth_1793 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1659; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1659)"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07255"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H8"
FT                   /protein_id="ADL07255.1"
FT                   /translation="MAVIATPVEATLQIVVQTGTGDNGRPITRTRSFRNLKTSAPDADV
FT                   MEVAKALAGLQNYPVDSFRKVVEIELTEQ"
FT   gene            477831..478994
FT                   /locus_tag="Toce_0479"
FT   CDS_pept        477831..478994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0479"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="COGs: COG0585 conserved hypothetical protein;
FT                   InterPro IPR011760:IPR020119:IPR001656; KEGG: csc:Csac_1232
FT                   tRNA pseudouridine synthase D, TruD; PFAM: tRNA
FT                   pseudouridine synthase D TruD; SPTR: tRNA pseudouridine
FT                   synthase D, TruD; PFAM: tRNA pseudouridine synthase D
FT                   (TruD); TIGRFAM: conserved hypothetical protein TIGR00094"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07256"
FT                   /db_xref="GOA:D9S1H9"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1H9"
FT                   /protein_id="ADL07256.1"
FT                   /translation="MKIKVIPEDFIVKELADIKYAPDGPYRIYLLEKRHWNTMDALKFI
FT                   SRENKVPLSKIGSGGRKDRHALTYQYISVPREYELHFEKPNVRLQFVGFADDFVSPAVL
FT                   EGNYFEITLRRINPGSVDGIKSRLSEVEEFGYPNFFDDQRFGSVEDPGEFIAERIIKKH
FT                   YNGALKLYFTTVHPEDKREEKARKRKIAELWGRWEDILPLCRTPVEKDIIKILLEGQSK
FT                   KHLAAALNAIPKEELSMFFSAYQSFLWNRTLEKLLPLFAGELFTVKGKIMDYTFYRTLP
FT                   PGKLKALKKLEIPTVSSRIPEAAPEVKKALDEVLTERGVKPSDFNLKKIRKSFFKSFMR
FT                   PAIVFPQDLYLGPFEEDGLYAGYRKVTIKFTLPPGSFATMLIKSLGI"
FT   gene            479066..479977
FT                   /locus_tag="Toce_0480"
FT   CDS_pept        479066..479977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0480"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005771:IPR005835; KEGG: tte:TTE0732 UDP-glucose
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase; SPTR:
FT                   UTP-glucose-1-phosphate uridylyltransferase; TIGRFAM:
FT                   UTP-glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; UbiD family decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07257"
FT                   /db_xref="GOA:D9S1I0"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I0"
FT                   /protein_id="ADL07257.1"
FT                   /translation="MKIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAV
FT                   ASGIEEILIITGRNKRAIEDHFDKSVELELELKKKGKGELLRVVEEISNMVDIHYVRQK
FT                   EPRGLGHAIYCARTFVGDEPFAVMLGDDVMCSKEPVLKQMMDIYERYNCSILGVQQVPE
FT                   DDVSKYGIIDGAFIEDRIYKVNNMIEKPKKQEAPSRMAIMGRYIITPRIFEILEHTKPG
FT                   AGGEIQLTDALKELLNYEVIYAYTFEGKRYDVGDKLGYLVATVEFALKREELRDEFRKY
FT                   LLGLLAEDQAGYCEAAAGKNSD"
FT   sig_peptide     479066..479134
FT                   /locus_tag="Toce_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            480158..484117
FT                   /pseudo
FT                   /locus_tag="Toce_0481"
FT   gene            complement(480390..481121)
FT                   /locus_tag="Toce_0482"
FT   CDS_pept        complement(480390..481121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0482"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="COGs: COG1484 DNA replication protein; InterPro
FT                   IPR003593:IPR002611; KEGG: cth:Cthe_1996 IstB-like
FT                   ATP-binding protein; PFAM: IstB domain protein ATP-binding
FT                   protein; SMART: AAA ATPase; SPTR: IstB-like ATP-binding
FT                   protein; PFAM: IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07258"
FT                   /db_xref="GOA:D9RYE5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D9RYE5"
FT                   /protein_id="ADL07258.1"
FT                   /translation="MLKDEIAACCKALKLSRNLVENCDKIEAQSHEEYLLKLLRLELEH
FT                   RDASRKDRLLKNAGFYTIKTFAGYIFDEIKLPQGLTPQDLKDCKFLEEKKNLILYGNVG
FT                   TGKTHLATAIGVEACKKGYNVKFFRTAALVNRLVEARKGGELSGLLKQLSKPDLLICDE
FT                   WGYVPLDREGAQLLFQVISDCYERRSVVITTNLEFSRWASIFYDEQMTAAMIDRLIHHS
FT                   YLLIFDGQSYRMRQSLMRQLS"
FT   gene            complement(481115..482638)
FT                   /locus_tag="Toce_0483"
FT   CDS_pept        complement(481115..482638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0483"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG4584 Transposase and inactivated
FT                   derivatives; InterPro IPR017894:IPR001584; KEGG:
FT                   cth:Cthe_1995 hypothetical protein; PFAM: Integrase
FT                   catalytic region; SPTR: Putative uncharacterized protein;
FT                   PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07259"
FT                   /db_xref="GOA:D9RXT9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:D9RXT9"
FT                   /protein_id="ADL07259.1"
FT                   /translation="MLTMTHIDNIRKAFFMKGQNISEIAREFQKDRKTIRKYIYQEDWN
FT                   TRVKVEEVKHTFPKLDPFKADIDQWLEEDKKARKKQRHTAKRIYDRLCEKYQDKFNCSY
FT                   RTVAGYVAMRKKELYQDNSCRLPLEHIPGEAQVDFGEADFYENGTLHHGFYLNLSFPYS
FT                   NVGYTQLFKGENQECLFQGLKDIFEHLGGVPRKLWFDNASTIVKLSKNGERKLTDAFLR
FT                   FKQHYGFEAVFCNPASGHEKGNVENKVGYHRRNFLVPVPRFEKLEDFNRELLRLCDRDM
FT                   HREHYRKEASIAELFNEDRKALLELPTVPYEVAGYITVKTNAYAKFSLNGGKHLYSTAP
FT                   KYANSRVLVKITAHEVIPLDESHREIVRHRRLYGDNKQESMDWLPYLTQLSRCPGALKY
FT                   SGIYSMLPDPLREYLDGLSKSERGKALKALAVLCTKSSFEQAVNAVAEALLYGVQDLDS
FT                   LVAIHNRITGITPQLEPVKIPEGVPELTAFRFNAEDYDKAFLKGGANLC"
FT   gene            complement(484169..484579)
FT                   /locus_tag="Toce_0484"
FT   CDS_pept        complement(484169..484579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gla:GL50803_8610 Coiled-coil protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07260"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I3"
FT                   /protein_id="ADL07260.1"
FT                   /translation="MTREELKKVLEEIETLKGLIRKELGDEAFEERSVSSGASTLKNTL
FT                   RRSIKSGEFKSTLLKISGSLDFTKSAIGSISQIVEKAREKINGESEKASDLSQIAAMGS
FT                   AWFPMFLSLMQAPEFQNLTASMLANMLKDEAS"
FT   gene            484683..485843
FT                   /locus_tag="Toce_0485"
FT   CDS_pept        484683..485843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0485"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR000209; KEGG: mta:Moth_2027 aerolysin; PFAM:
FT                   peptidase S8 and S53 subtilisin kexin sedolisin; SPTR:
FT                   Aerolysin. Serine peptidase. MEROPS family S08A; PFAM:
FT                   Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07261"
FT                   /db_xref="GOA:D9S1I4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I4"
FT                   /protein_id="ADL07261.1"
FT                   /translation="MVPYILLYYSLLLGVAGAVQKKKSRKRYKIVGFKPGVQVMETSNI
FT                   LESYGIKIKKQLPLIDACLCEVSPSAVSLQKLSEDPMIDFIEDDYVATIQGVPTGLVLG
FT                   RSKGQEIPWGVKKVAAQSAWSTCRGESVRVGIIDTGIDLYHPDLKDNIKDACGILDCKN
FT                   ILDDNGHGTHVAGTIAALDNDIGVVGVAPKVEIYAVKAFDRYGRGNISNIVEALNWCLE
FT                   KKVHVVNMSFGVKNRSFALRRAIEKLYKNNIVLVAAAGNTGKEDSVLYPAKYPEVIGVA
FT                   ALNMHDRPASFSSSGPEVDIIAPGVDIPSTYKNGGYKLMSGTSMATPHVTGAAALLLSL
FT                   TRMSPQEVKSFLMDTARDLGLPKEKQGAGLLDVSSAVSNIKKLGRL"
FT   gene            485847..486182
FT                   /locus_tag="Toce_0486"
FT   CDS_pept        485847..486182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_2028 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07262"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I5"
FT                   /protein_id="ADL07262.1"
FT                   /translation="MSKFEEIRKEIEKSGKTPESLGQIFSKFGLTPDNPEFAKELLREA
FT                   GLDVDLTPEKAAETVKKMTEKIPPELKKQMAELMLEVSKYIPAGPMPEDVKNFLLSWKG
FT                   EEKDKET"
FT   gene            486524..489481
FT                   /locus_tag="Toce_0487"
FT   CDS_pept        486524..489481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0487"
FT                   /product="O-antigen polymerase"
FT                   /note="InterPro IPR019734:IPR013026:IPR007016; KEGG:
FT                   tte:TTE0644 TPR repeat-containing protein; PFAM: O-antigen
FT                   polymerase; SPTR: TPR-repeat-containing proteins; PFAM:
FT                   O-Antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07263"
FT                   /db_xref="GOA:D9S1I6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I6"
FT                   /protein_id="ADL07263.1"
FT                   /translation="MGRKKSGISATKHDISREKLTNERNTLYYLIFAGLLILLFYPPYF
FT                   RGLFFDREILPTHIYSGIVFLAWVIYRSTNLKETRFFRSSIDYAALAVVGAYFLSIFAA
FT                   VNLRYAVGELLKYINYFIVYYLVSDIARSEGDKKIILWTMVISAAGVALAGIGAAAGTI
FT                   NYPGAFVGGRINSTLQYPNTLAAYLTAALILGLGLQVTSERRWEMTILAAVNYTLFLAF
FT                   IFALSRAAWLMFPVFYLILIISIPGLYKMKVIGYSLQTFAAGIFASPGFDSSISGGETS
FT                   KVWFWYLVGLIFAIAVFYIFEKLSERFTVRIKPVTLLSVFVILTIITGVGVYIAFTTEK
FT                   PLTLAHGPKEPESWKTSLHTVSNVKPDTEYVLKVIVTARPGQEQDKWGGAVLIKSVDKN
FT                   NKETDIKSEFFNKALDHQLVEIPFKTRTDTTKLRIGFANNFPGTSVTFSNAEIFEANDR
FT                   AAGQRIILAYKYIPEAVAQRLSSISFGEFSFQGRLSFYRDALKIIKEHPVLGIGGGGWK
FT                   SAYFAYQSYRYFTTEVHSFFLQLMVETGIIGLLTFLAVLVLIIRNMIISNINKVDDQKH
FT                   SALNTAALSSAVAILGHSAVDFNMSLPAVAIYLWALLGIAATIDGGATIPVAKRGQPAS
FT                   KFYATWVVCGITLLFILGSWTLYTGYSYGQKAVRAIQSGDIAGAKEAFEKASKYDPFAA
FT                   SFKADLSQIYDIIGEQGKNKEFKDKALKLREEAAAMEPYNAKLKSLLAATYLREGRLEE
FT                   GLSLLEEAAKLNPYNISVWEALAEGYEKAAEVYIVKNEVDRAKELLGKCLDIPSKIIEL
FT                   NRKSPQSDPGVVKLVATKDLMLYLKKAAMLFEIPNSDTVKKLKDLVFAADFSIDLNEDG
FT                   QPDLWTIWGEGEIKINPGENARVIPAGESAVTLYLSEGINLEPNQPYIVELKADVLEGG
FT                   YKIDIVADNKEVFSLTADKGEFVAPDDIEGKDTRIRIFVNPKSDIYLGEFLLYKK"
FT   gene            489569..490345
FT                   /locus_tag="Toce_0488"
FT   CDS_pept        489569..490345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0488"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR000412:IPR013525:IPR013526; KEGG: adg:Adeg_0506 ABC-2
FT                   type transporter; PFAM: ABC-2 type transporter; SPTR: ABC-2
FT                   type transporter; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07264"
FT                   /db_xref="GOA:D9S1I7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I7"
FT                   /protein_id="ADL07264.1"
FT                   /translation="MWERLKEIYAYREMLKNLVSKELRARYKGSILGFFWTFFNPLLML
FT                   IVYSFVFSFIMRSAIEKYTMFLFVALLPWNYLSGSIIQGAASLVANASLIKKVYFPREL
FT                   LPLSVVLSNLVNYLLSLLILIPALLLFKIRLTWALLAFPLVLLVETILVASLTLLVSVG
FT                   NVYFRDLEHITGVFMTVWFFLTPVVYSTEMAPPNAKKFFALNPAAHIVEAYRDIFYKGI
FT                   WPDWNALLYVGLSCLILFCISLLAFQRWQQAVAEEI"
FT   gene            490371..491132
FT                   /locus_tag="Toce_0489"
FT   CDS_pept        490371..491132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0489"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003439:IPR003593; KEGG: ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07265"
FT                   /db_xref="GOA:D9S1I8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I8"
FT                   /protein_id="ADL07265.1"
FT                   /translation="MAKEVSKEVAIEIKDVWKKFRIYHEKTYSLKERIIFWGRNKGEDF
FT                   WALKGINLTIPKGSTVGLLGRNGSGKSTLLKIISRILYPTRGEVKINGRVSTLLELGAG
FT                   FHPEFTGRENIFLNASILGLTRKEIKERLDDIIAFAELGDFIDNPVRNYSSGMYTRLGF
FT                   AVAVHVDPEILLIDEVLAVGDLAFQEKCLTRIRELQKRGTTIILVSHSPKQIEDLCDNA
FT                   VWLDKGEVKMQGPVREVTKAYSEFMKAVEGL"
FT   gene            491166..492809
FT                   /locus_tag="Toce_0490"
FT   CDS_pept        491166..492809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00013151001 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Polysaccharide pyruvyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07266"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1I9"
FT                   /protein_id="ADL07266.1"
FT                   /translation="MIFFYTLPETNRKINSEDASQIVILAGGFNGYGRNFGDLLQLRGT
FT                   LRWYKQHWPDAVLCPLLHLRTTSDAETLRELIDFFETPHWLFYTHHSEEDTSSRGAAFG
FT                   LEPLKVSDRLIPIILHVYGGGFFNGFWGRWMIDLIEAVLQTFPISRYIISGQQLGAEFV
FT                   PVLAEHCRRYRPDLVGCRDPESVKILTQSGIDAFFSGDDAFEELLRYAEIPAKDNNALL
FT                   LNLSFGLHLNLSNYVYSSPIQEQQNQSLDQVILQQLQDLFQLLTTQFDPLSFPILVGSY
FT                   LDSRQEVQDTWAALKRTLLTRYFPQFIGLDITGLLLQGRLEDVVPLLRSVKLFVANSYH
FT                   TALFLKILGVPTYLLAFNDYYTQKQSGIQSTIHSFEEFLTEDLETLRKEQEAILSAHQK
FT                   ARQEWMGLLEHELKEMPEKRGAVLRVTTYLQEDRNRLLAKVNEQEYIISRLESENVALR
FT                   EQLESLHRQNSVLSGELDNLYKQNAVLGDEVAKLRQDNTALAAQLGIIVRSRSWRLVQK
FT                   YWRLMDRPFWRLLLTPIRKVGIWIWGIGKR"
FT   gene            492806..495055
FT                   /locus_tag="Toce_0491"
FT   CDS_pept        492806..495055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0491"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296:IPR001173; KEGG: rca:Rcas_3648 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 2; glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase family 2; PFAM: Starch synthase catalytic
FT                   domain; Glycosyl transferases group 1; Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07267"
FT                   /db_xref="GOA:D9S1J0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J0"
FT                   /protein_id="ADL07267.1"
FT                   /translation="MKIWLLTTEYPPFFGGGIATYCFHTAHMFASFGHEVSVFVADSNL
FT                   EKSISIETIENIRVIKFRPGLIETYKYLGYVAALSFQFSEIVEEFIKQEGAPDVLECQD
FT                   YLGIAYFLLQKKKVLWDKLTDLPIVLTLHTPKFLCDIHDQAPVYRFPDYWIGEMERFCI
FT                   RAADAVISPSRYLIDELSKYIDLTKLKTYIIPNPYETSNDKSLISWQESDREDLIFLGR
FT                   LQYLKGILHLFRYFRELWDNGVNIRLKLVGGDTFFYPKSQTMSSYLQKKYRRYFEDGLV
FT                   TWEGKKDPETLMQMLRKVRIGIVPSLIESFSYTVVELLSQGVMVIASDSGGHREIIEDG
FT                   KSGFIFSHQNPESFKSKLLKAMELSPEKMEEMAENARKRLYELCSYEAVYNKKIKVLEE
FT                   LTHTKNCSRIFPFIRESQVEPQDKVQQKELFTEAQEEKDLLSIVIPYYNMGDYIKDTLD
FT                   SLLRISYPQKEIIVVNDGSDEPKSLAILYQIEKNYPVRVIHKRNGGLATARNEGALNAR
FT                   GEFLAFLDADDLVSAEYYDWAIKILKYYSNVSFIGCWTEYFGAARGIWPTWNPEPPYLL
FT                   VHNTLNSSGLVFRKRDFLLYGLNDPEMEYGMEDYECVIRMVKNGCRGVIIPRPFFKYRV
FT                   RPDSMSRQFNRGNMLYLYNLISQKHADFYGKYAKDVFNLLNANGPGYLYDNPTWELPPI
FT                   GFVSKGTENEIVGSLDWSTHEIPPELKEKLLSLWRRPFFRRALRLFFRLRLDKLF"
FT   gene            495071..495865
FT                   /locus_tag="Toce_0492"
FT   CDS_pept        495071..495865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0492"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   rca:Rcas_3636 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: Glycosyl transferase
FT                   family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07268"
FT                   /db_xref="GOA:D9S1J1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J1"
FT                   /protein_id="ADL07268.1"
FT                   /translation="MPLKVAIVIPCYNYGEFVEEAVHSALSQDTKIELVIVDDGSTDPE
FT                   TLRVLDRLRARGIYVYRQSNRGLPGARNTGIRLTSAPYIVCLDADDIISPSYCSTCLEV
FT                   LEKQPDVGFVYSTTRVFGNQNKQWSNLSYSALHLLVDNYIPYSAMFRRKIWEEVGGFDE
FT                   NMRLGYEDWDFWLSAVEKGWRGFHIPEGLFWYRKHGKSMLSSSNQHRKELKNYLRRKHH
FT                   NLYSHKAILKLLKDEPFRIPRAFGALIKEEILRPLKNLYNSL"
FT   gene            495993..497135
FT                   /locus_tag="Toce_0493"
FT   CDS_pept        495993..497135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0493"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: adg:Adeg_0504 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07269"
FT                   /db_xref="GOA:D9S1J2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J2"
FT                   /protein_id="ADL07269.1"
FT                   /translation="MSLNSKSKVLFLATVYTHLAAFHIPFMRLLQEKGYEVHAAASPDD
FT                   GGKEEVEAIRARCWDIPFSRSPYSLKNWRALRELDHLFEAHRFDLIHVHTPVAAFLGRF
FT                   MAKAKCQGPVLYTAHGFHFYRGVPLKNWLLYYPMERLASHWTDGLIVINREDFEIARRF
FT                   GFEPGRNLFYVHGVGVNLSCYTSLPSKGQYIRVDLGLSHSDIIITCVAEMTPNKNHILI
FT                   LKAWKKLAAKCSHCHLLLVGKGELMPALKKKVKEEKIPRVYFLGYRRDVPQILRESDIV
FT                   TLTSKREGLPKSIMEAMAAGKPVVATNVRGSRDLVEHGKTGFLVDLGDDEGLFFALKSL
FT                   IENGELRKTMGKAGREKIKDYSMDRVLNEMEAIYMRYLAL"
FT   gene            497220..498620
FT                   /locus_tag="Toce_0494"
FT   CDS_pept        497220..498620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0494"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro IPR017475:IPR003362;
FT                   KEGG: csc:Csac_1093 sugar transferase; PFAM: sugar
FT                   transferase; PRIAM: Undecaprenyl-phosphate galactose
FT                   phosphotransferase; SPTR: Exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase subfamily protein;
FT                   TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; PFAM: Bacterial sugar
FT                   transferase; TIGRFAM: exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07270"
FT                   /db_xref="GOA:D9S1J3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J3"
FT                   /protein_id="ADL07270.1"
FT                   /translation="MNGKTKKNLISLLLAILDIFFINLGYLLIFHLWKGKFTTENIEAY
FT                   ITVIPVISITALILFNIYGIYNIERRNISELAVSSVIALFFSNVIGMASSFFLRSFAFP
FT                   RSVFIGGFILQTVFIVTLRYIAINLYKKIHGPERLLIVGREEDAKQIINSISRIDHGWV
FT                   DCRYAVLENEAKMLEWAMNLADTIFLTAEAAKNLKKEIVDASLKGKKIAIIPDLYEILM
FT                   PKARLVTFDDLLVFEFPHWNVSRGQRVIKRVLDFISAFVGLILSLPLIIIISILIKLTS
FT                   EGPILYIQERIGQYGKKFKLYKFRTMINNAEKHTGPVMAGKDDPRLTPLGKILRALRFD
FT                   EIPQLINVLKGDMSLIGPRPERPVFVEKYCQINPYYNYRHLVKPGITGLAQVMGSYDTS
FT                   FEDKLRYDLYYISNYSLLLDLKIFFLTLKTILLAEGIVKKKNIDVDEQWQNMIVLCSDE
FT                   LSSSKENK"
FT   gene            498854..499660
FT                   /locus_tag="Toce_0495"
FT   CDS_pept        498854..499660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0495"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COGs: COG4464 Capsular polysaccharide biosynthesis
FT                   protein; InterPro IPR016667:IPR004013; KEGG: tte:TTE0735
FT                   capsular polysaccharide biosynthesis homolog YwqE; PFAM:
FT                   PHP domain protein; PRIAM: Protein-tyrosine-phosphatase;
FT                   SPTR: Capsular polysaccharide biosynthesis homolog ywqE"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07271"
FT                   /db_xref="GOA:D9S1J4"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J4"
FT                   /protein_id="ADL07271.1"
FT                   /translation="MIDLHAHILPGIDDGSPDLDTSLKMAEIAASEGIRKMVATPHFIT
FT                   KERELERELILEKVKELNDLFREKGIDLEVYPGQEVFLSPEIPELLDEGKLLTLFDGGK
FT                   YLLVELPMMSIPPYSLNIIHSVHLRGVKVILAHPERNREIIADIKKLCEFVRIGTLVQV
FT                   NSLSLMGVFGRESMRTAEKILKEGLAHIIATDCHTARSRAPRMKKALAALSEKAASLLS
FT                   VENPRLVMEGKQIEVPFAGYKAGHLGIAKKLALFFSGFKVVKEREV"
FT   gene            499662..500729
FT                   /locus_tag="Toce_0496"
FT   CDS_pept        499662..500729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0496"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119; KEGG: gym:GYMC10_1663 S-layer
FT                   domain protein; PFAM: S-layer domain protein; SPTR: S-layer
FT                   associated multidomain endoglucanase; PFAM: S-layer
FT                   homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07272"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J5"
FT                   /protein_id="ADL07272.1"
FT                   /translation="MGGLKKSRIVTVFAIFLLCLSLNYARPAAIELDEGLIDLAFEKLK
FT                   TLDPTVKSDAIDLLEIFFNSEQGLEDLKDSLPDILALVVGENYQDLLSKHGLSLGRLKS
FT                   DIDDLKKWSKEDRLKLLDLIEKGDKEGVKALVEKYEGSDNSASGGGSLPEQPIQNQPVF
FT                   PEISIKFNDIENHWARTYIEFIASKGIIKGKADGLFAPEDRVTRAEFTAMLVRLLKLED
FT                   EGTGKDLPFTDVKPDDWFYSIVKAAYNSGLARGIGNKFDPNSLITRQEMAVLVTRAASI
FT                   MNKSAFVDSAEVEKILSAYKDRDRISDWAKTEIAVAVKLGLISGVSADILVPGDTATRA
FT                   QAATVIYNLYRLIYE"
FT   sig_peptide     499662..499736
FT                   /locus_tag="Toce_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            500827..502944
FT                   /locus_tag="Toce_0497"
FT   CDS_pept        500827..502944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0497"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119; KEGG: tex:Teth514_1781 alpha
FT                   amylase, catalytic region; PFAM: S-layer domain protein;
FT                   SPTR: Alpha amylase, catalytic region; PFAM: S-layer
FT                   homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07273"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J6"
FT                   /protein_id="ADL07273.1"
FT                   /translation="MRGLTRKAISIALVLMMLVAAMPAWAETGDLTDDQINSLAFSVFL
FT                   RSKLEGLSVEEIKKLIDLIEKIDQKDIIVDKLFETALDSRLNGYGITRDSVTDFAKSLR
FT                   DDKFQNKSWKEWTKEIAEKVKEPGINSLTQDQINWIKHLDNDIFDKKFPGLTALINTKF
FT                   NNKFDFIRFNRQVFEKVITKNIDISYEGGRFSVSFKDSLKDDLNLYLSGQPAAVSGYFK
FT                   KGQSIVPLNEQEIEALEDVITDIITAFNDSEFTTSEKDLIAKALESFGFDVKGYPVTPP
FT                   EPGDDGSSGGTGGGGGGGGAAPSEPEIEIPKDQNKPVAVIVPADAVKVTVADGKAVVTF
FT                   DEKAVSDLLKLLDEAVKKAEGKKLALIIDLTGSEKIGDKATVELPASLAAKAFEKGATL
FT                   TVNLKKIGIDLPAGSVEVGNNALKINVEAKDAKSALMNIKGIENMRPVGSAVEANVLLG
FT                   DNPASFKKKVTLRLSIKGLTTNIDKLGIYYLNEKEGRAEFKGGKVDKASGEIRANLAHL
FT                   STYVLLEYDRTFGDIKSHWAKNYVESMAAKHVVDGRTADKFVPNDNVTRAEFAKLVVGA
FT                   LELDLVKYKGSFEDVASGAWYADYIQTAYDNGLITGRVEGKVFDPNAKITRQEIMAIIG
FT                   RALARKPSKDAGTLLAPFKDAAEIAGYAKEHVALLVEMGIVSGYPDGTVRPQAHTTRAE
FT                   AVKLIYGLYNN"
FT   sig_peptide     500827..500904
FT                   /locus_tag="Toce_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            503003..503566
FT                   /locus_tag="Toce_0498"
FT   CDS_pept        503003..503566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_3983 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07274"
FT                   /db_xref="GOA:D9S1J7"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J7"
FT                   /protein_id="ADL07274.1"
FT                   /translation="MGKEKGKIPYKAIIITLALFLALIISAYHILVNEAFDLVFPDHPG
FT                   EVSQSGGQAQPPTDIKSPDLPRTPEVDVHETGSEEGQTSRGTPPPKFEKPEKPLGTTAG
FT                   KAIEDISIDEISGNISFSDKRRILWLVVRRLTSDDIKYLLGLLKGGLTESEKEEAKKIA
FT                   FSRFTPEEIQEIRSLYHKYKHLTE"
FT   gene            503585..504298
FT                   /locus_tag="Toce_0499"
FT   CDS_pept        503585..504298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0499"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3944 Capsular polysaccharide biosynthesis
FT                   protein; InterPro IPR003856; KEGG: tpd:Teth39_1555
FT                   lipopolysaccharide biosynthesis protein; PFAM:
FT                   lipopolysaccharide biosynthesis protein; SPTR:
FT                   Lipopolysaccharide biosynthesis protein; PFAM: Chain length
FT                   determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07275"
FT                   /db_xref="GOA:D9S1J8"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J8"
FT                   /protein_id="ADL07275.1"
FT                   /translation="MEEINIYEEEISLREIISVLKKRLRLITVVVAICIMAAATYTFWI
FT                   KKPVYESYTTIMVGKPVQRVQDSSAPITYQELQTNRLLVSTYGEIAKSRSTLEEVLRRL
FT                   NLNTTYEKLKSRIKVNLVKNTEIIEIRVSDHDPVMAATIANAVSESFSRQVIRIMNVEN
FT                   VQVIDEAIPIYQKVQPKPVLNLSLSLILGLMMGVFFAFLQESFDTSIKSPEDVAKYLGL
FT                   PVIGSIPYIEKGEVA"
FT   gene            504298..505014
FT                   /locus_tag="Toce_0500"
FT   CDS_pept        504298..505014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0500"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR005702; KEGG: tpd:Teth39_1554
FT                   exopolysaccharide tyrosine-protein kinase; PRIAM:
FT                   Non-specific protein-tyrosine kinase; SPTR: Capsular
FT                   exopolysaccharide family protein; TIGRFAM: capsular
FT                   exopolysaccharide family; PFAM: CobQ/CobB/MinD/ParA
FT                   nucleotide binding domain; TIGRFAM: capsular
FT                   exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07276"
FT                   /db_xref="GOA:D9S1J9"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1J9"
FT                   /protein_id="ADL07276.1"
FT                   /translation="MEEMDAQLFVMDDPKSVVSEAFRVLRTNLQFSSIDRPLKKVVVTS
FT                   SIPQEGKSTVIANLAVSIASAGSRVLLVDADLRRPKLYKLFLLENYKGLSNLLAEDLPL
FT                   DTVVNTTKVENLHVITSGPVPPNPAEVLGSAKMKNFLDEVASLYDMVLIDAPPVNSVAD
FT                   AAILSTLVDGVILVVEEGSTEREAAVAAKQQLDKVNARILGVVLNKVKQQKGGGYYYYY
FT                   YYYGEGDHKRKKKKIT"
FT   gene            505065..506615
FT                   /locus_tag="Toce_0501"
FT   CDS_pept        505065..506615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0501"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase, WbaP"
FT                   /EC_number="2.7.8.6"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro
FT                   IPR017472:IPR017475:IPR003362; KEGG: dau:Daud_1703
FT                   undecaprenyl-phosphate galactose phosphotransferase; PFAM:
FT                   sugar transferase; PRIAM: Undecaprenyl-phosphate galactose
FT                   phosphotransferase; SPTR: Undecaprenyl-phosphate galactose
FT                   phosphotransferase; TIGRFAM: Undecaprenyl-phosphate
FT                   galactose phosphotransferase, WbaP; exopolysaccharide
FT                   biosynthesis polyprenyl glycosylphosphotransferase; PFAM:
FT                   Bacterial sugar transferase; TIGRFAM: exopolysaccharide
FT                   biosynthesis polyprenyl glycosylphosphotransferase;
FT                   Undecaprenyl-phosphate galactose phosphotransferase, WbaP"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07277"
FT                   /db_xref="GOA:D9S1K0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017472"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K0"
FT                   /protein_id="ADL07277.1"
FT                   /translation="MNNSQVEIRKTGRQIVTQSNEAAIALRPAPTLDLAHAFWGAFEIT
FT                   LLAAMDFLGIATSFMLALLIRIRTLPALSPLYSSMVPDRLINNFWWLTGIVLGILAFEG
FT                   LYTARYPFWRELQRLVKGITLAFLVVFTVIFMAKLSSEVSRTVLTLTYLFCLLILPFCR
FT                   YTGKTILSRLGLWRRKVVILGAGKTGELVAKIFSSDSYLGYEVVGFLEDDPGKKHKTFA
FT                   IKKDTILKVLGNFSDAQEVMQRLGVRHLVVAAPGMPSQELVKLVNRLQREAASVLVIPD
FT                   LLGVPVSSAEIDYFFEEQMLGFRVRNNLSDPVNMVLKRTFDLVVGSIALLVSAPIMAII
FT                   ALAIKLDSPGPVIFAHKRIGRWGKEFKCYKFRTMYLNNEEILQRYLASNPAAKEEWEKY
FT                   AKLKGYDPRVTRVGRFLRKLSLDELPQIFNVLKGEMSLVGPRPYLPRERFRMDNFAETI
FT                   LLARPGITGLWQISGRNEIDFEGRLNLESWYVRNWSLWLDIVILIRTVGVVLARRGAY"
FT   gene            506719..508077
FT                   /locus_tag="Toce_0502"
FT   CDS_pept        506719..508077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0502"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR017476:IPR001732:IPR014026:IPR014027; KEGG:
FT                   mtp:Mthe_0952 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: Nucleotide sugar dehydrogenase
FT                   subfamily protein; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
FT                   binding domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain; TIGRFAM:
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07278"
FT                   /db_xref="GOA:D9S1K1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K1"
FT                   /protein_id="ADL07278.1"
FT                   /translation="MHITIIGIGYVGLAAAVAFSYLDHHVVGIEKDPQKLRLLQESKSP
FT                   IFEPGIEELLDKSRERLSFTNDTVGAVADSDVIMIAVGTPPKKNGEADLCYVEEAARQA
FT                   AMGMVSGGTYVIVIKSTVPIGTNRRVMHIITKTLAERGVKANVHIASNPEFLRQGMALK
FT                   DMLYPDRIVVGAETAEAIETLRNLYRPILEQSFAPPSSLPRPDGYSFPPLIITDLTSAE
FT                   MIKYAANAFLALKISFINEIAGLCEKVGADIKEVARGIGLDPRIGPRFLQAGLGWGGSC
FT                   FPKDTAALLAVAAEYGYTMPIIEAARAVNTRQRTLIVEKLQSVLKILRGRIIGILGLAF
FT                   KPGTDDIRESPALDLVRILIERGAHVKVHDPVAMPKARLVLKELPVDYAADPYTLAEGC
FT                   DAIILATEWETYRQLNLALLAKRMNQPVLIDGRNFFDPEQARQAGFIYMGVGR"
FT   gene            508605..509714
FT                   /locus_tag="Toce_0503"
FT   CDS_pept        508605..509714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0503"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: bph:Bphy_6702 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07279"
FT                   /db_xref="GOA:D9S1K2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K2"
FT                   /protein_id="ADL07279.1"
FT                   /translation="MKVLHIVLKPRFSGAEILVKDLAVTHSSQGIAVGIAAFNPPEDDF
FT                   MPIIENLSISGVKCFLPVSPLKKTSRLLALWNWLAQFRPDIIVAHSAIPALYTRIALFN
FT                   RQMPKVISVLHAVDDYRDWRLRLPEYILRWKSARVVAVSDESARYYIRRFPKAHIKIIP
FT                   NGIHINRFILAAQNRAKHREYFGLAGHTQIVLQVGRITPVKQQHLSLAAIIPIMRENPN
FT                   VELWFIGPIEDKSYYNALLDKVRSFEIAERVRFWGGQSNLELFLAVSDLLLMPSVREAS
FT                   SIAFLEALASGIPVIASDIPAFAFAEKYPGVWLVSPENTPEFGDRIQLALAEKMRHVRD
FT                   LSSYSFQRTAEQYLSLFKEVLDNEKGCVD"
FT   gene            509707..510825
FT                   /locus_tag="Toce_0504"
FT   CDS_pept        509707..510825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0504"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: mfa:Mfla_2015 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase, group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07280"
FT                   /db_xref="GOA:D9S1K3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K3"
FT                   /protein_id="ADL07280.1"
FT                   /translation="MIDPFSTGHHVSYARILAKGLRNRGSEVVAIGDPQLLKGLGNLII
FT                   EGVPLELQGKGEAIIREWQKFHYMQVAVNFAQKMKPDIIHFLYLDRFALVLAMSGVLGM
FT                   QYRATLHWGYMLPEFLSRPLQRVRAAFEVRALRRLAARGFRIIVHSRWLQKSLAERVGH
FT                   RTFDFVPYPVEPHDSSESRLRARLLRESLGLPKGSRLVLVFGGTRYDKGVDLAVKALMH
FT                   LDTYWHLLVAGKSESFDEVTLLELARRHGVRERLHLHLQYIPEEIINDFFLAADVVLLP
FT                   YRSIFSGQSGPLTLAASLGIPVAAASVPVLAETVEQYRLGVLFPPEDICGMAQALRVLE
FT                   EKQICTLQSEFCRDHSPDAFIEAVMKSYVSSE"
FT   gene            510874..512001
FT                   /locus_tag="Toce_0505"
FT   CDS_pept        510874..512001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0505"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: afw:Anae109_4436 glycosyl transferase
FT                   group 1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07281"
FT                   /db_xref="GOA:D9S1K4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K4"
FT                   /protein_id="ADL07281.1"
FT                   /translation="MRVALVTNIASPYRIPVWDALGKEVEDLRIFLCAENEPNRIWKIK
FT                   DLGSYAFEYRILPGKQWYVPSRDWAIYLNPTLWCELNEYRPTHLIVSGYETPSYLMAIA
FT                   YAKLHRVRLVIWWGSHALSSRSRRGPVAWVRKHILRLADAYITYGTRATEYLINMGIPI
FT                   ERIVTGTNTVDVERVAGLVESYRVEMGPRIDKRTRFLYVGQLIERKGVRQLLRAFRALP
FT                   KERAELIIVGYGPLEDELKMFAKDNGMDNIIFAGSTRTLEETARYYAWADVLVMPSLIE
FT                   VWGLVVNEALAAGLWVLASRYAGATFDLVERAPVEVGIAFNPIDEEDFIRSLNMSLSNA
FT                   HLRRSKEISKWGMMHSPKRYAHCIVSCLFLSEQFC"
FT   gene            512078..513655
FT                   /locus_tag="Toce_0506"
FT   CDS_pept        512078..513655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0506"
FT                   /product="LicD family protein"
FT                   /note="InterPro IPR007074; KEGG: bvi:Bcep1808_6516
FT                   hypothetical protein; PFAM: LicD family protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: LICD Protein
FT                   Family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07282"
FT                   /db_xref="GOA:D9S1K5"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K5"
FT                   /protein_id="ADL07282.1"
FT                   /translation="MLRPSIFGEMYSEYGLGIITAILILDLIKHRFVIPGRIKKYLPFL
FT                   FWFSFLWFYMLITALLFISSNFVFAVKAFILNFITVWAVALILARGERNYLFFRWFGRI
FT                   MAILGYSSLITFVVSFFYPLNNLYFGQIVTPSYRAAGQIYFPFTIRYGRYTFGDFVLLR
FT                   DQGVFREPGILQAFANFMLVRALNFKEKFWVILGLLMQLVFTFSTATLFLTPITLGLWH
FT                   LFISNNRRKYWKFRLILFSRFTSAFMGVLLIIVGAIAFLHFPGFGFSDKLLTHETSISD
FT                   RVDNMIQGFVAGLEKPFGIGLYGVNRSNAGINLVAATEQIGIIGFILAIGVYIVSVLSA
FT                   PARARKKFAIMIMPLFITALVSQPLLDAPFDGSPKNWLLRRIHYSRIKFYRVIIQYYYC
FT                   NDKIIKDRGLKGVLKKKIMDLVKLIFKLFSKKITIQNIHKRLENLLRKYDYYNSDIVCN
FT                   YLGAWGSKEFIPRKYVGEKKKIEFEGYNFSSIEDPVAYLSKIYGDFMKLPPIEKRKSHH
FT                   AFSFIELN"
FT   gene            513991..515415
FT                   /locus_tag="Toce_0507"
FT   CDS_pept        513991..515415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cms:CMS_1585 putative polysaccharide
FT                   polymerase; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07283"
FT                   /db_xref="GOA:D9S1K6"
FT                   /db_xref="InterPro:IPR029468"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K6"
FT                   /protein_id="ADL07283.1"
FT                   /translation="MNKRVSNNQKYFCYTKIFWLIFVFNLLAIILPLSFIINISEFRIN
FT                   SNGILTLFIIWYSSARLAILSAKGLKRLLSMTFWVFVYIWLGISPLFQVSVGRMPWPIT
FT                   TSEYHVTYALIISITGLLFYDVGMFLAGHLIKTNNTNYTPKLILDERKILLFAPISIVT
FT                   AAVIIVAFFGGFDIFLLARAVRNAYLNELYSKSQLLLLDNLLRAIIFVSLQSVFVIWIR
FT                   RTNNYLTKKNILKFIFLIVLIVLNLYINNPISTARYRFGFVVISLLFIGLKWNEKTSFP
FT                   LWTLMMITFLLIIFPYADLFRNRADVSLKSLEFLPIYEHLVGNGDYDAFQQLSNTVAYV
FT                   SKKGITWGKQLLGVIFFAIPRNLWPNKPLGSGEFIALNSGYYYTNLSCPLWAEAYLNGG
FT                   FIAVIIIFTVYGILTKNIEHQYLSQQNGASFLDIFVPFFAPYQIFFLRGDLMSTFAYLI
FT                   PNILFMLLVTKINCKR"
FT   gene            515441..516619
FT                   /locus_tag="Toce_0508"
FT   CDS_pept        515441..516619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0508"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: cyn:Cyan7425_2189 glycosyl transferase
FT                   group 1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07284"
FT                   /db_xref="GOA:D9S1K7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K7"
FT                   /protein_id="ADL07284.1"
FT                   /translation="MNILLVHNHYRQPGGEDSVFFSEKMLLSDQGHNVFFYTANNAQLE
FT                   KFSAAGMIRNTLWNQKSYWDLRYLISKHSVQVAHFHNTFPLISPSAYYAAKSENIPVVQ
FT                   TLHNYRLLCPNALFFRAGHVCEDCLGRFVPWPGVLRRCYRGSIAASGVVATMLTFHRVL
FT                   GTWKRMVDVYVALTEFARQKFIKAGFPAEKIVVKPNFVYPDPGVGEGKAGFTLFVGRLS
FT                   PEKGLDTLLVAWERLEGKLPLKIVGDGPLAGKVIEATQRLIGVEWLGRRSREEVLALMK
FT                   EASFLIFPSISHEGFPMTIVEAFAVGLPVLASNIGNMSNLIDPGRTGFHFRAGDSEDLA
FT                   AKVEWAWAHTRQLMEMRREARAEYEAKYTAEKNYEMLMNIYQLAISRAKGRG"
FT   gene            516730..517992
FT                   /locus_tag="Toce_0509"
FT   CDS_pept        516730..517992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0509"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: chu:CHU_0913 A-glycosyltransferase; PFAM:
FT                   glycosyl transferase group 1; SPTR:
FT                   A-glycosyltransferase-related protein, glycosyltransferase
FT                   family 4 protein; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07285"
FT                   /db_xref="GOA:D9S1K8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K8"
FT                   /protein_id="ADL07285.1"
FT                   /translation="MGLRLLIYGINYTPEPTGTGKYTGEMAAWLAARGHQVDAIVGLPH
FT                   YPSWEVDPAYQDKGFHTEIIEGVRVLRVPHFVPSPERIGAIERIRLESSFSLKALRYWL
FT                   LFLLQNNSYDAVIAICPPMQVGVYPWLYRLFRGVPWIFHIQDLQVDVAVRLGLLNGKLS
FT                   KVLYTVENFLLRRATRVSTITEAMRRRIIAKGVPEKNTWLFPNWSDITFIRPMPRNNAF
FT                   RQELRVAEDQILFMYAGNMGEKQGLELVLQAAEHLRYYSQLRFVLVGAGVAKQRLEKMA
FT                   EEMKLTNVTFLPVQPLERLPEMLAAADVHLVVQKSEAADLVMPSKLTNILAAGRPVVAT
FT                   ADSGTALHDVLTSYQAGIVTPPGDLKAFIDALQLLAESAILREQMGRNARLYAERYLDK
FT                   ERILKDFEDKLITLVREVRKR"
FT   gene            517989..519041
FT                   /locus_tag="Toce_0510"
FT   CDS_pept        517989..519041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0510"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="COGs: COG1089 GDP-D-mannose dehydratase; InterPro
FT                   IPR020904:IPR006368:IPR001509; KEGG: sus:Acid_4632
FT                   GDP-mannose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: GDP-mannose 4,6-dehydratase;
FT                   TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family; TIGRFAM: GDP-mannose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07286"
FT                   /db_xref="GOA:D9S1K9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1K9"
FT                   /protein_id="ADL07286.1"
FT                   /translation="MKKALITGITGQDGSYLTEFLLNKGYEVHGIIRRASTFNTDRIDH
FT                   IYRDPHDQEARLFLHYGDLTDGTGLRRILEKVQPDEVYNLAAQSHVKVSFEQPEYTADV
FT                   VATGTLRLLEALRDYIKVSGREVRFYQAGSSEMFGASPPPQNEKTPFYPRSPYAVSKVA
FT                   AYWYAVNYREAYGMFICNGILFNHESPRRGETFVTRKITRAATRIKLGLQDKLYLGNLD
FT                   AKRDWGYAGDYVEAMWLMLQQNEPDDYVIATGESHSVREFLEEAFGLLGLDWRQYVEID
FT                   PRYFRPTEVEFLLGDSTKARQKLGWKPKVTFKDLVKMMVEHDLLLAHQEKTLKDAGYAV
FT                   ALRGVASANA"
FT   gene            519034..519963
FT                   /locus_tag="Toce_0511"
FT   CDS_pept        519034..519963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0511"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509; KEGG: mba:Mbar_A0035
FT                   GDP-fucose synthetase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: NAD-dependent
FT                   epimerase/dehydratase; manually curated; PFAM: NAD
FT                   dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07287"
FT                   /db_xref="GOA:D9S1L0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L0"
FT                   /protein_id="ADL07287.1"
FT                   /translation="MHKGAKVYVAGHKGLVGSAILRKLQAEGYSNIVTRTHQELDLTNQ
FT                   QEVYRFFETERPEYVFLAAAKVGGILANSTYPAVFIRENLLIQTNIIDAAYRYGVKKLL
FT                   FLGSSCIYPKFAPQPIKEEHLLTGALEPTNEPYAIAKIVGIKMCQAYNKQYGTNFISVM
FT                   PTNLYGPGDNFDLETSHVLPALIRKFHEAKVAGAPHVVVWGSGTPRREFLHVDDLADAC
FT                   LFLMNNYDSSEIINIGVGKDLTIAELANLIKEIVGYKGEIVFDTSKPDGTPRKLLDVSK
FT                   LFNLGWRPRIRLEDGIRSTYEWYMQNYT"
FT   gene            520073..521410
FT                   /locus_tag="Toce_0512"
FT   CDS_pept        520073..521410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0512"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="COGs: COG0232 dGTP triphosphohydrolase; InterPro
FT                   IPR006261:IPR003607:IPR006674; KEGG: tkm:TK90_0267
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR:
FT                   Deoxyguanosinetriphosphate triphosphohydrolase; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM: HD
FT                   domain; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07288"
FT                   /db_xref="GOA:D9S1L1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L1"
FT                   /protein_id="ADL07288.1"
FT                   /translation="MSNYGDGVVLRGDELIEFLDNQLANYAVKHKYGKEARLYPEKYDP
FT                   NDNRNPFQHDRDRIIHSRAFRRLKGKTQVFTVSRNDHIRTRLSHTLEVAQLSRSVARAL
FT                   RLNEDLAEAIALGHDLGHPPFGHAAEEELNDILRGRTKLWTCDIGGFKHNINSLKIVDY
FT                   FERAYAEFPGLNLTHWTREGILKHTGLNDKKDGLQVHDPTIDMSKLRLEVGVPSFLEGQ
FT                   IVAVCDELAQVTHDLEDAGRAGIVRDFSEEASPWCEIEIFSKALERARQERFYDETNLR
FT                   SRLIRHLINLLMEDLISATEERIKKCILECGEVDPVKQPFSTKIVDFSADVAKQVENLQ
FT                   KLLRETVYASYEVSRGDIKARLYIQSIFKAYYDHPSRMPDYVYRKYNDAKGASESEELK
FT                   RSNLEKFKDKIKNDPIFVRTIVEHIAGMTDQYLLNEYRQLFTPEIW"
FT   gene            521407..521685
FT                   /locus_tag="Toce_0513"
FT   CDS_pept        521407..521685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0513"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07289"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L2"
FT                   /protein_id="ADL07289.1"
FT                   /translation="MNALLIKKLKVYLSRSFANRYRIARIRSGLLLFKEYIFSFLTIKG
FT                   IRKERTVSQAEGCGFVSVGEKILLVLQNFLISLLWQTRGMKPCSNRR"
FT   gene            complement(521630..522586)
FT                   /locus_tag="Toce_0514"
FT   CDS_pept        complement(521630..522586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0514"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG1453 oxidoreductase of the aldo/keto
FT                   reductase family; InterPro
FT                   IPR017896:IPR017900:IPR001395:IPR020471; KEGG:
FT                   mta:Moth_0964 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07290"
FT                   /db_xref="GOA:D9S1L3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L3"
FT                   /protein_id="ADL07290.1"
FT                   /translation="MKKNVLGMTGIEVTELCFGALPMGPLQKNLDLDSCVEVTAYALKK
FT                   GINFIDTAQMYKTYEPIREAIKLTGINPVISTKSTASTYSDMEKAIDEALRALDRNYID
FT                   IFFMHAARVGEDVFDVRKEALKCLLDYKSKGYIKAVGISTHNVKVVELASQRDDIDVVF
FT                   PIINYKGVGILGGSVEDMKKAIEVSSSRGKGVLLMKVLGGGVLLNEYKKSMDFARNLKG
FT                   YHSIAVGMVSKEEVDFNVNYFNGIYDEEKSPVLGKNQKNFIVVDSLCKGCKTCLSACPN
FT                   YAMEFAEERNKAYINREKCLTCGYCTASCPEFAIRVI"
FT   gene            523044..524207
FT                   /locus_tag="Toce_0515"
FT   CDS_pept        523044..524207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0515"
FT                   /product="glycerol 2-dehydrogenase (NAD+)"
FT                   /EC_number="1.1.1.6"
FT                   /note="COGs: COG0371 Glycerol dehydrogenase;
FT                   InterProIPR006162:IPR018211:IPR016160:IPR016205:IPR 001670;
FT                   KEGG: cno:NT01CX_0287 glycerol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR:
FT                   Iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07291"
FT                   /db_xref="GOA:D9S1L4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L4"
FT                   /protein_id="ADL07291.1"
FT                   /translation="MRIPVPGVILIKYLGGRFTVTRAIIGPGKYVQGNGVLKDIKEHTM
FT                   KLGRSFFIIASENGIKRTKPVIEESFAGEKVELVFEPFNGECSENEIERLKGLAEKNNS
FT                   QVIVGIGGGKVLDTAKAIAYFLKLPVVVVPTVASTDAPCSALSVIYTDEGVFSKYLILP
FT                   RNPDVVMVDTGFIVKAPARLLAAGMGDALATYFEARACFRSNATTLAGGKSTKAAMALA
FT                   ELCYRTLLEDGLKAKLAVENNACTLAVENIVEANTYLSGIGFESGGLAAAHAIHNGFTV
FT                   LEECHHMYHGEKVAFGTIVQLVLENSPMEELEEVVGFCLDVGLPVTLEDLGIKEVKEAD
FT                   IRKVAEASCAEGETIHNMPFKVTPEDVYNAILGADALGRTLKNQYIR"
FT   gene            complement(524386..524463)
FT                   /pseudo
FT                   /locus_tag="Toce_0516"
FT   gene            complement(524585..525976)
FT                   /locus_tag="Toce_0517"
FT   CDS_pept        complement(524585..525976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0517"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: aoe:Clos_0856 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: MATE efflux family protein; TIGRFAM: MATE efflux
FT                   family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07292"
FT                   /db_xref="GOA:D9S1L5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L5"
FT                   /protein_id="ADL07292.1"
FT                   /translation="MARLADLFSPKDMTVGTPWKRIVEFSIPMLIGNIAQQLYNTVDSI
FT                   VIGRYVGDNALAAVGSAFPVLNFLLVLFVAVASGASIMVAQYFGAKDRERLSRSIGVCI
FT                   TLTAIVSTLIMVISPFAIRPMLVFINTPESILDWCEDYLLILLVGNWGFSYFNILSGIL
FT                   RGLGDSFSALVFLLISTALNVVLDIWFVAGLNMGVPGVALATVIAQTVSAVLCIIKLKK
FT                   MDDLFDFNLNMMKPIKEYVLQLLRLGLPSGLTQVIFSLAMITVQSLTNTFGEMIIACNV
FT                   IVMRVDGFAMMPNFTFGITMTTFAGQNVGAKKMKRVELGTRQGLAIAVGVSTVITIIIL
FT                   IFGRYLMNIFTDTAELVDLSMRMMRILAVGYIAMAVTQVLSGVMRGAGDTVTPMWLSLI
FT                   TTIFLRVPIAYGIAYLTRSAEYPNGRPESIFVSLLIAWVFGAIITVIFFKKGNWKEKAL
FT                   LKDVR"
FT   repeat_region   526446..529158
FT                   /note="CRISPR"
FT   gene            complement(529323..530393)
FT                   /locus_tag="Toce_0518"
FT   CDS_pept        complement(529323..530393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0518"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="InterPro IPR003346; KEGG: tit:Thit_1358 transposase
FT                   IS116/IS110/IS902 family protein; PFAM: transposase
FT                   IS116/IS110/IS902 family protein; SPTR: Transposase
FT                   IS116/IS110/IS902 family protein; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07293"
FT                   /db_xref="GOA:D9S1L6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L6"
FT                   /protein_id="ADL07293.1"
FT                   /translation="MRLFYLIVSTGSFWKPIYNLLELENINILLVNAKHIKNVPGRKTD
FT                   VKDAEWIASLLRHGLLKGSFVPDREQRELRELVRYRHSLVEERSRELNRIQKVLEGANI
FT                   KLSSVVSDINGMSSRAILEALISGVDDPEILAELSHGKLKNKKEDLKRALKGFINYHQR
FT                   KMLEIQLRHIDYLDEEIERLDEEIKNRMLPFEEDLALLDTIPGVGRRTAEQIIAEIGTN
FT                   MDQFPSAAHLCSWAGLCSGQNESAGKRKSARTRKGNKKLRSALVEAARAASRAKDTYLS
FT                   SQYHRIAARRGSNRAAVAVANSILTIVYHILKRRQPYIELGPNFYEEKRRNMVIRQSLK
FT                   KLESLGLKVTVEAVAS"
FT   gene            530520..531602
FT                   /locus_tag="Toce_0519"
FT   CDS_pept        530520..531602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0519"
FT                   /product="peptidase S58 DmpA"
FT                   /note="COGs: COG3191 L-aminopeptidase/D-esterase; InterPro
FT                   IPR005321; KEGG: tte:TTE1085 L-aminopeptidase/D-esterase;
FT                   PFAM: peptidase S58 DmpA; SPTR: Peptidase family T4; PFAM:
FT                   Peptidase family S58"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07294"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L7"
FT                   /protein_id="ADL07294.1"
FT                   /translation="MREWGLSIGLLPPGPLNAITDVEGVTVGHVTLISGEGSLISGKGP
FT                   VRTGVTAIVPHCGNIFKEKLIASCFVGNGFGKSAGLVQVKELGTLETPIILTNTLSVGT
FT                   AVDALIEYMLSSNDDIGITTGTVNPVVLECNDGHLNDIRGRHVKKEHVFSAISGAKKTF
FT                   ETGSVGAGTGMICHGFKGGIGTSSRRIEIDATAYTVGALLLTNYGRMEDLIFNGKNVGR
FT                   ILKEEIRGRERVGEKDEGSCIVVIATDAPLDAHGLERVAKRGILGLARTGSFMGNGSGD
FT                   IAVAFSTANRIYHYGRPVIEVNTISPHSEDINKIFQAAVEAVEEAVWDSMFTAERIVGR
FT                   DYHEAPLLPVERFLELVRER"
FT   sig_peptide     530520..530573
FT                   /locus_tag="Toce_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(531659..531988)
FT                   /locus_tag="Toce_0520"
FT   CDS_pept        complement(531659..531988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0520"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="COGs: COG2337 Growth inhibitor; InterPro IPR003477;
FT                   KEGG: gka:GK1648 ppGpp-regulated growth inhibitor
FT                   (ChpA/MazF); PFAM: PemK family protein; SPTR:
FT                   PpGpp-regulated growth inhibitor (ChpA/MazF); manually
FT                   curated; PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07295"
FT                   /db_xref="GOA:D9S1L8"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L8"
FT                   /protein_id="ADL07295.1"
FT                   /translation="MQAPDRGDLVYVNFNPQSGHEQAGRRPGIVLSPKPFNQLTGFAVF
FT                   CPITRQKKGYPFEVELPVGLAVQGVILADQVKSLDWRARQLQIVGRASNEIVSECLDLI
FT                   HTFLS"
FT   gene            complement(531988..532257)
FT                   /locus_tag="Toce_0521"
FT   CDS_pept        complement(531988..532257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0521"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="COGs: COG2336 Growth regulator; InterPro IPR007159;
FT                   KEGG: gyc:GYMC61_2489 transcriptional regulator/antitoxin,
FT                   MazE; PFAM: SpoVT/AbrB domain protein; SPTR: Suppressor of
FT                   ppGpp-regulated growth inhibitor (ChpA/MazF); PFAM: SpoVT /
FT                   AbrB like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07296"
FT                   /db_xref="GOA:D9S1L9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1L9"
FT                   /protein_id="ADL07296.1"
FT                   /translation="MELNEPKGVPLMTAKVQKWGNSLAIRIPSVVAERLGIHQGSEMEM
FT                   IIENQAIKLIPKKKKPTLEELLAKITPENRHAEIDFGTEGNELF"
FT   gene            532470..532862
FT                   /locus_tag="Toce_0522"
FT   CDS_pept        532470..532862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0522"
FT                   /product="HEPN domain protein"
FT                   /note="COGs: COG2250 conserved hypothetical protein related
FT                   to C-terminal domain of eukaryotic chaperone SACSIN;
FT                   InterPro IPR007842; KEGG: dth:DICTH_0449 HEPN domain,
FT                   putative; PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein; SPTR: Hepn domain, putative; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07297"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M0"
FT                   /protein_id="ADL07297.1"
FT                   /translation="MPNRAFDRLKQALKDLNHAQVSRKNGDHDWACFAAHQAGEKAVKA
FT                   LHLYLGQEAWGHVIARLLKDLPEGICVKEELIEKAKVLDNFYIPARYPDSHPDGAPFEH
FT                   YGSLQSGEAIKYASEIVEFVRSQMAG"
FT   gene            532816..533178
FT                   /locus_tag="Toce_0523"
FT   CDS_pept        532816..533178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0523"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: dth:DICTH_0448
FT                   nucleotidyltransferase domain, putative; PFAM: DNA
FT                   polymerase beta domain protein region; SPTR:
FT                   Nucleotidyltransferase domain, putative; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07298"
FT                   /db_xref="GOA:D9S1M1"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M1"
FT                   /protein_id="ADL07298.1"
FT                   /translation="MPVRSLNSSVLKWPDKETVVYSLLEWVKEITQNRNDIVKIGYFGS
FT                   YARGDWGVGSDLDIIIIVKKSDIPFNNRSAEWDTKGIPIPVDLLVYTVEEYENMKAMNS
FT                   GFSKSIEKEVVWIYPL"
FT   gene            533390..535756
FT                   /locus_tag="Toce_0524"
FT   CDS_pept        533390..535756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0524"
FT                   /product="CRISPR-associated protein, Csm1 family"
FT                   /note="COGs: COG1353 hydrolase of the HD superfamily
FT                   (permuted catalytic motifs); InterPro IPR000160:IPR013408;
FT                   KEGG: ate:Athe_2704 metal dependent phosphohydrolase; SPTR:
FT                   Metal dependent phosphohydrolase; TIGRFAM:
FT                   CRISPR-associated protein, Csm1 family; PFAM: HD domain;
FT                   TIGRFAM: CRISPR-associated protein, Csm1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07299"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR013408"
FT                   /db_xref="InterPro:IPR041062"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M2"
FT                   /protein_id="ADL07299.1"
FT                   /translation="MAFLFNDFTAEERNLLLAALLHDIGKFWQRTQDEPMRRIVSENYR
FT                   AFYEARNHSSPGHQDWSAYFCETFVKIREVTNAVINHHGPSERLHYFVSAGDCLSAGER
FT                   LDIAEEKGGEIRQLVSILSCIELDGLRSKKAYYKKLVPLGEYCVPEEEPSPNPKQGYKE
FT                   LWDAFIKAFNSIQNFDDPVELTKLYSILEEYTFNIPSAYYYSMPDISLWAHLKTAAAIA
FT                   FALYRELEGKPNQHVISKLDSIIRRPSAVEEDLFCLVKGDISGIQDFVYDTKMDGATKA
FT                   LRGKSFYLSYLMTVIPKYILKKERLPITNLLYSGGGHFYLIMHGRFLQKLDEYQKELDG
FT                   LFLDAHHGELALLLKGVTLKPADFRVKDGKLPEKFEELGKLLQEEKNRKFYSILKEDQK
FT                   MVFGPFKEKGEPCPHCGNPVKEDECPFCRSFERLGENLIKKKFLVEEWKEKSERQKGSI
FT                   EKVEDIFKRLGVSVEFTDEALEKDYSFAVKREEWDFKKCCGYMKIPVGMKLDQKGNIIT
FT                   FDEISDSAKGIKVWGVLRGDVDNLGRIFREGLGQNRSFARIMTLSQEMAQFFGPSLERM
FT                   LNRLGSCDKSHSYENCAVIYAGGDDFFLVGPWDAMPYVAEEIKKEFYRYTGHNPAITVS
FT                   MAFDIAPDKKFPLYRVAQTAGENLENAKHFKDPVRKKEKNCFAFAGVPIGWEDFDKFKD
FT                   VKEKLFKALDELKVSRSLLGIIYRVCREYEVSANEDGKMFRSWRLFYYVARLKERNKKA
FT                   EDILDKLIYLLIEKGNKLYKYAFQSARWAEFETRK"
FT   gene            535770..536192
FT                   /locus_tag="Toce_0525"
FT   CDS_pept        535770..536192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0525"
FT                   /product="CRISPR-associated protein, Csm2 family"
FT                   /note="InterPro IPR010149; KEGG: csc:Csac_0076
FT                   CRISPR-associated Csm2 family protein; PFAM:
FT                   CRISPR-associated protein TM1810 domain protein; SPTR:
FT                   CRISPR-associated protein, Csm2 family; TIGRFAM:
FT                   CRISPR-associated protein, Csm2 family; PFAM: Protein of
FT                   unknown function (DUF310); TIGRFAM: CRISPR-associated
FT                   protein, Csm2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07300"
FT                   /db_xref="InterPro:IPR010149"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M3"
FT                   /protein_id="ADL07300.1"
FT                   /translation="MAWESNRKGKSDSFNDVKEIEERLPSALDKNKDPNGDDFFYCAEK
FT                   TGKLLATKRVSVSQIRKIFNKARRIKYEENGIFELRMLKAVIAYTAGRFPENMKEFKGI
FT                   FTKAIEIAEKSEENLKRFKQFFEAVVAYHRSYGGRE"
FT   gene            536208..537026
FT                   /locus_tag="Toce_0526"
FT   CDS_pept        536208..537026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0526"
FT                   /product="CRISPR-associated protein, Csm3 family"
FT                   /note="COGs: COG1337 Uncharacterized protein predicted to
FT                   be involved in DNA repair (RAMP superfamily); InterPro
FT                   IPR013412:IPR005537; KEGG: csc:Csac_0077 CRISPR-associated
FT                   RAMP Csm3 family protein; PFAM: protein of unknown function
FT                   DUF324; SPTR: CRISPR-associated RAMP protein, Csm3 family;
FT                   TIGRFAM: CRISPR-associated RAMP protein, Csm3 family; PFAM:
FT                   RAMP superfamily; TIGRFAM: CRISPR-associated RAMP protein,
FT                   Csm3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07301"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013412"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M4"
FT                   /protein_id="ADL07301.1"
FT                   /translation="MKDLKLAGKYIITSEIVALTGLHIGTSSNTLEIGGVDNSVVKDAL
FT                   GRPYIPGSSLKGKMRALLEYAEGLITMVYVVHNERNESSNTRIHMCKKEDCAVCNIFGR
FT                   NHGKHKVVDGNDPRGYRPVDFTDAVTPTRLIVRDATLIKESITEQMKENMDFEWTEVKF
FT                   ENNLDRVTSAANPRQTERVPAGARFKSEMVLTVFQGEGTKYIEKLLEAMLLLEDDYLGG
FT                   QGTRGYGRIAFEKVSIAFRSVGYYEGREEEQVIVENCPSLREALGKIKRG"
FT   gene            537033..537992
FT                   /locus_tag="Toce_0527"
FT   CDS_pept        537033..537992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0527"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /note="COGs: COG1567 Uncharacterized protein predicted to
FT                   be involved in DNA repair (RAMP superfamily); InterPro
FT                   IPR005510:IPR005537; KEGG: tme:Tmel_1673 CRISPR-associated
FT                   RAMP Csm4 family protein; PFAM: protein of unknown function
FT                   DUF324; SPTR: CRISPR-associated RAMP protein, Csm4 family;
FT                   TIGRFAM: CRISPR-associated RAMP protein, Csm4 family; PFAM:
FT                   RAMP superfamily; TIGRFAM: CRISPR-associated RAMP protein,
FT                   Csm4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07302"
FT                   /db_xref="InterPro:IPR005510"
FT                   /db_xref="InterPro:IPR040932"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M5"
FT                   /protein_id="ADL07302.1"
FT                   /translation="MDSGVKRYRVKLKFKGPVHFGYKEKTYNLTETFAHSDTLFSGIVN
FT                   CYSLLYGKAAADNLVEMFFDNPPFKISSAFLYANDEFFVPRPLNMDLTPITGDYKKAKK
FT                   VKYVPLDFILARDGGGKANKDYRVEHGILARKDMDTPYVISERPRVKIDRGDFSTEIYY
FT                   VSGCYFREGAGLWFFLDIYDDSEEEKVKAAIRLLGDEGIGGERTYGFGSFEAGIEEYNE
FT                   KKGNGSGDWLLLSLYYPRMDEKVADIIKAFSLLERAGYSYSPFNQQARKKKVRMLAEGS
FT                   VFKKDVQGMVVDVSPGEDVGHKILKYGLAYTVPIFNRK"
FT   gene            538005..539126
FT                   /locus_tag="Toce_0528"
FT   CDS_pept        538005..539126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0528"
FT                   /product="CRISPR-associated RAMP protein, Csm5 family"
FT                   /note="COGs: COG1332 Uncharacterized protein predicted to
FT                   be involved in DNA repair (RAMP superfamily); InterPro
FT                   IPR010173:IPR005537; KEGG: ate:Athe_2700 CRISPR-associated
FT                   RAMP protein, Csm5 family; PFAM: protein of unknown
FT                   function DUF324; SPTR: CRISPR-associated RAMP protein, Csm5
FT                   family; TIGRFAM: CRISPR-associated RAMP protein, Csm5
FT                   family; PFAM: RAMP superfamily; TIGRFAM: CRISPR-associated
FT                   RAMP protein, Csm5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07303"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010173"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M6"
FT                   /protein_id="ADL07303.1"
FT                   /translation="MEKPFQYEVEIISPVNIGDGNRYREFEYIIEGDSIGFIDVIKLLK
FT                   SNKDNTSFIDYFYRSIDSFRFSWQDALKYAPKIDISEFISYQVKPCGASRVKGDIVSFI
FT                   KTTGYPYIPGSSLKGSFRTGLMRGVWPSIEEEYKAKLDDTLREKDKKLKEIDDYPEEET
FT                   FGKPHYSPFKFVRFSDSSLLPLDALGIYEMKILNICHGKAKWFKKNENVEESENATAIY
FT                   IEALKPGIRAEGFFEIKQRTKNEEIYRIIKNVWILKNAFNAIRNDTKRYIEGEKYFYKE
FT                   YGLDQVANFYQRLEELNGKLGENEILLQIGFGTGYLSKTIGCFLSAEDLKKLSKQGVRI
FT                   SDANLFPKTRRIIFANGNPDTVPGWVKITFREV"
FT   gene            539132..539812
FT                   /locus_tag="Toce_0529"
FT   CDS_pept        539132..539812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0529"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="COGs: COG1583 Uncharacterized protein predicted to
FT                   be involved in DNA repair (RAMP superfamily); InterPro
FT                   IPR010156:IPR002743; KEGG: chy:CHY_2139 CRISPR-associated
FT                   Cas family protein; PFAM: protein of unknown function
FT                   DUF57; SPTR: CRISPR-associated protein Cas6; TIGRFAM:
FT                   CRISPR-associated protein Cas6; PFAM: CRISPR associated
FT                   protein Cas6; TIGRFAM: CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07304"
FT                   /db_xref="GOA:D9S1M7"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M7"
FT                   /protein_id="ADL07304.1"
FT                   /translation="MFRLRLEIYFKKDAFFFDRGYKINLSSYFREVIKNQFFVFSDIIP
FT                   SKKKPAKDGFWALDRAALILNTAFQELLPDIALKIMNTPVDFRYGRLTFSKAIFQRVPL
FT                   ERTGYLLSPVAVALPAGENLLWEERPERFSEALRQMLVDKYIRLYGRRPSDDRFLFRFR
FT                   GRPVKEELDSGVIAYRGKFEIFSSEELVMLSYLCGLGSFNAMGYGMASPDLYLWKKPET
FT                   MEGI"
FT   gene            539813..541177
FT                   /locus_tag="Toce_0530"
FT   CDS_pept        539813..541177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0530"
FT                   /product="CRISPR-associated protein, MJ1666 family"
FT                   /note="InterPro IPR010171:IPR019016; KEGG: ate:Athe_2714
FT                   CRISPR-associated protein, MJ1666 family; PFAM:
FT                   CRISPR-associated protein DxTHG; SPTR: CRISPR-associated
FT                   protein, MJ1666 family; TIGRFAM: CRISPR-associated protein,
FT                   MJ1666 family; PFAM: CRISPR-associated (Cas) DxTHG family;
FT                   TIGRFAM: CRISPR-associated protein, MJ1666 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07305"
FT                   /db_xref="InterPro:IPR010171"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="InterPro:IPR027419"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M8"
FT                   /protein_id="ADL07305.1"
FT                   /translation="MNSLIYQIGRLDRNIIKKQKFTIEGKTRSKQLSSFALKEHLKENG
FT                   EQAKVILVYPVSLPFNRTLENANFGDFSRSLKAVLRNPKEEYLSNPKNFFSNMPYSSEV
FT                   DDFIVIHSIGEYAGINFQGKFNDIVFEIALDMIERYNEEIERIYVDISSGLNIYVSALL
FT                   EAVRFFSIWATLKNWLPEAKRPEIWITFSDPILDNEAAEYQLHREKLEFKAFFASPINK
FT                   EDINNVAKKIYEDDRSKKRKLSSLLENFLVIFSAIKNNIPLAVYLFGYEDGEVIDETSR
FT                   TLIEDMKKKLYDSYAASPNLDKNTYSKGLLSLAFYSGIAEVFWHYQIKNHDEDDGIDLD
FT                   ELKRIFDDLYSLFSLKPNNVFLGNEISNTKRIMGKINIEDSTWHLLIKFHNKEYEGRTP
FT                   DKRNFFAHSGLEGLVTEMKKEKDKFFVRYTREYTDKSGNKKSVKNLIREWLKEEA"
FT   gene            541217..541501
FT                   /locus_tag="Toce_0531"
FT   CDS_pept        541217..541501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0531"
FT                   /product="CRISPR-associated protein, Csx3 family"
FT                   /note="InterPro IPR013409; KEGG: dtu:Dtur_0613
FT                   CRISPR-associated protein, Csx3 family; PFAM:
FT                   CRISPR-associated protein Csx3; SPTR: CRISPR-associated
FT                   protein, Csx3 family; TIGRFAM: CRISPR-associated protein,
FT                   Csx3 family; PFAM: CRISPR-associated protein (Cas_csx3);
FT                   TIGRFAM: CRISPR-associated protein, Csx3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07306"
FT                   /db_xref="InterPro:IPR013409"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1M9"
FT                   /protein_id="ADL07306.1"
FT                   /translation="MVKFDTAEYGKYTILHFELEGPINPEILKDICPPKVNSTKGLIIS
FT                   GRGPIWLYCYLVHYYHFTVFIATFDPRLGGAVIVESHIPEFKPGNVIML"
FT   repeat_region   541723..543434
FT                   /note="CRISPR"
FT   gene            543530..543841
FT                   /locus_tag="Toce_0532"
FT   CDS_pept        543530..543841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0532"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: swo:Swol_2510 transposase
FT                   IS3/IS911; PFAM: transposase IS3/IS911 family protein;
FT                   SPTR: Transposase IS3/IS911; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07307"
FT                   /db_xref="GOA:D9S1N0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N0"
FT                   /protein_id="ADL07307.1"
FT                   /translation="MKKKRYDREFKEQVVRECQEVGNIALVARRHGLSKNTVYNWLQAT
FT                   RKNGSVIPLPRDVNQRLLEAENRLESLARENDQLKRLVAEKELELAILRELRDRVNPQ"
FT   gene            543856..544794
FT                   /locus_tag="Toce_0533"
FT   CDS_pept        543856..544794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0533"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: gtn:GTNG_3490 IS1477
FT                   transposase; PFAM: Integrase catalytic region; SPTR: IS1477
FT                   transposase; manually curated; PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07308"
FT                   /db_xref="GOA:D9S1N1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N1"
FT                   /protein_id="ADL07308.1"
FT                   /translation="MAKRWVAKGYSLYLVLGFVGLAPSTFYAYESKKEPTVTADNQAKA
FT                   KAGRPKTQFSYTLDGKKVADEQIKEWLCELVCQDGFPYGYKKLTAALVEDYGLVINHKK
FT                   VYRLCKELDILKPQRICKSKHPRRLAQRIEVTGPNQLWEMDVKYGYIHGEERFFFQLSL
FT                   IDVFDRCVIDYHLGLTCTAKDARRVLCNALKKRGIKPGMQMPRLRTDNGPQFIANLFAA
FT                   ACRKLGIVHERIPVKTPNLNAHIEAFHSILEDECYSRHQFASYAEAYEQIAWYMDYYNN
FT                   RRRHGSLNNMAPQKYYQAIISNSIKPKSLVA"
FT   sig_peptide     543856..543939
FT                   /locus_tag="Toce_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   repeat_region   544868..545237
FT                   /note="CRISPR"
FT   gene            complement(545398..546069)
FT                   /pseudo
FT                   /locus_tag="Toce_0534"
FT   gene            546344..546856
FT                   /locus_tag="Toce_0535"
FT   CDS_pept        546344..546856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0535"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023; KEGG: hor:Hore_01790 NADH
FT                   dehydrogenase I subunit E; PFAM: NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit; SPTR: NADH dehydrogenase I
FT                   subunit E; PFAM: Respiratory-chain NADH dehydrogenase 24 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07309"
FT                   /db_xref="GOA:D9S1N2"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N2"
FT                   /protein_id="ADL07309.1"
FT                   /translation="MATATGHGRSFQRVDEIIEAHGRNPVNIISILQEVQNEYRYLPQD
FT                   VLNYIATAMNISPSKVYGVATFYENFSLEPKGKYVIRICDGTACHVKNSTALLNALTKK
FT                   LGLKEGQRTTEDLLFTLETVSCLGACGLAPVMVVNEEVHGKVTPEKAEEIIDEIINKER
FT                   GQNDKER"
FT   gene            546840..548717
FT                   /locus_tag="Toce_0536"
FT   CDS_pept        546840..548717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0536"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR017896:IPR017900:IPR001949:IPR011538:IPR
FT                   019554:IPR019575; KEGG: cce:Ccel_2304 respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding; PRIAM:
FT                   NADH dehydrogenase (quinone); SPTR: Respiratory-chain NADH
FT                   dehydrogenase domain 51 kDa subunit; PFAM: NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region; 4Fe-4S binding
FT                   domain; Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07310"
FT                   /db_xref="GOA:D9S1N3"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N3"
FT                   /protein_id="ADL07310.1"
FT                   /translation="MIKSVEELNKLKDECSKALAGEKMKILVCAGTGCISGGSLKVYEA
FT                   IKKLLEEKNLYVDIDLYTEDKEGVNVSPSGCHGFCQMGPIVRVEPQGYFYVKVKEEDAQ
FT                   EIVEKTVEKGEPVERLLYKSHEDGQAFMTEDSIPFYGKQSRIVLEHCGKINPENIKEYI
FT                   AAGGYQALAKALQMTPEEICQVMLKAKLRGRGGAGFPAGIKWDSVRKQKSDVKYVICNG
FT                   DEGDPGAFMDRSIMEGDPHRVIEGMIIAGYASGATQGYIYVRAEYPLAVRRLKKAIEQA
FT                   REFGLLGKNILGSGFDFDIKINMGAGAFVCGEGSALIASIEGQRGMPKTRPPRTVEKGL
FT                   FGKPTVLNNVETYANVPMIILNGADWYLSIGTETSPGTKAFALTGNIVNTGLIEVPMGT
FT                   TLREVIYEIGGGIPNGKELKAVQIGGPSGGCLTKEHLDLPLDFDTLGTVGAMIGSGGMV
FT                   VMDEDTCMVEVARFFMSFTQRESCGKCVPCREGTKRMLKLLEKITSGKGTEKDLELLEE
FT                   LAVTVKDGSLCGLGQTAPNPVLTTLKYFRDEYLAHVREKRCPAGVCQALKRYAIDATVC
FT                   KGCSKCSRVCPVGAISGEIKKPFTINPDKCIKCGACVEACPFKAVKEGK"
FT   gene            548718..550418
FT                   /locus_tag="Toce_0537"
FT   CDS_pept        548718..550418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0537"
FT                   /product="NAD(P)-dependent iron-only hydrogenase catalytic
FT                   subunit"
FT                   /note="COGs: COG4624 Iron only hydrogenase large subunit
FT                   C-terminal domain;
FT                   InterProIPR001041:IPR017896:IPR017900:IPR000283:IPR
FT                   013352:IPR019574:IPR004108:IPR003149; KEGG: hor:Hore_01810
FT                   NADH dehydrogenase I subunit G; PFAM: hydrogenase large
FT                   subunit domain protein; NADH:ubiquinone oxidoreductase,
FT                   subunit G, iron-sulphur binding; ferredoxin; iron
FT                   hydrogenase small subunit; SPTR: NADH dehydrogenase I
FT                   subunit G; TIGRFAM: hydrogenase, Fe-only; PFAM: Iron only
FT                   hydrogenase large subunit, C-terminal domain;
FT                   NADH-ubiquinone oxidoreductase-G iron-sulfur binding
FT                   region; Iron hydrogenase small subunit; TIGRFAM:
FT                   hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07311"
FT                   /db_xref="GOA:D9S1N4"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N4"
FT                   /protein_id="ADL07311.1"
FT                   /translation="MKTLKINGREVAFSDEKNLLEVIRKAGIELPTFCYHSELSTYGAC
FT                   RMCLVEDKRGNLIAACSTPPREGMEIKTHTKRLLKQRRMTLELILAEHDRDCTTCGKNG
FT                   DCKLRKLSHDLGVEEIRFGTKENYLPIDDSSEAIVRNPNKCILCGDCVRMCEEVQGIGV
FT                   IGFAHRGAKAVVTPAFNKNLCEVECVDCGQCSAVCPTGAIVVKSHIDKVWDALNDDNKV
FT                   VIAQIAPAVRVAFGEAFGLRPGESTEYLIVSALKAMGFDMVFDTCFAADLTVIEEGHEF
FT                   LERLEKGENLPLFTSCCPAWVKFVEFNYPSFLNNLSSCRSPHQMFGSFTKNYYAKELGV
FT                   SRENVYVVSIMPCTAKKAEAAREELGVDGNPDVDAVLTTRELIRMVREAGIVFKDLKEE
FT                   PFDMPFGFSTGGGIIFGATGGVAEAVVRTLDGGHRRFEQVRGSEGLKEATIVKDGKEIR
FT                   VAVVHGLKNARELLEKIKSGSVKYDMVEVMACPGGCVGGAGQPSPASTGVREERAKGLY
FT                   NIDNRMQLARSDENPMIKMLYEKWLGSPGSEVAHKYLHTHYRPRRRTEV"
FT   gene            complement(550491..550862)
FT                   /locus_tag="Toce_0538"
FT   CDS_pept        complement(550491..550862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0538"
FT                   /product="FeS cluster assembly scaffold protein NifU"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR017787:IPR002871; KEGG:
FT                   mta:Moth_1651 nitrogen-fixing NifU-like; PFAM:
FT                   nitrogen-fixing NifU domain protein; SPTR: Nitrogen-fixing
FT                   NifU-like; TIGRFAM: FeS cluster assembly scaffold protein
FT                   NifU; PFAM: NifU-like N terminal domain; TIGRFAM: FeS
FT                   cluster assembly scaffold protein NifU, Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07312"
FT                   /db_xref="GOA:D9S1N5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N5"
FT                   /protein_id="ADL07312.1"
FT                   /translation="MYNEKVLDHFSNPRNAGEIPDADGIGHAGNPVDGDSITIYIKVKD
FT                   GIIDDIKFKTFGCGAAIAASSMLTVLAKGKTLDEALKITNDQVAEALGGLPPQKLNCSN
FT                   IAADALHDAIADYKNKISR"
FT   gene            complement(550909..553539)
FT                   /locus_tag="Toce_0539"
FT   CDS_pept        complement(550909..553539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0539"
FT                   /product="Alpha-mannosidase"
FT                   /EC_number="3.2.1.24"
FT                   /note="COGs: COG0383 Alpha-mannosidase; InterPro
FT                   IPR000602:IPR011682; KEGG: tit:Thit_0527 glycoside
FT                   hydrolase family 38; PFAM: glycoside hydrolase family 38;
FT                   glycosyl hydrolase 38 domain protein; PRIAM:
FT                   Alpha-mannosidase; SPTR: Glycoside hydrolase family 38;
FT                   PFAM: Glycosyl hydrolases family 38 C-terminal domain;
FT                   Glycosyl hydrolases family 38 N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07313"
FT                   /db_xref="GOA:D9S1N6"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N6"
FT                   /protein_id="ADL07313.1"
FT                   /translation="MNLYVVCHTHWDREWHKTFHEYRVKLVEFMDDLIDLLERDENYTS
FT                   FLLDGQTVVLEDYLDVKPYMKERIRRLVKAGRLVIGPWYVQPDEFLVSGESLIRNLLIG
FT                   HEIGKDFGRVMKVGYLPDSFGQAACIPQLLKGFGIDSAVFWRGVTDEDLDKTEFLWESP
FT                   DGSRVFAVHLPLGYGNGASLSKNMAMSFETVEENLKKLASKAATNNILLMCGFDQRFAD
FT                   HDIPEIIKELNSYYKENGKDIRLIQCSIEDYIEKVKSEEPSLKVLKGEFRKGKSMRVHV
FT                   SIGGTRLDIKRDNFNTQLLYERYLEPISTMAYILGHKYDNDIINRGWKYIIQNHAHDSI
FT                   CTVCTDDTHREMKIRFEFAKQIGHTLLNEKISEISGDIAYKKEMGKPLIVFNTLMRKRK
FT                   EPVEATIYLDTEEFSLTDNEGRKIPYQIMSVKDVNLAEKEIEIGVKNPDRWVKEIKLVF
FT                   IAELDGFGYRTYYVKEHAKSNRYTGFIGAGNILENEFYRVSVEDDGSLCITDKETAKTY
FT                   RGLNIFEESGNAGDEYDFSPPKEDVVITTRGSRPEIALVENGPLFARIRISHILNVPMD
FT                   TDSMKRAEKTCPCPVDCFVTLYRGIKRVDIKTVIDNRAKNHRIRVLFDGNVEAHTHIAE
FT                   QQFGVLKRDNFLKEQECWDKEGWEERYYPVYPQRSFVDVSDGQYGLAILNKGLPQYEIL
FT                   NKDKPIIALTLLSGTDYMGKNDLRYRPGRRSGLHIAVPDSQLLGVHEVEYSIVPHKGDY
FT                   IAGDIIESAHSYITPLLSFMPLNETQGELNDELYFIKTENKGIIESSIKKSEHGPAVVL
FT                   RIYNGTDLPLRNIVLKLDDRFNAVDILDLKEEKIKNNNKVSFVENKINIPLLNENEIIS
FT                   LSLGR"
FT   gene            complement(553591..555422)
FT                   /pseudo
FT                   /locus_tag="Toce_0540"
FT   gene            complement(555412..557379)
FT                   /locus_tag="Toce_0541"
FT   CDS_pept        complement(555412..557379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0541"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG3711 Transcriptional antiterminator;
FT                   InterProIPR001034:IPR002178:IPR013011:IPR011608:IPR 007737;
FT                   KEGG: tit:Thit_0523 PTS modulated transcriptional
FT                   regulator, MtlR family; PFAM: PRD domain protein; M
FT                   trans-acting positive regulator;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; PRIAM: Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase; SPTR: PTS modulated transcriptional
FT                   regulator, MtlR family; PFAM: Mga helix-turn-helix domain;
FT                   HTH domain; PRD domain; PTS system, Lactose/Cellobiose
FT                   specific IIB subunit; Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07314"
FT                   /db_xref="GOA:D9S1N7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N7"
FT                   /protein_id="ADL07314.1"
FT                   /translation="MDLDARKKKIIEELLISKGPVTGEYLAGVLGVSSRTIRSDIKIIN
FT                   EQLKESGIKIISSPGVGYSLEYDDEEKLSGILREIMKESQGYIVPTLPEDRVRYIRGKL
FT                   LAADGFITLESLADELYVSKSTVEKDMEKVEEWFSSHNIKIFKKPNYGMKLQGSEMDLR
FT                   FAMSDHLRSLKDEKVFAVDLPDIGDIVKDVDIEVIKDVIDEVLERIPFKLSDVAYTNLI
FT                   IHIAIAVKRIRESKSIELPPGEITNLKDKMEYSVAADMVKSLESKFNISIPEAEIGYIT
FT                   MHLMGTKVLEDGSLSKEKIKKAVGEEIYRVATRMIEEVKRVYGIDFTADDELIYGLALH
FT                   LKPTITRIKYGMNLKNPLLKEIKEEYPQAFELAVVASRVLEDVYKIKVDENEMGYIAVY
FT                   FGAAIERGNYRESNQIKRVAVVCASGMGTAQLLATRIRKTFPNITITGVYPAFKSSEII
FT                   KQRPDFILSTVPLENMDIPVIEISPLLNKNDLRRLKAVILSEDEDVDRSILLKFMKEDL
FT                   FFKGISASDCFEVIDKMSDSLYQKGYVTKGFKESAKQREKISSTGIGNLVAIPHAMLGH
FT                   AIGSHIAVGILEKPIKWGSSQAQLIFMIALEKLSDREFQHIFEALYDVVDDPSLVAKLI
FT                   KARDFNEFARILKGRGRYDN"
FT   gene            complement(557517..557846)
FT                   /locus_tag="Toce_0542"
FT   CDS_pept        complement(557517..557846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0542"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: pai:PAE0273 hypothetical
FT                   protein; PFAM: DNA polymerase beta domain protein region;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07315"
FT                   /db_xref="GOA:D9S1N8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N8"
FT                   /protein_id="ADL07315.1"
FT                   /translation="MVKTKDEIMKIVRDYICNLGKYIKINKVILFGSYARDEALKSSDV
FT                   NLAIVSEDFGKMSFFERLELLYKCWNYDIGADLLGYTPEEFEELANKISFVSEIIKTGI
FT                   EITPA"
FT   gene            complement(557822..558208)
FT                   /locus_tag="Toce_0543"
FT   CDS_pept        complement(557822..558208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0543"
FT                   /product="HEPN domain protein"
FT                   /note="COGs: COG2250 conserved hypothetical protein related
FT                   to C-terminal domain of eukaryotic chaperone SACSIN;
FT                   InterPro IPR007842; KEGG: tye:THEYE_A1691 HEPN domain,
FT                   putative; PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein; SPTR: Hepn domain, putative; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07316"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1N9"
FT                   /protein_id="ADL07316.1"
FT                   /translation="MRQEVLDWVESSEYDFETAKAMFKAGRYNYCIFMCHQAVEKLLKA
FT                   LIIFLHKEFPPKTHNLITLLEMIDQNPEKEMQTIILKLNPHYMVSRSPDAAGGPSHKMY
FT                   NDQIAREFLKETERVLQWLRQKMK"
FT   gene            complement(558299..559573)
FT                   /locus_tag="Toce_0544"
FT   CDS_pept        complement(558299..559573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0544"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="COGs: COG3858 glycosyl hydrolase; InterPro
FT                   IPR012854:IPR001223; KEGG: tit:Thit_2291 copper amine
FT                   oxidase domain protein; PFAM: copper amine oxidase domain
FT                   protein; glycoside hydrolase family 18; SPTR: Copper amine
FT                   oxidase domain protein; PFAM: Copper amine oxidase
FT                   N-terminal domain; Glycosyl hydrolases family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07317"
FT                   /db_xref="GOA:D9S1P0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P0"
FT                   /protein_id="ADL07317.1"
FT                   /translation="MQKLMRLLFLTLLLFETLTGSISTPALAQEKGISVLIDGLPVYFD
FT                   VSPIIKDGRTLVPFRAISEALNVPVVWNQKTKTITASDGHINLRLRIGDKTAYRNNTPV
FT                   KLDVPPLIVNGRTLIPLRFFSEAFGCKVEWDAAASTVKITSGPKEMTVIGFYALGDSKT
FT                   SSWTNLFGKPYPEHSAGNTGAINELALGWYSLDKNGNLLTMSTTGWQRPPGWENVLQAA
FT                   SLYNLRTEMVIHATDSGGDITGLFSSKEAMEKLAAAIAEESKLYSGVNLDLEGLGLNES
FT                   QEVLLQTRQNFTYFVRILSERLDPSKTLTLTLHAPNSAYKGYDYRALGEIADRIIIMAY
FT                   DYGTSPEPVNLVLQAVEKAKAEVPPGKLILGISIPNETAQSMIAKIGIAKRHRLAGIAL
FT                   WRLGLISKDEWELLRNTVVPVAFLR"
FT   sig_peptide     complement(559490..559573)
FT                   /locus_tag="Toce_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            559757..560983
FT                   /locus_tag="Toce_0545"
FT   CDS_pept        559757..560983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0545"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG2972 signal transduction protein with a
FT                   C-terminal ATPase domain; InterPro
FT                   IPR003594:IPR018771:IPR010559:IPR004358; KEGG:
FT                   tex:Teth514_1959 histidine kinase; PFAM: Transcription
FT                   regulator,histidine kinase sensor-like; histidine kinase
FT                   internal region; ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; SPTR:
FT                   Histidine kinase; PFAM: Histidine kinase; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; Predicted
FT                   histidine kinase sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07318"
FT                   /db_xref="GOA:D9S1P1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P1"
FT                   /protein_id="ADL07318.1"
FT                   /translation="MTRYMLKDVIDKEKLEEILKKFSEATGLAAIIADRSGVNITEPSN
FT                   FTKHCNLVRSTEKGRKYCYFSDAKLGRLSLKKGGPATSLCYCEIVDLAAPLVVEGHCLG
FT                   YILCGQVFLRPPDEEKIERARKRALDFGLDPDLYVKAFLEIETVPKKHIYTTGEMLHII
FT                   SNYIIELGVNSLYQKRLLEETKRRSEYENAIKTLELKALQSQVNPHFLFNTLNTAARLA
FT                   YLENAEKTAEIIYSLANLLRYSLKNLDQLVPLKEEISCIGYYLYIQQFRYKDHIRAEIE
FT                   FPKELEKYLIPVLSLQPLVENAIVHGLEKKKEGGQVRVVGYEKDTCVFIDIIDDGVGIQ
FT                   EEVLNNINKPKIALEGHTTGLGIHNVDLRIKKYFGDNYGLKIESKVGVGTKVTLKIPKV
FT                   VNRGIGHEL"
FT   gene            560973..562571
FT                   /locus_tag="Toce_0546"
FT   CDS_pept        560973..562571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0546"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="COGs: COG4753 Response regulator containing
FT                   CheY-like receiver domain and AraC-type DNA-binding domain;
FT                   InterProIPR018060:IPR001789:IPR018062:IPR000005:IPR 020449;
FT                   KEGG: tex:Teth514_1958 response regulator receiver protein;
FT                   PFAM: response regulator receiver; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: response regulator
FT                   receiver; Helix-turn-helix, AraC domain; SPTR: Response
FT                   regulator receiver protein; PFAM: Response regulator
FT                   receiver domain; Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07319"
FT                   /db_xref="GOA:D9S1P2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P2"
FT                   /protein_id="ADL07319.1"
FT                   /translation="MSYKVLVCDDEALEREVISLIIQKSGLPFLTVGEARNGYEAVEKA
FT                   RELKPDVIFMDIKMPGKDGLTATAEIKDILPQMKVIITTAYDDFEFAKEALRLGSIDYL
FT                   LKPIRPEEFIAVLNKLLNLFEREMMSRKQEEELKKAIKKAEKMIKGGILASLIMGEAEK
FT                   DEERDILLKQAQLLDITSLPNALLIVEPNIDELNTGAVYERYKVFKIAEELIGDLNDVF
FT                   LLNLGESLVIGIQKDNIDPQVLASAIQKKVEENTDFCVTISIGEASDIINKTIYEETKA
FT                   NARLGRFFFGGKVVNKQEMDELMKSSEKADDEMESRLLDYVTMANYQEALRLFEEIINN
FT                   LVIKSRGSLLFCQTRIAEIMLLIWRSVRKLGWVDNNSSHLYFNYLKKLSKAQSLYALTE
FT                   CCRNYLSDLFVLNKRFKERNGIVNAVVKYINENYDKDLKLKDITKMVYLNSEYFSRLFK
FT                   KEVGCTYAEYLTRVRVEAARKYLSNPALTVADVARKVGYHDPNYFSKVFKKAVGVSPTE
FT                   YRVSLGITQNEQSLA"
FT   gene            562774..563052
FT                   /locus_tag="Toce_0547"
FT   CDS_pept        562774..563052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0547"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro
FT                   IPR020808:IPR000249; KEGG: tex:Teth514_1955
FT                   microcompartments protein; PFAM: microcompartments protein;
FT                   SPTR: Microcompartments protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07320"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P3"
FT                   /protein_id="ADL07320.1"
FT                   /translation="MNGEALGMVETKGLIPAIEAADAMVKAANVKLVGYEKIGSGLVTV
FT                   MVRGDVGATKAATDAGAAAARKVGEVVSVHVIPRPHSDVEKILPKSE"
FT   gene            563085..563864
FT                   /locus_tag="Toce_0548"
FT   CDS_pept        563085..563864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0548"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4816 Ethanolamine utilization protein;
FT                   InterPro IPR009193:IPR000249; KEGG: tex:Teth514_1954
FT                   microcompartments protein; PFAM: microcompartments protein;
FT                   SPTR: Microcompartments protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07321"
FT                   /db_xref="GOA:D9S1P4"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030984"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P4"
FT                   /protein_id="ADL07321.1"
FT                   /translation="MDELTIKKLVKEIIGKVDAEEKKPACPAITNPGVTEFVGTAIGDT
FT                   IGLVIANIDSKLLEKTGLDKRFRSIGILGSRTGAGPQIMAADEAVKATNTEIVAVELAR
FT                   DTKGGAGHGSLIIFGAEEVSDARRAVEVALKELPRTFGDVYANDAGHLEFQYTARASYA
FT                   VEKAFGAPLGKAFGLIVGAPAAIGVVCCDTAVKAAEVDIVGYASPAKGTSFTNEAILFI
FT                   SGDSGAVRQALIAAREIGKKLLATLGEEPKPLSTPYI"
FT   gene            563889..565556
FT                   /locus_tag="Toce_0549"
FT   CDS_pept        563889..565556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0549"
FT                   /product="Glycerol dehydratase"
FT                   /EC_number="4.2.1.30"
FT                   /note="COGs: COG4909 Propanediol dehydratase large subunit;
FT                   InterPro IPR003206; KEGG: tex:Teth514_1953 glycerol
FT                   dehydratase; PFAM: dehydratase large subunit; PRIAM:
FT                   Glycerol dehydratase; SPTR: Glycerol dehydratase; PFAM:
FT                   Dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07322"
FT                   /db_xref="GOA:D9S1P5"
FT                   /db_xref="InterPro:IPR003206"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036999"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P5"
FT                   /protein_id="ADL07322.1"
FT                   /translation="MKSKRFQVLAERPVNKDGFVAEWPEVGLVAVDSPNDPKPGIKIEN
FT                   GKIVEMDGKKREDFDMIEQFIADYAIDVEMAEKAMKMDSLEIARMLVDINVPREQVVKI
FT                   ASGLTPAKIVEVVKMLNVVEIMMAIQKMRARKRPGNQCHVTNLRDNPVLIAADAAEAAL
FT                   RGFDEEETTVGITRYAPFNALALLIGSQTGRGGVLTQCALEEAFELTIGMRGFTSYAET
FT                   ISVYGTEQVFVDGDDTPWSKAFLASAYASRGLKMRFTSGTGSEVQMGYAEGKSMLYLET
FT                   RCAMIAKGAGVQGLQNGSISCIGVPGAVPSGIRIVAGENLITTMLDLEVASGSDQTFSH
FT                   SDIRRTARTLLLMLPGTDLIFSGYSAVPNYDNMFAGSNFDIEDVDDYLALQRDLMVDGG
FT                   LRPVTEEEVIAVRNKAARALQAVFKKLGLPPITDEEVEAATYAHGSKDMPLRDVNEDLK
FT                   AATEIMNRGIHGLDIVKALAESGFTDVAQNIFNMLKQRVAGDYLHTSAVLDEDFNIDSA
FT                   VNNPNDYMGPGTGYRLSAERWEEIKNIPQALRPEDFNK"
FT   gene            565587..566261
FT                   /locus_tag="Toce_0550"
FT   CDS_pept        565587..566261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0550"
FT                   /product="dehydratase medium subunit"
FT                   /note="InterPro IPR003208; KEGG: tex:Teth514_1952
FT                   dehydratase, medium subunit; PFAM: dehydratase medium
FT                   subunit; SPTR: Dehydratase, medium subunit; PFAM:
FT                   Dehydratase medium subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Toce_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL07323"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="InterPro:IPR025541"
FT                   /db_xref="UniProtKB/TrEMBL:D9S1P6"
FT                   /protein_id="ADL07323.1"
FT                   /translation="MINTEMVVEEVVKEVLKRLAGEREKVAEDYAVGNPAGKELLLEEM
FT                   GEAKPGAREEEVVIGVSPAFGVKFKENINGIPLADILREIMAGIAEEGLNSRVIRVRHT
FT                   ADVAFIGHTAAKLSGSGVGIGIQSRGTAVIHHKDLQPLNNLELFPQCPVMTLDTYRAIG
FT                   KNAALYAKGESPTPVPVMNDQMARPKFQAKAAVMHNFETQYVKPGLKPVELKVCFSKGG
FT                   TS"
FT   gene            566261..566776
FT                   /locus_tag="Toce_0551"
FT   CDS_pept        566261..566776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Toce_0551"
FT                   /product="dehydratase small subunit"
FT                   /note="COGs: COG4910 Propanediol dehydratase small subunit;
FT                   InterPro IPR003207; KEGG: tex:Teth514_1951 dehydratase,
FT