(data stored in SCRATCH zone)

EMBL: CP002154

ID   CP002154; SV 1; circular; genomic DNA; STD; PRO; 3684607 BP.
XX
AC   CP002154;
XX
PR   Project:PRJNA45969;
XX
DT   07-SEP-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Edwardsiella tarda FL6-60, complete genome.
XX
KW   .
XX
OS   Edwardsiella tarda FL6-60
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Hafniaceae; Edwardsiella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3684607
RX   DOI; 10.1186/1471-2172-12-58.
RX   PUBMED; 22003892.
RA   van Soest J.J., Stockhammer O.W., Ordas A., Bloemberg G.V., Spaink H.P.,
RA   Meijer A.H.;
RT   "Comparison of static immersion and intravenous injection systems for
RT   exposure of zebrafish embryos to the natural pathogen Edwardsiella tarda";
RL   BMC Immunol. 12:58-58(2011).
XX
RN   [2]
RP   1-3684607
RA   van Soest J.J., Henkel C.V., Jansen H.J., van den Hondel C.A.M.J.J.,
RA   Bloemberg G.V., Meijer A.H., Spaink H.P.;
RT   "Genome comparisons of Edwardsiella bacteria analysed using deep sequencing
RT   technology";
RL   Unpublished.
XX
RN   [3]
RP   1-3684607
RA   van Soest J.J., Henkel C.V., Jansen H.J., van den Hondel C.A.M.J.J.,
RA   Bloemberg G.V., Meijer A.H., Spaink H.P.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Molecular Cell Biology, Leiden University, Institute of Biology,
RL   Einsteinweg 55, Leiden, Zuid Holland 2333 CC, The Netherlands
XX
DR   MD5; b3a33dcf2afb5b7ce31e78dcf7179482.
DR   BioSample; SAMN02603331.
DR   EnsemblGenomes-Gn; EBG00001070326.
DR   EnsemblGenomes-Gn; EBG00001070327.
DR   EnsemblGenomes-Gn; EBG00001070328.
DR   EnsemblGenomes-Gn; EBG00001070329.
DR   EnsemblGenomes-Gn; EBG00001070330.
DR   EnsemblGenomes-Gn; EBG00001070331.
DR   EnsemblGenomes-Gn; EBG00001070332.
DR   EnsemblGenomes-Gn; EBG00001070333.
DR   EnsemblGenomes-Gn; EBG00001070334.
DR   EnsemblGenomes-Gn; EBG00001070335.
DR   EnsemblGenomes-Gn; EBG00001070336.
DR   EnsemblGenomes-Gn; EBG00001070337.
DR   EnsemblGenomes-Gn; EBG00001070338.
DR   EnsemblGenomes-Gn; EBG00001070339.
DR   EnsemblGenomes-Gn; EBG00001070340.
DR   EnsemblGenomes-Gn; EBG00001070341.
DR   EnsemblGenomes-Gn; EBG00001070342.
DR   EnsemblGenomes-Gn; EBG00001070343.
DR   EnsemblGenomes-Gn; EBG00001070344.
DR   EnsemblGenomes-Gn; EBG00001070345.
DR   EnsemblGenomes-Gn; EBG00001070346.
DR   EnsemblGenomes-Gn; EBG00001070347.
DR   EnsemblGenomes-Gn; EBG00001070348.
DR   EnsemblGenomes-Gn; EBG00001070349.
DR   EnsemblGenomes-Gn; EBG00001070350.
DR   EnsemblGenomes-Gn; EBG00001070351.
DR   EnsemblGenomes-Gn; EBG00001070352.
DR   EnsemblGenomes-Gn; EBG00001070353.
DR   EnsemblGenomes-Gn; EBG00001070354.
DR   EnsemblGenomes-Gn; EBG00001070355.
DR   EnsemblGenomes-Gn; EBG00001070356.
DR   EnsemblGenomes-Gn; EBG00001070357.
DR   EnsemblGenomes-Gn; EBG00001070358.
DR   EnsemblGenomes-Gn; EBG00001070359.
DR   EnsemblGenomes-Gn; EBG00001070360.
DR   EnsemblGenomes-Gn; EBG00001070361.
DR   EnsemblGenomes-Gn; EBG00001070362.
DR   EnsemblGenomes-Gn; EBG00001070363.
DR   EnsemblGenomes-Gn; EBG00001070364.
DR   EnsemblGenomes-Gn; EBG00001070365.
DR   EnsemblGenomes-Gn; EBG00001070366.
DR   EnsemblGenomes-Gn; EBG00001070367.
DR   EnsemblGenomes-Gn; EBG00001070368.
DR   EnsemblGenomes-Gn; EBG00001070369.
DR   EnsemblGenomes-Gn; EBG00001070370.
DR   EnsemblGenomes-Gn; EBG00001070371.
DR   EnsemblGenomes-Gn; EBG00001070372.
DR   EnsemblGenomes-Gn; EBG00001070373.
DR   EnsemblGenomes-Gn; EBG00001070374.
DR   EnsemblGenomes-Gn; EBG00001070375.
DR   EnsemblGenomes-Gn; EBG00001070376.
DR   EnsemblGenomes-Gn; EBG00001070377.
DR   EnsemblGenomes-Gn; EBG00001070378.
DR   EnsemblGenomes-Gn; EBG00001070379.
DR   EnsemblGenomes-Gn; EBG00001070380.
DR   EnsemblGenomes-Gn; EBG00001070381.
DR   EnsemblGenomes-Gn; EBG00001070382.
DR   EnsemblGenomes-Gn; EBG00001070383.
DR   EnsemblGenomes-Gn; EBG00001070384.
DR   EnsemblGenomes-Gn; EBG00001070385.
DR   EnsemblGenomes-Gn; EBG00001070386.
DR   EnsemblGenomes-Gn; EBG00001070387.
DR   EnsemblGenomes-Gn; EBG00001070388.
DR   EnsemblGenomes-Gn; EBG00001070389.
DR   EnsemblGenomes-Gn; EBG00001070390.
DR   EnsemblGenomes-Gn; EBG00001070391.
DR   EnsemblGenomes-Gn; EBG00001070392.
DR   EnsemblGenomes-Gn; EBG00001070393.
DR   EnsemblGenomes-Gn; EBG00001070394.
DR   EnsemblGenomes-Gn; EBG00001070395.
DR   EnsemblGenomes-Gn; EBG00001070396.
DR   EnsemblGenomes-Gn; EBG00001070397.
DR   EnsemblGenomes-Gn; EBG00001070398.
DR   EnsemblGenomes-Gn; EBG00001070399.
DR   EnsemblGenomes-Gn; EBG00001070400.
DR   EnsemblGenomes-Gn; EBG00001070401.
DR   EnsemblGenomes-Gn; EBG00001070402.
DR   EnsemblGenomes-Gn; EBG00001070403.
DR   EnsemblGenomes-Gn; EBG00001070404.
DR   EnsemblGenomes-Gn; EBG00001070405.
DR   EnsemblGenomes-Gn; EBG00001070406.
DR   EnsemblGenomes-Gn; EBG00001070407.
DR   EnsemblGenomes-Gn; EBG00001070408.
DR   EnsemblGenomes-Gn; EBG00001070409.
DR   EnsemblGenomes-Gn; EBG00001070410.
DR   EnsemblGenomes-Gn; EBG00001070411.
DR   EnsemblGenomes-Gn; EBG00001070412.
DR   EnsemblGenomes-Gn; EBG00001070413.
DR   EnsemblGenomes-Gn; EBG00001070414.
DR   EnsemblGenomes-Gn; EBG00001070415.
DR   EnsemblGenomes-Gn; EBG00001070416.
DR   EnsemblGenomes-Gn; EBG00001070417.
DR   EnsemblGenomes-Gn; EBG00001070418.
DR   EnsemblGenomes-Gn; EBG00001070419.
DR   EnsemblGenomes-Gn; EBG00001070420.
DR   EnsemblGenomes-Gn; EBG00001070421.
DR   EnsemblGenomes-Gn; EBG00001070422.
DR   EnsemblGenomes-Gn; EBG00001070423.
DR   EnsemblGenomes-Gn; EBG00001070424.
DR   EnsemblGenomes-Gn; EBG00001070425.
DR   EnsemblGenomes-Gn; EBG00001070426.
DR   EnsemblGenomes-Gn; EBG00001070427.
DR   EnsemblGenomes-Gn; EBG00001070428.
DR   EnsemblGenomes-Gn; EBG00001070429.
DR   EnsemblGenomes-Gn; EBG00001070430.
DR   EnsemblGenomes-Gn; EBG00001070431.
DR   EnsemblGenomes-Gn; EBG00001070432.
DR   EnsemblGenomes-Gn; EBG00001070433.
DR   EnsemblGenomes-Gn; EBG00001070434.
DR   EnsemblGenomes-Gn; EBG00001070435.
DR   EnsemblGenomes-Gn; EBG00001070436.
DR   EnsemblGenomes-Gn; EBG00001070437.
DR   EnsemblGenomes-Gn; EBG00001070438.
DR   EnsemblGenomes-Gn; EBG00001070439.
DR   EnsemblGenomes-Gn; EBG00001070440.
DR   EnsemblGenomes-Gn; EBG00001070441.
DR   EnsemblGenomes-Gn; EBG00001070442.
DR   EnsemblGenomes-Gn; EBG00001070443.
DR   EnsemblGenomes-Gn; EBG00001070444.
DR   EnsemblGenomes-Gn; EBG00001070445.
DR   EnsemblGenomes-Gn; EBG00001070446.
DR   EnsemblGenomes-Gn; EBG00001070447.
DR   EnsemblGenomes-Gn; EBG00001070448.
DR   EnsemblGenomes-Gn; EBG00001070449.
DR   EnsemblGenomes-Gn; EBG00001070450.
DR   EnsemblGenomes-Gn; EBG00001070451.
DR   EnsemblGenomes-Gn; EBG00001070452.
DR   EnsemblGenomes-Gn; EBG00001070453.
DR   EnsemblGenomes-Gn; EBG00001070454.
DR   EnsemblGenomes-Gn; EBG00001070455.
DR   EnsemblGenomes-Gn; EBG00001070456.
DR   EnsemblGenomes-Gn; EBG00001070457.
DR   EnsemblGenomes-Gn; EBG00001070458.
DR   EnsemblGenomes-Gn; EBG00001070459.
DR   EnsemblGenomes-Gn; EBG00001070460.
DR   EnsemblGenomes-Gn; EBG00001070461.
DR   EnsemblGenomes-Gn; EBG00001070462.
DR   EnsemblGenomes-Gn; EBG00001070463.
DR   EnsemblGenomes-Gn; EBG00001070464.
DR   EnsemblGenomes-Gn; EBG00001070465.
DR   EnsemblGenomes-Gn; EBG00001070466.
DR   EnsemblGenomes-Gn; EBG00001070467.
DR   EnsemblGenomes-Gn; EBG00001070468.
DR   EnsemblGenomes-Gn; EBG00001070469.
DR   EnsemblGenomes-Gn; EBG00001070470.
DR   EnsemblGenomes-Gn; EBG00001070471.
DR   EnsemblGenomes-Gn; EBG00001070472.
DR   EnsemblGenomes-Gn; EBG00001070473.
DR   EnsemblGenomes-Gn; EBG00001070474.
DR   EnsemblGenomes-Gn; EBG00001070475.
DR   EnsemblGenomes-Gn; EBG00001070476.
DR   EnsemblGenomes-Gn; EBG00001070477.
DR   EnsemblGenomes-Gn; EBG00001070478.
DR   EnsemblGenomes-Gn; EBG00001070479.
DR   EnsemblGenomes-Gn; EBG00001070480.
DR   EnsemblGenomes-Gn; EBG00001070482.
DR   EnsemblGenomes-Gn; EBG00001070484.
DR   EnsemblGenomes-Gn; EBG00001070485.
DR   EnsemblGenomes-Gn; EBG00001070486.
DR   EnsemblGenomes-Gn; EBG00001070487.
DR   EnsemblGenomes-Gn; EBG00001070488.
DR   EnsemblGenomes-Gn; EBG00001070489.
DR   EnsemblGenomes-Gn; EBG00001070490.
DR   EnsemblGenomes-Gn; EBG00001070493.
DR   EnsemblGenomes-Gn; EBG00001070495.
DR   EnsemblGenomes-Gn; EBG00001070497.
DR   EnsemblGenomes-Gn; EBG00001070498.
DR   EnsemblGenomes-Gn; EBG00001070500.
DR   EnsemblGenomes-Gn; EBG00001070502.
DR   EnsemblGenomes-Gn; EBG00001070504.
DR   EnsemblGenomes-Gn; EBG00001070505.
DR   EnsemblGenomes-Gn; EBG00001070507.
DR   EnsemblGenomes-Gn; EBG00001070509.
DR   EnsemblGenomes-Gn; EBG00001070511.
DR   EnsemblGenomes-Gn; ETAF_3215.
DR   EnsemblGenomes-Gn; ETAF_3216.
DR   EnsemblGenomes-Gn; ETAF_3217.
DR   EnsemblGenomes-Gn; ETAF_3218.
DR   EnsemblGenomes-Gn; ETAF_3219.
DR   EnsemblGenomes-Gn; ETAF_3220.
DR   EnsemblGenomes-Gn; ETAF_3221.
DR   EnsemblGenomes-Gn; ETAF_3222.
DR   EnsemblGenomes-Gn; ETAF_3223.
DR   EnsemblGenomes-Gn; ETAF_3224.
DR   EnsemblGenomes-Gn; ETAF_3225.
DR   EnsemblGenomes-Gn; ETAF_3226.
DR   EnsemblGenomes-Gn; ETAF_3227.
DR   EnsemblGenomes-Gn; ETAF_3228.
DR   EnsemblGenomes-Gn; ETAF_3229.
DR   EnsemblGenomes-Gn; ETAF_3230.
DR   EnsemblGenomes-Gn; ETAF_3231.
DR   EnsemblGenomes-Gn; ETAF_3232.
DR   EnsemblGenomes-Gn; ETAF_3233.
DR   EnsemblGenomes-Gn; ETAF_3234.
DR   EnsemblGenomes-Gn; ETAF_3235.
DR   EnsemblGenomes-Gn; ETAF_3236.
DR   EnsemblGenomes-Gn; ETAF_3237.
DR   EnsemblGenomes-Gn; ETAF_3238.
DR   EnsemblGenomes-Gn; ETAF_3239.
DR   EnsemblGenomes-Gn; ETAF_3240.
DR   EnsemblGenomes-Gn; ETAF_3241.
DR   EnsemblGenomes-Gn; ETAF_3242.
DR   EnsemblGenomes-Gn; ETAF_3243.
DR   EnsemblGenomes-Gn; ETAF_3244.
DR   EnsemblGenomes-Gn; ETAF_3245.
DR   EnsemblGenomes-Gn; ETAF_3246.
DR   EnsemblGenomes-Gn; ETAF_3247.
DR   EnsemblGenomes-Gn; ETAF_3248.
DR   EnsemblGenomes-Gn; ETAF_3249.
DR   EnsemblGenomes-Gn; ETAF_3250.
DR   EnsemblGenomes-Gn; ETAF_3251.
DR   EnsemblGenomes-Gn; ETAF_3252.
DR   EnsemblGenomes-Gn; ETAF_3253.
DR   EnsemblGenomes-Gn; ETAF_3254.
DR   EnsemblGenomes-Gn; ETAF_3255.
DR   EnsemblGenomes-Gn; ETAF_3256.
DR   EnsemblGenomes-Gn; ETAF_3257.
DR   EnsemblGenomes-Gn; ETAF_3258.
DR   EnsemblGenomes-Gn; ETAF_3259.
DR   EnsemblGenomes-Gn; ETAF_3260.
DR   EnsemblGenomes-Gn; ETAF_3261.
DR   EnsemblGenomes-Gn; ETAF_3262.
DR   EnsemblGenomes-Gn; ETAF_3263.
DR   EnsemblGenomes-Gn; ETAF_3264.
DR   EnsemblGenomes-Gn; ETAF_3265.
DR   EnsemblGenomes-Gn; ETAF_3266.
DR   EnsemblGenomes-Gn; ETAF_3267.
DR   EnsemblGenomes-Gn; ETAF_3268.
DR   EnsemblGenomes-Gn; ETAF_3269.
DR   EnsemblGenomes-Gn; ETAF_3270.
DR   EnsemblGenomes-Gn; ETAF_3271.
DR   EnsemblGenomes-Gn; ETAF_3272.
DR   EnsemblGenomes-Gn; ETAF_3273.
DR   EnsemblGenomes-Gn; ETAF_3274.
DR   EnsemblGenomes-Gn; ETAF_3275.
DR   EnsemblGenomes-Gn; ETAF_3276.
DR   EnsemblGenomes-Gn; ETAF_3277.
DR   EnsemblGenomes-Gn; ETAF_3278.
DR   EnsemblGenomes-Gn; ETAF_3279.
DR   EnsemblGenomes-Gn; ETAF_3280.
DR   EnsemblGenomes-Gn; ETAF_3281.
DR   EnsemblGenomes-Gn; ETAF_3282.
DR   EnsemblGenomes-Gn; ETAF_3283.
DR   EnsemblGenomes-Gn; ETAF_3284.
DR   EnsemblGenomes-Gn; ETAF_3285.
DR   EnsemblGenomes-Gn; ETAF_3286.
DR   EnsemblGenomes-Gn; ETAF_3287.
DR   EnsemblGenomes-Gn; ETAF_3288.
DR   EnsemblGenomes-Gn; ETAF_3289.
DR   EnsemblGenomes-Gn; ETAF_3290.
DR   EnsemblGenomes-Gn; ETAF_3291.
DR   EnsemblGenomes-Gn; ETAF_3292.
DR   EnsemblGenomes-Gn; ETAF_3293.
DR   EnsemblGenomes-Gn; ETAF_3294.
DR   EnsemblGenomes-Gn; ETAF_3295.
DR   EnsemblGenomes-Gn; ETAF_3296.
DR   EnsemblGenomes-Gn; ETAF_3297.
DR   EnsemblGenomes-Gn; ETAF_3298.
DR   EnsemblGenomes-Gn; ETAF_3299.
DR   EnsemblGenomes-Gn; ETAF_3300.
DR   EnsemblGenomes-Gn; ETAF_3301.
DR   EnsemblGenomes-Gn; ETAF_3302.
DR   EnsemblGenomes-Gn; ETAF_3303.
DR   EnsemblGenomes-Gn; ETAF_3304.
DR   EnsemblGenomes-Gn; ETAF_3305.
DR   EnsemblGenomes-Gn; ETAF_3306.
DR   EnsemblGenomes-Gn; ETAF_3307.
DR   EnsemblGenomes-Gn; ETAF_3308.
DR   EnsemblGenomes-Gn; ETAF_3309.
DR   EnsemblGenomes-Gn; ETAF_3310.
DR   EnsemblGenomes-Gn; ETAF_3311.
DR   EnsemblGenomes-Gn; ETAF_3312.
DR   EnsemblGenomes-Gn; ETAF_3313.
DR   EnsemblGenomes-Gn; ETAF_3314.
DR   EnsemblGenomes-Gn; ETAF_3315.
DR   EnsemblGenomes-Gn; ETAF_3316.
DR   EnsemblGenomes-Gn; ETAF_3317.
DR   EnsemblGenomes-Gn; ETAF_3318.
DR   EnsemblGenomes-Gn; ETAF_3319.
DR   EnsemblGenomes-Gn; ETAF_3320.
DR   EnsemblGenomes-Gn; ETAF_3321.
DR   EnsemblGenomes-Gn; ETAF_3322.
DR   EnsemblGenomes-Gn; ETAF_3323.
DR   EnsemblGenomes-Gn; ETAF_3324.
DR   EnsemblGenomes-Gn; ETAF_3325.
DR   EnsemblGenomes-Gn; ETAF_3326.
DR   EnsemblGenomes-Gn; ETAF_3327.
DR   EnsemblGenomes-Gn; ETAF_3328.
DR   EnsemblGenomes-Gn; ETAF_3329.
DR   EnsemblGenomes-Gn; ETAF_3330.
DR   EnsemblGenomes-Gn; ETAF_3331.
DR   EnsemblGenomes-Gn; ETAF_3332.
DR   EnsemblGenomes-Gn; ETAF_3333.
DR   EnsemblGenomes-Gn; ETAF_3334.
DR   EnsemblGenomes-Tr; EBT00001672892.
DR   EnsemblGenomes-Tr; EBT00001672893.
DR   EnsemblGenomes-Tr; EBT00001672894.
DR   EnsemblGenomes-Tr; EBT00001672895.
DR   EnsemblGenomes-Tr; EBT00001672896.
DR   EnsemblGenomes-Tr; EBT00001672897.
DR   EnsemblGenomes-Tr; EBT00001672898.
DR   EnsemblGenomes-Tr; EBT00001672899.
DR   EnsemblGenomes-Tr; EBT00001672900.
DR   EnsemblGenomes-Tr; EBT00001672901.
DR   EnsemblGenomes-Tr; EBT00001672902.
DR   EnsemblGenomes-Tr; EBT00001672903.
DR   EnsemblGenomes-Tr; EBT00001672904.
DR   EnsemblGenomes-Tr; EBT00001672905.
DR   EnsemblGenomes-Tr; EBT00001672906.
DR   EnsemblGenomes-Tr; EBT00001672907.
DR   EnsemblGenomes-Tr; EBT00001672908.
DR   EnsemblGenomes-Tr; EBT00001672909.
DR   EnsemblGenomes-Tr; EBT00001672910.
DR   EnsemblGenomes-Tr; EBT00001672911.
DR   EnsemblGenomes-Tr; EBT00001672912.
DR   EnsemblGenomes-Tr; EBT00001672913.
DR   EnsemblGenomes-Tr; EBT00001672914.
DR   EnsemblGenomes-Tr; EBT00001672915.
DR   EnsemblGenomes-Tr; EBT00001672916.
DR   EnsemblGenomes-Tr; EBT00001672917.
DR   EnsemblGenomes-Tr; EBT00001672918.
DR   EnsemblGenomes-Tr; EBT00001672919.
DR   EnsemblGenomes-Tr; EBT00001672920.
DR   EnsemblGenomes-Tr; EBT00001672921.
DR   EnsemblGenomes-Tr; EBT00001672923.
DR   EnsemblGenomes-Tr; EBT00001672926.
DR   EnsemblGenomes-Tr; EBT00001672928.
DR   EnsemblGenomes-Tr; EBT00001672931.
DR   EnsemblGenomes-Tr; EBT00001672933.
DR   EnsemblGenomes-Tr; EBT00001672937.
DR   EnsemblGenomes-Tr; EBT00001672938.
DR   EnsemblGenomes-Tr; EBT00001672940.
DR   EnsemblGenomes-Tr; EBT00001672942.
DR   EnsemblGenomes-Tr; EBT00001672944.
DR   EnsemblGenomes-Tr; EBT00001672946.
DR   EnsemblGenomes-Tr; EBT00001672947.
DR   EnsemblGenomes-Tr; EBT00001672950.
DR   EnsemblGenomes-Tr; EBT00001672951.
DR   EnsemblGenomes-Tr; EBT00001672953.
DR   EnsemblGenomes-Tr; EBT00001672956.
DR   EnsemblGenomes-Tr; EBT00001672959.
DR   EnsemblGenomes-Tr; EBT00001672960.
DR   EnsemblGenomes-Tr; EBT00001672962.
DR   EnsemblGenomes-Tr; EBT00001672963.
DR   EnsemblGenomes-Tr; EBT00001672965.
DR   EnsemblGenomes-Tr; EBT00001672967.
DR   EnsemblGenomes-Tr; EBT00001672969.
DR   EnsemblGenomes-Tr; EBT00001672972.
DR   EnsemblGenomes-Tr; EBT00001672973.
DR   EnsemblGenomes-Tr; EBT00001672975.
DR   EnsemblGenomes-Tr; EBT00001672976.
DR   EnsemblGenomes-Tr; EBT00001672978.
DR   EnsemblGenomes-Tr; EBT00001672980.
DR   EnsemblGenomes-Tr; EBT00001672982.
DR   EnsemblGenomes-Tr; EBT00001672984.
DR   EnsemblGenomes-Tr; EBT00001672986.
DR   EnsemblGenomes-Tr; EBT00001672988.
DR   EnsemblGenomes-Tr; EBT00001672990.
DR   EnsemblGenomes-Tr; EBT00001672992.
DR   EnsemblGenomes-Tr; EBT00001672993.
DR   EnsemblGenomes-Tr; EBT00001672995.
DR   EnsemblGenomes-Tr; EBT00001672996.
DR   EnsemblGenomes-Tr; EBT00001672998.
DR   EnsemblGenomes-Tr; EBT00001672999.
DR   EnsemblGenomes-Tr; EBT00001673001.
DR   EnsemblGenomes-Tr; EBT00001673003.
DR   EnsemblGenomes-Tr; EBT00001673005.
DR   EnsemblGenomes-Tr; EBT00001673006.
DR   EnsemblGenomes-Tr; EBT00001673008.
DR   EnsemblGenomes-Tr; EBT00001673011.
DR   EnsemblGenomes-Tr; EBT00001673013.
DR   EnsemblGenomes-Tr; EBT00001673015.
DR   EnsemblGenomes-Tr; EBT00001673017.
DR   EnsemblGenomes-Tr; EBT00001673019.
DR   EnsemblGenomes-Tr; EBT00001673021.
DR   EnsemblGenomes-Tr; EBT00001673023.
DR   EnsemblGenomes-Tr; EBT00001673025.
DR   EnsemblGenomes-Tr; EBT00001673026.
DR   EnsemblGenomes-Tr; EBT00001673030.
DR   EnsemblGenomes-Tr; EBT00001673032.
DR   EnsemblGenomes-Tr; EBT00001673034.
DR   EnsemblGenomes-Tr; EBT00001673037.
DR   EnsemblGenomes-Tr; EBT00001673041.
DR   EnsemblGenomes-Tr; EBT00001673043.
DR   EnsemblGenomes-Tr; EBT00001673045.
DR   EnsemblGenomes-Tr; EBT00001673047.
DR   EnsemblGenomes-Tr; EBT00001673049.
DR   EnsemblGenomes-Tr; EBT00001673050.
DR   EnsemblGenomes-Tr; EBT00001673051.
DR   EnsemblGenomes-Tr; EBT00001673052.
DR   EnsemblGenomes-Tr; EBT00001673053.
DR   EnsemblGenomes-Tr; EBT00001673054.
DR   EnsemblGenomes-Tr; EBT00001673055.
DR   EnsemblGenomes-Tr; EBT00001673056.
DR   EnsemblGenomes-Tr; EBT00001673057.
DR   EnsemblGenomes-Tr; EBT00001673058.
DR   EnsemblGenomes-Tr; EBT00001673059.
DR   EnsemblGenomes-Tr; EBT00001673060.
DR   EnsemblGenomes-Tr; EBT00001673061.
DR   EnsemblGenomes-Tr; EBT00001673062.
DR   EnsemblGenomes-Tr; EBT00001673063.
DR   EnsemblGenomes-Tr; EBT00001673064.
DR   EnsemblGenomes-Tr; EBT00001673065.
DR   EnsemblGenomes-Tr; EBT00001673066.
DR   EnsemblGenomes-Tr; EBT00001673067.
DR   EnsemblGenomes-Tr; EBT00001673068.
DR   EnsemblGenomes-Tr; EBT00001673069.
DR   EnsemblGenomes-Tr; EBT00001673070.
DR   EnsemblGenomes-Tr; EBT00001673071.
DR   EnsemblGenomes-Tr; EBT00001673072.
DR   EnsemblGenomes-Tr; EBT00001673073.
DR   EnsemblGenomes-Tr; EBT00001673074.
DR   EnsemblGenomes-Tr; EBT00001673075.
DR   EnsemblGenomes-Tr; EBT00001673076.
DR   EnsemblGenomes-Tr; EBT00001673077.
DR   EnsemblGenomes-Tr; EBT00001673078.
DR   EnsemblGenomes-Tr; EBT00001673079.
DR   EnsemblGenomes-Tr; EBT00001673080.
DR   EnsemblGenomes-Tr; EBT00001673081.
DR   EnsemblGenomes-Tr; EBT00001673082.
DR   EnsemblGenomes-Tr; EBT00001673083.
DR   EnsemblGenomes-Tr; EBT00001673084.
DR   EnsemblGenomes-Tr; EBT00001673085.
DR   EnsemblGenomes-Tr; EBT00001673086.
DR   EnsemblGenomes-Tr; EBT00001673087.
DR   EnsemblGenomes-Tr; EBT00001673088.
DR   EnsemblGenomes-Tr; EBT00001673089.
DR   EnsemblGenomes-Tr; EBT00001673090.
DR   EnsemblGenomes-Tr; EBT00001673091.
DR   EnsemblGenomes-Tr; EBT00001673092.
DR   EnsemblGenomes-Tr; EBT00001673093.
DR   EnsemblGenomes-Tr; EBT00001673094.
DR   EnsemblGenomes-Tr; EBT00001673095.
DR   EnsemblGenomes-Tr; EBT00001673096.
DR   EnsemblGenomes-Tr; EBT00001673097.
DR   EnsemblGenomes-Tr; EBT00001673098.
DR   EnsemblGenomes-Tr; EBT00001673099.
DR   EnsemblGenomes-Tr; EBT00001673100.
DR   EnsemblGenomes-Tr; EBT00001673101.
DR   EnsemblGenomes-Tr; EBT00001673102.
DR   EnsemblGenomes-Tr; EBT00001673103.
DR   EnsemblGenomes-Tr; EBT00001673104.
DR   EnsemblGenomes-Tr; EBT00001673105.
DR   EnsemblGenomes-Tr; EBT00001673106.
DR   EnsemblGenomes-Tr; EBT00001673107.
DR   EnsemblGenomes-Tr; EBT00001673108.
DR   EnsemblGenomes-Tr; EBT00001673109.
DR   EnsemblGenomes-Tr; EBT00001673110.
DR   EnsemblGenomes-Tr; EBT00001673111.
DR   EnsemblGenomes-Tr; EBT00001673112.
DR   EnsemblGenomes-Tr; EBT00001673113.
DR   EnsemblGenomes-Tr; EBT00001673114.
DR   EnsemblGenomes-Tr; EBT00001673115.
DR   EnsemblGenomes-Tr; EBT00001673116.
DR   EnsemblGenomes-Tr; EBT00001673117.
DR   EnsemblGenomes-Tr; EBT00001673118.
DR   EnsemblGenomes-Tr; EBT00001673119.
DR   EnsemblGenomes-Tr; EBT00001673120.
DR   EnsemblGenomes-Tr; EBT00001673121.
DR   EnsemblGenomes-Tr; EBT00001673122.
DR   EnsemblGenomes-Tr; EBT00001673123.
DR   EnsemblGenomes-Tr; EBT00001673124.
DR   EnsemblGenomes-Tr; EBT00001673125.
DR   EnsemblGenomes-Tr; EBT00001673126.
DR   EnsemblGenomes-Tr; EBT00001673127.
DR   EnsemblGenomes-Tr; EBT00001673128.
DR   EnsemblGenomes-Tr; EBT00001673129.
DR   EnsemblGenomes-Tr; EBT00001673130.
DR   EnsemblGenomes-Tr; ETAF_3215-1.
DR   EnsemblGenomes-Tr; ETAF_3216-1.
DR   EnsemblGenomes-Tr; ETAF_3217-1.
DR   EnsemblGenomes-Tr; ETAF_3218-1.
DR   EnsemblGenomes-Tr; ETAF_3219-1.
DR   EnsemblGenomes-Tr; ETAF_3220-1.
DR   EnsemblGenomes-Tr; ETAF_3221-1.
DR   EnsemblGenomes-Tr; ETAF_3222-1.
DR   EnsemblGenomes-Tr; ETAF_3223-1.
DR   EnsemblGenomes-Tr; ETAF_3224-1.
DR   EnsemblGenomes-Tr; ETAF_3225-1.
DR   EnsemblGenomes-Tr; ETAF_3226-1.
DR   EnsemblGenomes-Tr; ETAF_3227-1.
DR   EnsemblGenomes-Tr; ETAF_3228-1.
DR   EnsemblGenomes-Tr; ETAF_3229-1.
DR   EnsemblGenomes-Tr; ETAF_3230-1.
DR   EnsemblGenomes-Tr; ETAF_3231-1.
DR   EnsemblGenomes-Tr; ETAF_3232-1.
DR   EnsemblGenomes-Tr; ETAF_3233-1.
DR   EnsemblGenomes-Tr; ETAF_3234-1.
DR   EnsemblGenomes-Tr; ETAF_3235-1.
DR   EnsemblGenomes-Tr; ETAF_3236-1.
DR   EnsemblGenomes-Tr; ETAF_3237-1.
DR   EnsemblGenomes-Tr; ETAF_3238-1.
DR   EnsemblGenomes-Tr; ETAF_3239-1.
DR   EnsemblGenomes-Tr; ETAF_3240-1.
DR   EnsemblGenomes-Tr; ETAF_3241-1.
DR   EnsemblGenomes-Tr; ETAF_3242-1.
DR   EnsemblGenomes-Tr; ETAF_3243-1.
DR   EnsemblGenomes-Tr; ETAF_3244-1.
DR   EnsemblGenomes-Tr; ETAF_3245-1.
DR   EnsemblGenomes-Tr; ETAF_3246-1.
DR   EnsemblGenomes-Tr; ETAF_3247-1.
DR   EnsemblGenomes-Tr; ETAF_3248-1.
DR   EnsemblGenomes-Tr; ETAF_3249-1.
DR   EnsemblGenomes-Tr; ETAF_3250-1.
DR   EnsemblGenomes-Tr; ETAF_3251-1.
DR   EnsemblGenomes-Tr; ETAF_3252-1.
DR   EnsemblGenomes-Tr; ETAF_3253-1.
DR   EnsemblGenomes-Tr; ETAF_3254-1.
DR   EnsemblGenomes-Tr; ETAF_3255-1.
DR   EnsemblGenomes-Tr; ETAF_3256-1.
DR   EnsemblGenomes-Tr; ETAF_3257-1.
DR   EnsemblGenomes-Tr; ETAF_3258-1.
DR   EnsemblGenomes-Tr; ETAF_3259-1.
DR   EnsemblGenomes-Tr; ETAF_3260-1.
DR   EnsemblGenomes-Tr; ETAF_3261-1.
DR   EnsemblGenomes-Tr; ETAF_3262-1.
DR   EnsemblGenomes-Tr; ETAF_3263-1.
DR   EnsemblGenomes-Tr; ETAF_3264-1.
DR   EnsemblGenomes-Tr; ETAF_3265-1.
DR   EnsemblGenomes-Tr; ETAF_3266-1.
DR   EnsemblGenomes-Tr; ETAF_3267-1.
DR   EnsemblGenomes-Tr; ETAF_3268-1.
DR   EnsemblGenomes-Tr; ETAF_3269-1.
DR   EnsemblGenomes-Tr; ETAF_3270-1.
DR   EnsemblGenomes-Tr; ETAF_3271-1.
DR   EnsemblGenomes-Tr; ETAF_3272-1.
DR   EnsemblGenomes-Tr; ETAF_3273-1.
DR   EnsemblGenomes-Tr; ETAF_3274-1.
DR   EnsemblGenomes-Tr; ETAF_3275-1.
DR   EnsemblGenomes-Tr; ETAF_3276-1.
DR   EnsemblGenomes-Tr; ETAF_3277-1.
DR   EnsemblGenomes-Tr; ETAF_3278-1.
DR   EnsemblGenomes-Tr; ETAF_3279-1.
DR   EnsemblGenomes-Tr; ETAF_3280-1.
DR   EnsemblGenomes-Tr; ETAF_3281-1.
DR   EnsemblGenomes-Tr; ETAF_3282-1.
DR   EnsemblGenomes-Tr; ETAF_3283-1.
DR   EnsemblGenomes-Tr; ETAF_3284-1.
DR   EnsemblGenomes-Tr; ETAF_3285-1.
DR   EnsemblGenomes-Tr; ETAF_3286-1.
DR   EnsemblGenomes-Tr; ETAF_3287-1.
DR   EnsemblGenomes-Tr; ETAF_3288-1.
DR   EnsemblGenomes-Tr; ETAF_3289-1.
DR   EnsemblGenomes-Tr; ETAF_3290-1.
DR   EnsemblGenomes-Tr; ETAF_3291-1.
DR   EnsemblGenomes-Tr; ETAF_3292-1.
DR   EnsemblGenomes-Tr; ETAF_3293-1.
DR   EnsemblGenomes-Tr; ETAF_3294-1.
DR   EnsemblGenomes-Tr; ETAF_3295-1.
DR   EnsemblGenomes-Tr; ETAF_3296-1.
DR   EnsemblGenomes-Tr; ETAF_3297-1.
DR   EnsemblGenomes-Tr; ETAF_3298-1.
DR   EnsemblGenomes-Tr; ETAF_3299-1.
DR   EnsemblGenomes-Tr; ETAF_3300-1.
DR   EnsemblGenomes-Tr; ETAF_3301-1.
DR   EnsemblGenomes-Tr; ETAF_3302-1.
DR   EnsemblGenomes-Tr; ETAF_3303-1.
DR   EnsemblGenomes-Tr; ETAF_3304-1.
DR   EnsemblGenomes-Tr; ETAF_3305-1.
DR   EnsemblGenomes-Tr; ETAF_3306-1.
DR   EnsemblGenomes-Tr; ETAF_3307-1.
DR   EnsemblGenomes-Tr; ETAF_3308-1.
DR   EnsemblGenomes-Tr; ETAF_3309-1.
DR   EnsemblGenomes-Tr; ETAF_3310-1.
DR   EnsemblGenomes-Tr; ETAF_3311-1.
DR   EnsemblGenomes-Tr; ETAF_3312-1.
DR   EnsemblGenomes-Tr; ETAF_3313-1.
DR   EnsemblGenomes-Tr; ETAF_3314-1.
DR   EnsemblGenomes-Tr; ETAF_3315-1.
DR   EnsemblGenomes-Tr; ETAF_3316-1.
DR   EnsemblGenomes-Tr; ETAF_3317-1.
DR   EnsemblGenomes-Tr; ETAF_3318-1.
DR   EnsemblGenomes-Tr; ETAF_3319-1.
DR   EnsemblGenomes-Tr; ETAF_3320-1.
DR   EnsemblGenomes-Tr; ETAF_3321-1.
DR   EnsemblGenomes-Tr; ETAF_3322-1.
DR   EnsemblGenomes-Tr; ETAF_3323-1.
DR   EnsemblGenomes-Tr; ETAF_3324-1.
DR   EnsemblGenomes-Tr; ETAF_3325-1.
DR   EnsemblGenomes-Tr; ETAF_3326-1.
DR   EnsemblGenomes-Tr; ETAF_3327-1.
DR   EnsemblGenomes-Tr; ETAF_3328-1.
DR   EnsemblGenomes-Tr; ETAF_3329-1.
DR   EnsemblGenomes-Tr; ETAF_3330-1.
DR   EnsemblGenomes-Tr; ETAF_3331-1.
DR   EnsemblGenomes-Tr; ETAF_3332-1.
DR   EnsemblGenomes-Tr; ETAF_3333-1.
DR   EnsemblGenomes-Tr; ETAF_3334-1.
DR   EuropePMC; PMC3206475; 22003892.
DR   EuropePMC; PMC3890536; 24053667.
DR   EuropePMC; PMC5340389; 28267754.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02081; STnc550.
DR   SILVA-LSU; CP002154.
DR   SILVA-SSU; CP002154.
XX
CC   The bacteria is available from Herman Spaink at
CC   h.p.spaink@biology.leidenuniv.nl.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3684607
FT                   /organism="Edwardsiella tarda FL6-60"
FT                   /strain="FL6-60"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:718251"
FT   gene            1..1323
FT                   /gene="dnaA"
FT                   /locus_tag="ETAF_0001"
FT   CDS_pept        1..1323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ETAF_0001"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40124"
FT                   /db_xref="GOA:A0A0H3DNK6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNK6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40124.1"
FT                   /translation="MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNDFCG
FT                   SDAPVLRFEVGSKPVAPAAVSSAASSGVSVAPAAVRTSSPARPSWERVTAQPELSYRSN
FT                   VNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIM
FT                   ARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEE
FT                   FFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMK
FT                   KADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALRDLL
FT                   ALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
FT                   DAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   gene            1348..2448
FT                   /locus_tag="ETAF_0002"
FT   CDS_pept        1348..2448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0002"
FT                   /product="DNA polymerase III beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40125"
FT                   /db_xref="GOA:A0A0H3DNN2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNN2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40125.1"
FT                   /translation="MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLT
FT                   GTDLEMEMVARVPLVQPHEAGATTVPARKFLDICRGLPDGAEISVALDGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRLLDGGETPLRLQIGSNN
FT                   LRAHVGGFIFTSKLVDGRFPDYRRVLPKNPDKALEAGCDELKQAFARAAILSNEKFRGV
FT                   RLHVSHNQLKITANNPEQEEAEELLDVDYPGSDLEIGFNVSYVLDVLNALKCERVVMML
FT                   TDAVSSVQIEDAASQAAVYVVMPMRL"
FT   gene            2525..3601
FT                   /gene="recF"
FT                   /locus_tag="ETAF_0003"
FT   CDS_pept        2525..3601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="ETAF_0003"
FT                   /product="DNA recombination and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40126"
FT                   /db_xref="GOA:A0A0H3DQ40"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ40"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40126.1"
FT                   /translation="MALTRLVIRDFRNIEDADLALAPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQAGRVIRHDCAAFVLHGRIDDGGGRELAVGLSKDRQGDSKVRIDGSDGH
FT                   KVAELAQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHGDRGFFTAWNNLRRVLKQRN
FT                   AALRQVTRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQDIAATCSQFLPEYALSFSFM
FT                   RGWDRESDYAALLERHFERDRALTYTALGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEYLTRHSGRQCLYLIDDFASELDAGRRRLLAERLKATGAQVFVSAVNADQVGD
FT                   MVDEKGKMFRVEQGKIAV"
FT   gene            3645..6059
FT                   /locus_tag="ETAF_0004"
FT   CDS_pept        3645..6059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40127"
FT                   /db_xref="GOA:A0A0H3DLL4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40127.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIVTIHSDNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGHVHEQIYRHGVPAAPLKVVGDTEQT
FT                   GTRVRFWPSMETFSNVVEFQYDILAKRLRELSFLNSGVSIRLRDKRNDREDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNSYMENEGYTKKSKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVESLMNERLAEYLLENPSDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQMSIALDGAALHINAAAPALA
FT                   GEPLEKLVAEHYQVQKLIGRMERRYPKAVLNQLIYQPTLSEADLGNQAQVEQWINSLVA
FT                   TLNEKEQHGSVYSARVLENRERQMFEPLVRVRTHGVDTDYAFDFDFVHGAEYRRICALG
FT                   EKLRDLLEESAFVERGERRQPVASFEQALDWLVKESRRGLAIQRYKGLGEMNPEQLWET
FT                   TMDPEGRRMLRVTIKDAVAADQLFTTLMGDAVEPRRAFIEENALKASNLDF"
FT   gene            6158..6976
FT                   /locus_tag="ETAF_0005"
FT   CDS_pept        6158..6976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0005"
FT                   /product="Hydrolase HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40128"
FT                   /db_xref="GOA:A0A0H3DLV4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40128.1"
FT                   /translation="MPIKLIAIDLDGTLLNEAREITPAVKAAIADARRRGVKVVLATGR
FT                   PLIGVRPYLRELALDVAGEYCLCNNGGLIVHADSGETLFETALDYGDYRYLEALAREVD
FT                   CHFHALDAERLFTANRDISKYTVHESFITGIPLYFCPVEQMAPSLRFPKVMMIDHPEVL
FT                   EAAIARIPAQAYQRYTLLRSSPFFLEILHRDVDKGKGIARLAEHLGIDRQHVMCIGDHG
FT                   NDLAMIDYAGLGVAMGNAEPAILAAAQYVTASNREDGVAQAIQRWVLNAA"
FT   gene            7062..8360
FT                   /gene="yidR"
FT                   /locus_tag="ETAF_0006"
FT   CDS_pept        7062..8360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidR"
FT                   /locus_tag="ETAF_0006"
FT                   /product="Uncharacterized protein YidR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40129"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNL0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40129.1"
FT                   /translation="MRHPSELQLTDDARGHQLTNTHVWTPDSRWIAYDVRPRGSTFSGE
FT                   TIERVSVPDGQTQCLYRAVDGACVGVVTVAPTSPERYVFIHGPEHPDALWQYDFHHRRG
FT                   VIVSAEHPDVAETLDALDITPPYTPGALRGGSHVHVFSPDASRLSFTYNDHVMHEDCPE
FT                   RDQRNVGVALSGASVRSAKSHPREYDGSHFCVLVTHTTPAPRPGSDDITRAYEEGWVGH
FT                   RGYLKPDGLRQRWALAFIGDTLSEDGQRVPELFIVDLPEEDSAYRQAGVSPLQGTGSTL
FT                   PAPPAGVSQRRLTFTHSRRYPGLATLPRHWVRSAPDGGSLAFLMRDDNGVVQLWRVSPN
FT                   GGELRQVTHGGYDVQSAFNWHPDGRSVLMVMDNSVVRCDVASGAVTRITERTAQPPCAD
FT                   AVIPSPDGRWVAYMREVNGWAQIFVARLTTDDE"
FT   gene            complement(8367..8636)
FT                   /gene="yidQ"
FT                   /locus_tag="ETAF_0007"
FT   CDS_pept        complement(8367..8636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidQ"
FT                   /locus_tag="ETAF_0007"
FT                   /product="Outer membrane lipoprotein YidQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40130"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNN7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40130.1"
FT                   /translation="MTRVGPHQGYYAGTKNDLQMIGSEESGWAMRPLLALDLPLSAVAD
FT                   TLLLPYDYYRADDDPATASPRARVQRAEQASAASGMAPPAALEN"
FT   gene            8993..9406
FT                   /locus_tag="ETAF_0008"
FT   CDS_pept        8993..9406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0008"
FT                   /product="16 kDa heat shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40131"
FT                   /db_xref="GOA:A0A0H3DQ43"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ43"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40131.1"
FT                   /translation="MRNFDLAPLYRSAIGFDRLFNLIESGQNNTNGGYPPYNVELVDDN
FT                   HYRISIAVAGFDEAELEITSHANSLMVKGSHQAIDKQRTYLYQGIAERNFERKFQLAEH
FT                   IHIKGARLENGLLFIDLERIIPESQQARKIAIK"
FT   gene            9522..9986
FT                   /locus_tag="ETAF_0009"
FT   CDS_pept        9522..9986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0009"
FT                   /product="16 kDa heat shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40132"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40132.1"
FT                   /translation="MRNYDLSPLMRQWIGFDKLANAMQTSLEPQGFPPYNIEKSDDNHY
FT                   RISLALAGFRQSELDIEVEGPRLTVRGNPVKPEKPVEYLHQGLVCKAFELSFTLAEHLT
FT                   VEGAAFENGLLNIDLVRHVPEALQPQRIIIGAAQRDPAALECRDEPNTQQ"
FT   gene            10181..11440
FT                   /locus_tag="ETAF_0010"
FT   CDS_pept        10181..11440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0010"
FT                   /product="Valine--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40133"
FT                   /db_xref="GOA:A0A0H3DLV7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40133.1"
FT                   /translation="MTFSAFGERFTRYSAITRLMDDLNNGLRTPGAVMLGGGNPARIAQ
FT                   MDAYFTSLCGELLEEGTLGEALCNYDGPQGKDTLLEALARLLSEQYGWPIGPQNIALTN
FT                   GSQSAFFYLFNLFAGRCSDGTRRRVLFPLAPEYIGYADAGLEDDLFVALKPSIALLPQG
FT                   QFKYHIDFDRLKIEDDIGLICVSRPTNPTGNVLTDEELTRLDALARQHRVPLLIDNAYG
FT                   VPFPGIIFTEATPLWNPNTILCMSLSKLGLPGVRCGIVVADERTIQALSNMNGVISLSP
FT                   GSMGPALALRMIERGDLLRLSREVIRPFYQQRVDQTLAIIRRYLPEERCLIHRPEGAIF
FT                   LWLWFKDLPIGSEELYQRLKQRGVLMVPGDYFFPGLAQAWPHTRQCMRMNYVPDPTLIE
FT                   RGVQILAEEVERAYREAGAA"
FT   gene            complement(11510..12229)
FT                   /locus_tag="ETAF_0011"
FT   CDS_pept        complement(11510..12229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40134"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNL6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40134.1"
FT                   /translation="MTFAVKTWAQRLLMPVMALFLVMQLSGCGDSDKEQQKAFIDYLQN
FT                   TVMRGSVTIPTLSEAQKQQLGHYAGDYAVLVTFSQNFNRAMEASMTPLFSTLQQIRTPQ
FT                   EYLTQRDRLQQELGALNMLGQQIQSAKAQADGAYATLKQPEEVKAVFDKAFTKIVTGPS
FT                   NAVMPMIPQAADVAQTLVQVGDFLQNLGPQARFDNQGVQLQTQAQVDQYNQLMRDLSAK
FT                   YQTLMAAKQQNAGLLQN"
FT   gene            complement(12362..14431)
FT                   /locus_tag="ETAF_0012"
FT   CDS_pept        complement(12362..14431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0012"
FT                   /product="Glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40135"
FT                   /db_xref="GOA:A0A0H3DNP2"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNP2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40135.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDI
FT                   EWFAAPRRLALKVAALNAAQPDREIEKRGPAIAQAFDADGKPTKAAEGWARGCGISVDQ
FT                   ADRLSTDKGEWLLYRALQKGQRAQDLLPTRVANALSRLPIPKLMRWGDSDTQFVRPVHT
FT                   VTLLLGSESIPATILGVPSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYDAR
FT                   KALIKRDAEAAAARIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIDSKDAQQIISGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLETVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEADEVAVALNEQYMPRFAGDALPTSLVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVRLYGDKLSN
FT                   ANVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSHFRTLPEA
FT                   ATLAAANKRVSNILAKSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLAPLFADGRYQ
FT                   EALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADISVLQ"
FT   gene            complement(14441..15349)
FT                   /locus_tag="ETAF_0013"
FT   CDS_pept        complement(14441..15349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0013"
FT                   /product="Glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40136"
FT                   /db_xref="GOA:A0A0H3DQ47"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ47"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40136.1"
FT                   /translation="MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFAC
FT                   FEQYEKEARMLLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   MVAEAYYASREALGFPMCKKD"
FT   gene            15563..16162
FT                   /locus_tag="ETAF_0014"
FT   CDS_pept        15563..16162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0014"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40137"
FT                   /db_xref="GOA:A0A0H3DLM0"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40137.1"
FT                   /translation="MDDHAPPRCAWVSADPLYIAYHDHEWGRPLYDGQALFELLCLEGQ
FT                   QAGLSWLTVLKKRQRYRQAFHGFDPAKVAAMTAEDIADLLLDQGLIRNRRKLEAIVTNA
FT                   RALLAMAQRGEAFSAFIWSFVGGAPLAPPEGGWQALTHTSVSDALARALKQRGFTFVGT
FT                   TICYAFMQACGMVNDHMPGCCLYHDASPVSASGQAR"
FT   gene            16122..16628
FT                   /locus_tag="ETAF_0015"
FT   CDS_pept        16122..16628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0015"
FT                   /product="Histone acetyltransferase HPA2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40138"
FT                   /db_xref="GOA:A0A0H3DLW1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40138.1"
FT                   /translation="MMRPLYLRPARPADTSALLALWLKLTIQAHPAIPPGYWRASLPWV
FT                   RDAYLPEGQTWLATDRGRIGGFICILPGHLLGALFVARRYRGRGVAQRLMRHAKRHHPW
FT                   LLLEAYCANLRAQAFYRRQGFHCIDRQIQAQTGQAVATLLWQRRAVLEKSERLDYTARS
FT                   SVMGE"
FT   gene            16824..17348
FT                   /locus_tag="ETAF_0016"
FT   CDS_pept        16824..17348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0016"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40139"
FT                   /db_xref="GOA:A0A0H3DNM1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40139.1"
FT                   /translation="MSSVALAEIGDKTQLLTLLLVARFGKPFLILLAIILATLVNHYFA
FT                   ALIGELVTQFLSPQIMRWMVAAGFLAMAVWVLFPDKDDGEIRGGHPFWTSLVVFFLAEI
FT                   GDKTQIATVLLGAHYQHITWVVLGSTLGMVLANAPMLWFGARLQPYLKSGWGRRLSSLL
FT                   FAILGVVTLIL"
FT   gene            17497..18156
FT                   /locus_tag="ETAF_0017"
FT   CDS_pept        17497..18156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0017"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40140"
FT                   /db_xref="GOA:A0A0H3DNP8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNP8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40140.1"
FT                   /translation="MKKSRFCIAGLISAALILSGCTTNPYTGESQAGKSGVGAGLGALL
FT                   GAGVGALSSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGD
FT                   NIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMR
FT                   LSQQRADSVASALIVQGVSAGRIRTIGMGPANPIATNSTAAGKAQNRRVEITLSPL"
FT   gene            complement(18195..18443)
FT                   /gene="tusA"
FT                   /locus_tag="ETAF_0018"
FT   CDS_pept        complement(18195..18443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tusA"
FT                   /locus_tag="ETAF_0018"
FT                   /product="tRNA 5-methylaminomethyl-2-thiouridine synthase
FT                   TusA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40141"
FT                   /db_xref="GOA:A0A0H3DQ50"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ50"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40141.1"
FT                   /translation="MTDLFANPDKTLDALGLRCPEPVMMVRKAVRHMAAGETLLIIADD
FT                   PATTRDIPGFCRFMDHALLAQEIEQTPYRYLLRKGGA"
FT   gene            18723..19382
FT                   /locus_tag="ETAF_0019"
FT   CDS_pept        18723..19382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0019"
FT                   /product="Putative preQ0 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40142"
FT                   /db_xref="GOA:A0A0H3DLM4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40142.1"
FT                   /translation="MFSFTPQQRFTALCWLSLFHVLIITSSNYLVQLPITVFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILAVMVPALLISYCVSALFFQGQWQGFAALGSV
FT                   NLMVARIACASFMAYVLGQILDVHVFNRLRQTRAWWVAPTASTLFGNISDTLSFFFIAF
FT                   YRSSDAFMATHWVEIALVDYAFKLLISMVFFLPMYGVMLNMLLKRIAFRQQQASLA"
FT   gene            19592..21586
FT                   /locus_tag="ETAF_0020"
FT   CDS_pept        19592..21586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0020"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40143"
FT                   /db_xref="GOA:A0A0H3DLW5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40143.1"
FT                   /translation="MYKYPILICALLSPLTATTYAADAEQPPVVSRVHPLLHVQGYTFR
FT                   DANGNGRLDPYEDWRLSAEQRSADLVARMTLREKAGMMMIDTFRVAPQGAIRQEDAALI
FT                   REQHMTRFIFRNPVVSQPQSGTNQLTPREVAEALNQAQEMAERTPHGIPALFKSNARNH
FT                   LDPQAREGINVISGAFSSWPKEAGLAATRDMSLIREFAGIMAQEWRAVGIRGMYGYMMD
FT                   LATEPRWYRVHETFTEDADLMSDIARQLILGLQGERLGRDSIALTIKHFPGGGPQENGG
FT                   DPHYAYGKNQNYAGQNFRYHLKPFITAIELGVSAIMPYYGIPVGQALTPNDVGMAFSAG
FT                   VITGLLREQLGFKGYVNSDTGIIGDRAWGIEHLPEQEQIAIAVNAGTDVLSGYHSNAIV
FT                   YDTIRAGKISQERVDLAVSRLLKEQFTLGLFENAYVDPERATQTLGNKAFQALASLAQR
FT                   KSIVLLKNGDDRAPLLPLAPAQTLYVVGMDKAIVEAYGFRVISGDRRGGALPAIPPQTA
FT                   RAIVRVVVSNPYVEARRFGGAAEDELNDLAFSAMARAKTWQITPSLADIQTIMARVGAA
FT                   NTILSINYRQPFVLDRASGMDRAGAILATFGVSDHALMDVLSGRFNPQGRLPFALPNQA
FT                   QAVVNQLSDMPGYRALDTWRPYGFGLRYQ"
FT   gene            21694..21858
FT                   /locus_tag="ETAF_0021"
FT   CDS_pept        21694..21858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40144.1"
FT                   /translation="MTPITLHSATPAAILALYRAIPEFAPRHSLADIQRRLAGRQASLL
FT                   IARSGGRDV"
FT   gene            21860..22141
FT                   /locus_tag="ETAF_0022"
FT   CDS_pept        21860..22141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40145"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNQ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40145.1"
FT                   /translation="MGYALDEQTFYSWLGGVLPGWRRKGIAQILLHAQQAWALNQGYRR
FT                   IEVKTRNGFSSMLMMLINNGYHIIQVQPQDEVVDYRLRLVRDLRLDAA"
FT   gene            22218..22793
FT                   /locus_tag="ETAF_0023"
FT   CDS_pept        22218..22793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0023"
FT                   /product="DcrB protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40146"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ54"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40146.1"
FT                   /translation="MGNLVKLIGVGLLVTGLAACDGSSTAETNAPAQGASATQPSVPAG
FT                   AKVSLLDGKIGFTLPAGLSDQTSKLGSQTNNMSVYANKTGQQAVIVILAPMPQDNLNTL
FT                   STRLIDQQKSRDASLQLVSSESVKLGGKDVEKVVSMQQANGHAIYSSIILAQVGDQLMT
FT                   MQISLPGDNRQEAANIANGVLNTLSFAQ"
FT   gene            complement(22815..24512)
FT                   /locus_tag="ETAF_0024"
FT   CDS_pept        complement(22815..24512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40147"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40147.1"
FT                   /translation="MKVIGKLLLTLCVLILLALAAAYFIVQSRWGARQISDWVNQHTHY
FT                   RITLSALQHTLGQPATVQVNGFSLARAGQPPLIQSATLRLTFGWQQLSAPRHFSAISLS
FT                   GGKLTLTQDGIPPLPISAAALRLHDMQILWPHADWPLQASDVDGGIVPLRPGSTKVDFQ
FT                   FSAAALNIGEIPAKNVLVQGEYRDRQLWLNNLGADVANGQMTAQALRQADGTWRIDSLR
FT                   LSQIHWQSPQALRPFLHALQILPPLTLVRLDLLGANLEGKGWALGGLDATLRNVSLTDG
FT                   HWHSQRGSLAFNAADIVLGAVHLSDPLLSADLTPQGITLRQFNTRWSNALIRASGDWQR
FT                   DSGHLTLNDLAVVGLEYTLPSAWRTLWLRPLPAWLQEITLQRFSLSRTLLVDINPDFPF
FT                   QMTALDGFGSHVTLARQRRWGIWQGQMQFNASEATFNKVDLRRPSATLLADGGTVRVSD
FT                   LSAISQKGLLEASATLIQDDSLLTLALHGRGVPVSQLDAWGWPALTTLQGDMNLQLTLR
FT                   APLQAGTPFRQGVEATLQAQDGHGHTLHQRMVSGQLVAEPSPIATEGR"
FT   gene            complement(24711..26114)
FT                   /locus_tag="ETAF_0025"
FT   CDS_pept        complement(24711..26114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0025"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40148"
FT                   /db_xref="GOA:A0A0H3DLW7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40148.1"
FT                   /translation="MTTQTTDLDPMAQPTTPPTTHSELIYRLDDCPPLAQTLFAACQHL
FT                   LAMFVAVITPALLICQALGLPAQDTQHIISMSLFASGLASLLQIKTWGPVGSGLLSIQG
FT                   TSFNFVTPLIMGGMALKNGGADIPTMMATLFGTLMLASCTEIILSRFLHLARRIITPLV
FT                   SGIVVMIIGLSLIQVGLISIGGGYSAMGDHSFGAPRNLLLAGAVLLVIILLNRQRNPYL
FT                   RVASLVIAMAVGYGLAWLMDMLPASAAQPNTAPLVTIPTPLYYGLGIDWNLLIPLMLVF
FT                   MVTSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFGQN
FT                   NGVIQLTGVASRKVGFVVALMLVLLGLFPAVAGFVQHIPEPVLGGATIVMFGTIAASGV
FT                   RIVSREPLNRRAIMIMALSLAVGLGVSQQPEILQFAPQWLKTLLSSGIAAGGITAIVLN
FT                   LIFPHETHR"
FT   gene            26348..27562
FT                   /locus_tag="ETAF_0026"
FT   CDS_pept        26348..27562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0026"
FT                   /product="Sodium/glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40149"
FT                   /db_xref="GOA:A0A0H3DNM9"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40149.1"
FT                   /translation="MYHLDIYGTLVAATLVLLLGRQMVQKIPLLTKYTIPEPVAGGLLV
FT                   ALALLILKKSIGFEVDFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFLFVVVGL
FT                   LIVQNAIGISMAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFQNATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPDGTPDDNAVPSAFEKPQSGRMITSLVLIETLA
FT                   LIVICLTVGQLIAGWLRGSALELPTFVCVLFVGVILSNTLSKIGFYQVFERAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLAILAVQTLVMALYAIFVTYRVMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITERFGPSHLAFLVVPMVGAFFIDIANAIIIKLYLMLPLF
FT                   AQAIG"
FT   gene            complement(27579..29660)
FT                   /gene="recG"
FT                   /locus_tag="ETAF_0027"
FT   CDS_pept        complement(27579..29660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ETAF_0027"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40150"
FT                   /db_xref="GOA:A0A0H3DNQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNQ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40150.1"
FT                   /translation="MQGRLLDAVPLTSLSGVGASQAGKLAKLGLVTIQDLLLHLPLRYE
FT                   DRTRLYRIGELQPGMVVTVEGEVLRTDVAFGRRRMLTSQISDGSGLLTLRFFNFSAAMK
FT                   NSLAPGKRVLAYGEIKRGHHGGEIIHPEYRMQGDDAAPALQEALTPVYPTTEGVRQATL
FT                   RKLSDQALALLDITPIPELLPDALKQGLLSLPDALRTLHRPPPDIHQEDLAQGRHPAQR
FT                   RLILEELLAHHLSMLAVRAGNQRHRALALATDDHLKQRFLAALPFTPTTAQRRVLGDIE
FT                   ADMAKSVPMMRLVQGDVGCGKTLVAALAALRAIAHGHQVALMAPTELLAEQHAANFRQW
FT                   FAPLGLSVGWLAGKQKGKARQTQMAAIAAGEVDMVVGTHALFQEQVQFAGLALVIIDEQ
FT                   HRFGVHQRLALWEKGEAQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIADTRRQQILDRVRHACLEEKRQAYWVCTLIEESDLLEAQAAEATAETLMQQLPE
FT                   LRIALVHGRMKAADKQRVMTQFKAGEVDLLVATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGAIASHCVLLYKAPLSQTAQRRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGNAEFRVADLLRDQALIPEVQRIARHLHSAYPQHARALIERWLPAGSRYSNA"
FT   gene            complement(29662..30321)
FT                   /locus_tag="ETAF_0028"
FT   CDS_pept        complement(29662..30321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0028"
FT                   /product="tRNA (Guanosine18-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40151"
FT                   /db_xref="GOA:A0A0H3DQ58"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ58"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40151.1"
FT                   /translation="MMAARQPDLTVCMEQVHKPHNVSAVIRTADAVGVHQVHAVWPGKS
FT                   MRTLVSTAAGSNSWVNVKTHRDIATAVGELKGQGMQILATNLSATAVDFREIDYTRPTC
FT                   ILMGQEKRGISAEALQLADRDIIIPMVGMVQSLNVSVASALILYEAQRQRQQAGMYGRS
FT                   QPSLSEEEQQRLLWEGGYPVLASVARRKGLARPHIGDDGQIDAPQAWWDAMQAARS"
FT   gene            complement(30360..32453)
FT                   /locus_tag="ETAF_0029"
FT   CDS_pept        complement(30360..32453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0029"
FT                   /product="GTP pyrophosphokinase, (p)ppGpp synthetase II /
FT                   Guanosine-3,5-bis(diphosphate) 3-pyrophosphohydrolase"
FT                   /EC_number="2.7.6.5"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40152"
FT                   /db_xref="GOA:A0A0H3DLM8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40152.1"
FT                   /translation="MYLFESLNLLIQKYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIDG
FT                   RLTEAGMACQVNGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVKDVDTCYRVLGQVH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEGESSTTAQIRAQRWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPEGRIVEL
FT                   PAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALSSGQTIEVITAPGARPNAAWLN
FT                   FVVSSKARAKIRQMLKNLKRDDSVSLGRRLLTHALGNGRKLASIPAPNIQRELERMKLQ
FT                   SLDDLLAEIGLGNAMSVVVARNLLGEQDTPPGGRKLPIKGADGVLLTFAKCCRPIPGDP
FT                   IIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMPVEWDKEIDQEFIAEIKVDMFNHQGAL
FT                   ANLTAAINATASNIQSMNTEEKDGRVYSVYIRLTTRDRVHLANIMRKIRIMPDVIKVTR
FT                   NRN"
FT   gene            complement(32473..32748)
FT                   /locus_tag="ETAF_0030"
FT   CDS_pept        complement(32473..32748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0030"
FT                   /product="DNA-directed RNA polymerase omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40153"
FT                   /db_xref="GOA:A0A0H3DLX0"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40153.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQTGGKEPLVPEENDK
FT                   TTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
FT   gene            complement(32803..33426)
FT                   /locus_tag="ETAF_0031"
FT   CDS_pept        complement(32803..33426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0031"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40154"
FT                   /db_xref="GOA:A0A0H3DNN4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNN4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40154.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPTYDSRVSVSHTTRASR
FT                   PGEQHGEHYYFVSVDEFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDID
FT                   WQGARQVRSKMPQARSIFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEMSHYSEY
FT                   DYLIINDDFDVALQDLRTIIRAERLRRERQQLRHDALISKLLAD"
FT   gene            complement(33547..34167)
FT                   /locus_tag="ETAF_0032"
FT   CDS_pept        complement(33547..34167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0032"
FT                   /product="Putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40155"
FT                   /db_xref="GOA:A0A0H3DNR3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNR3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40155.1"
FT                   /translation="MLLSILYIVGITAEAMTGALAAGRRQMDTFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLSWVKHPENIVIVACAAVLTTWVAPLMSHLRRLFLLLDAVGLIVFSIIG
FT                   AQVALEMGHGPIVAVIAAVVTGVFGGVLRDLFCNQIPLVFQKELYAGISFAAAWLYLGL
FT                   LYLQVPQDLTVIITLVAGFSARLLALRFHLSLPVFDYKQPERE"
FT   gene            complement(34488..35351)
FT                   /gene="yicC"
FT                   /locus_tag="ETAF_0033"
FT   CDS_pept        complement(34488..35351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicC"
FT                   /locus_tag="ETAF_0033"
FT                   /product="YicC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40156"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ61"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40156.1"
FT                   /translation="MIRSMTAYARREVKGNWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERLRTRLTRGKVECNLRFELDPSAQSALILNESLAKQLVDAANWVKLQSDEGEI
FT                   NPLDVLRWPGVMAAAEQDLDAIGSELLAALDGTIDDFIDAREREGSALKQLIEQRLEAV
FT                   SAEVAKVRSRMPEILQWQRERLVSKLEEAQVQLENNRLEQELVLMAQRIDVAEELDRLD
FT                   AHVKETYVILKKKEAVGRRLDFMMQEFNRESNTLASKSINADITASAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            35484..36200
FT                   /locus_tag="ETAF_0034"
FT   CDS_pept        35484..36200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0034"
FT                   /product="Ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40157"
FT                   /db_xref="GOA:A0A0H3DLN3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40157.1"
FT                   /translation="MRPEGRAAGQIRPLRLTRHYTKHAEGSVLVEFGDTKVLCTASVDE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMAREAAKGKQGGRTMEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVIQADGGTRTASITGACVALADALGALVAAGKLKESPLKGMVAAVS
FT                   VGIVADEAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLALAR
FT                   DGIGQIIQAQKTALEQ"
FT   gene            36283..36924
FT                   /locus_tag="ETAF_0035"
FT   CDS_pept        36283..36924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0035"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40158"
FT                   /db_xref="GOA:A0A0H3DLX5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40158.1"
FT                   /translation="MKAYQRRFIEFALSKQVLKFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LALLGRFYAEALVDSGIAFDVLFGPAYKGIPIATTTAVALAEHHDRDMPYCFNRKEAKD
FT                   HGEGGTLVGSALVGRVMLVDDVITAGTAIRESMSIIQANGAALAGVLISLDRQERGRGE
FT                   LSAIQEVERDYGCRVISIITLGDLIRYLEEQPEMAQHLAAVKAYRAQYGV"
FT   gene            complement(36962..37558)
FT                   /gene="slmA"
FT                   /locus_tag="ETAF_0036"
FT   CDS_pept        complement(36962..37558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slmA"
FT                   /locus_tag="ETAF_0036"
FT                   /product="Transcriptional regulator SlmA, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40159"
FT                   /db_xref="GOA:A0A0H3DNP1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNP1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40159.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDTLTSRINLILQDEKDTFNRLRLILLLILGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEAQLRQVLKERRLREGSGFDHDETLLASQLL
FT                   AFCEGMLSRFVRSEFRYRPTQEFETRWPLLACQLQ"
FT   gene            complement(37664..38122)
FT                   /locus_tag="ETAF_0037"
FT   CDS_pept        complement(37664..38122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0037"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40160"
FT                   /db_xref="GOA:A0A0H3DNR8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNR8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40160.1"
FT                   /translation="MKKKIDVKILDARIGQQFPLPTYATPGSAGLDLRACLDRAVVLAP
FT                   GETTLLPTGLAIHIADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNR
FT                   GQTPFTIEPGERIAQLVLVPVVQADFNLVESFEGSARGDGGFGHSGRH"
FT   gene            complement(38100..39317)
FT                   /locus_tag="ETAF_0038"
FT   CDS_pept        complement(38100..39317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0038"
FT                   /product="Phosphopantothenoylcysteine decarboxylase /
FT                   Phosphopantothenoylcysteine synthetase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40161"
FT                   /db_xref="GOA:A0A0H3DQ67"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ67"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40161.1"
FT                   /translation="MTVLRGKRILLGISGGIAAYKCPEIVRRLRERGAEVRVVMTKGAQ
FT                   AFITPLTLQAVSGYPVADDLFDPAAEASMGHIALGKWADLVLLAPATADLMARLAAGMA
FT                   DDLLATLCLASAAPLAIAPAMNQQMFRAAATQDNLATLARRGALIWGPDSGEQACGDVG
FT                   PGRMLDPLTLVSLTEQHFSQSQDLAAYRLIITAGPTREALDPVRFISNHSSGKMGFAIA
FT                   EAAARRGAQVTLISGPVALPTPPGVARVDVQSALDMQAAVAQRARDCDIFIACAAVADY
FT                   RAQQIAPEKMKKQQGDTLTLTLVKNPDIVAGVAAMTEARPFVVGFAAETQNVEEYAKQK
FT                   LARKGLDLICANDVSQDGQGFNSDTNALHLFWPQGDKRLPLSSKSRLGCTLINEIVRHY
FT                   EEKNRR"
FT   gene            39507..40193
FT                   /gene="radC"
FT                   /locus_tag="ETAF_0039"
FT   CDS_pept        39507..40193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="ETAF_0039"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40162"
FT                   /db_xref="GOA:A0A0H3DLN5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40162.1"
FT                   /translation="MAQGKGEGGWPQGALPREKLLALGAAALSDRELLALFLRTGLPGV
FT                   HVIQLAERLLQRFGSLQGVLRADVDTFCASQGLGIAKFAQLQAVIELSRRVLRHRIGEE
FT                   SAITSPDLTALYLQNLFVSLEREIFVVLFLDNQHRVIRSEQMFSGTINCVDVYPREIVR
FT                   EALKLNAVALILAHNHPSGNPEPSVADRLLTERVAKACALVDIQVLDHMVIGHGQRVSF
FT                   AERGWI"
FT   gene            40468..40668
FT                   /locus_tag="ETAF_0040"
FT   CDS_pept        40468..40668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0040"
FT                   /product="LSU ribosomal protein L28p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40163"
FT                   /db_xref="GOA:A0A0H3DLX8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40163.1"
FT                   /translation="MTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMR
FT                   VIDKKGIEAVLADLRARGEKY"
FT   gene            40680..40847
FT                   /locus_tag="ETAF_0041"
FT   CDS_pept        40680..40847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0041"
FT                   /product="LSU ribosomal protein L33p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40164"
FT                   /db_xref="GOA:A0A0H3DNP6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNP6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40164.1"
FT                   /translation="MAKGIREKIKLVSSAGTGHYYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
FT   gene            40941..41750
FT                   /locus_tag="ETAF_0042"
FT   CDS_pept        40941..41750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0042"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40165"
FT                   /db_xref="GOA:A0A0H3DNS4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNS4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40165.1"
FT                   /translation="MPELPEVETSRRGIAPFLEGKTLSHLTVRQPRLRWPVSETLLTLR
FT                   DRPILSVQRRAKYLLLALPEGWIVIHLGMSGSVRILPAQTPPQKHDHVDLLLTDGMMLR
FT                   YTDPRRFGAWLWYDDLATASVLAHLGPEPLSEAFSAEYLLERARGRRTAVKPWLMDNTL
FT                   VVGVGNIYASESLFSAQIHPDRLAGSLSADEASLLVQTIKAVLQRSIDQGGTTLRDFLQ
FT                   ADGKPGYFAQQLQVYGRAGEACLTCGTTIKSSKHGQRTTFYCPHCQR"
FT   gene            complement(41747..42232)
FT                   /locus_tag="ETAF_0043"
FT   CDS_pept        complement(41747..42232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0043"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40166"
FT                   /db_xref="GOA:A0A0H3DQ72"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ72"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40166.1"
FT                   /translation="MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDRVILAIAASPGKRPL
FT                   FTLEERVAMAREVTAHLANVEVQGFSELMAHFAQRQRANILVRGLRAVSDFEYELQLAN
FT                   MNRHLMPTLESVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEPVARTLMARLRNA"
FT   gene            complement(42229..43005)
FT                   /locus_tag="ETAF_0044"
FT   CDS_pept        complement(42229..43005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0044"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40167"
FT                   /db_xref="GOA:A0A0H3DLN9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40167.1"
FT                   /translation="MPPRLSVVLICKNAADLLPECLASVAWADEIIVLDSGSSDETQRI
FT                   AQAAGAKVYESRDWQGFGIQRQRAQQYASGDYILMIDSDERVTPALKEAIAQVLTQPVT
FT                   ERVYSIARRNLFLGRFMRHSGWYPDRVIRLYPRQRYGYDTSPVHESLACRGASVTPLQG
FT                   DLLHLTCRDFTGFQQKQLCYATAWAHERHARGKKTSMLGIFSHTVGALLKTLLLRGGVL
FT                   DGKQGWLLAVVNAQYTFNKYAELWALQHGYTEKTPL"
FT   gene            complement(43008..44282)
FT                   /locus_tag="ETAF_0045"
FT   CDS_pept        complement(43008..44282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0045"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40168"
FT                   /db_xref="GOA:A0A0H3DLY4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLY4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40168.1"
FT                   /translation="MESLYTVLLYIIQPLIWLRLLLRSRKAPAYRKRWGERYGFCRNKV
FT                   APGGILLHSVSVGETLAAVPLVRALRHRYPTLPITVTTMTPTGSERVMSAFGNDVHHVY
FT                   LPYDLPGAMRRFLNTVRPKLVIVMETELWPNMISALHQRQIPLVIANARLSARSAKGYG
FT                   KLGGFMRRLLRKVTLIAAQNQEDGERFIALGLKRSQLAVTGSIKFDISVTPELAARAVT
FT                   LRRQWAPHRKVWIAASTHQGEEAIILQAHRRLLAQFPDLLLILVPRHPERFKETELLTQ
FT                   KEGFTYLMRSGGEIPTPQTQVVIGDSMGELMLLYGIADLAFVGGSLIERGGHNPLEPAA
FT                   HAIPVLMGPHTFNFKDICAKLHQADGLISVADGDALVNEVSTLLTDEDYRLWYGRHAVE
FT                   VLHQNQGALQRLLQLLLPYLPLRSH"
FT   gene            complement(44456..45538)
FT                   /locus_tag="ETAF_0046"
FT   CDS_pept        complement(44456..45538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0046"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40169"
FT                   /db_xref="GOA:A0A0H3DNQ1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNQ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40169.1"
FT                   /translation="MIIDGLPGGGAEKVVLTLAQYFLAQGDSVSLFSLRDVCHYPLPDG
FT                   LDYRVIRDTCRAPWRKLSELSRRARQLDEAIASAEQKGRYDLVLSNLHKTDRIVARSHL
FT                   LRDHNLWFCLHGVFSTSYLGHRHGFSRWLKREKIRRIYQGRQIVAVSHAVGEDLCQQFN
FT                   VTPAQLQTIPNPFDLEAIRRAADAPCPLEGQDYLIHVGRFHPAKRHDRLLEAYAQSGLS
FT                   APLVLLGQGSPEQEHTLRALAKTLNVAERVHFAGFQANPYPWIRHARLLVVSSDSEGFG
FT                   NVLVEALTLGTAVVSTRCPGGPAEIMTGDLARGLCRPDAASLAQTLQDIYRHPPAIDDT
FT                   QLQQYGVAAVCTRYRQLGKA"
FT   gene            complement(45554..46681)
FT                   /gene="waaG"
FT                   /locus_tag="ETAF_0047"
FT   CDS_pept        complement(45554..46681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaG"
FT                   /locus_tag="ETAF_0047"
FT                   /product="UDP-glucose, heptosyl, LPS
FT                   alpha1,3-glucosyltransferase WaaG"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40170"
FT                   /db_xref="GOA:A0A0H3DNS9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNS9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40170.1"
FT                   /translation="MTQFRLALVRQKYRPDGGAERFVSRALEALDSHDIELNVITRQWQ
FT                   GPVKPAWHIHLCNPWKWGRISRERGFAHAARTLWQQQRFDLVQSHERIPGCDLYRAGDG
FT                   VHQRWLTQRARILPGWKARMLWHDRYHRYVMNAEQAMYQAPELRAVICNADMIKQEIIA
FT                   DFGVPESKIHVIYNAIDHHRFLPPDEAQRAALRRRWQIPQSASCLIYVGSGFERKGLRA
FT                   AIEAIAPTERYLLVVGKDKEEARYRALANTLGCAQRVRFLGMQPETLPFYQMADGLLLP
FT                   TLYDPFPNVILEAMACGLPVITSTGCGGAEFIRSGDNGYVCDALDIAALRDAAMALPAQ
FT                   ALGSHAGRLARERIMECTAERLSAQLIGLYRQLVK"
FT   gene            complement(46678..47754)
FT                   /locus_tag="ETAF_0048"
FT   CDS_pept        complement(46678..47754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0048"
FT                   /product="Lipopolysaccharide heptosyltransferase III"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40171"
FT                   /db_xref="GOA:A0A0H3DQ75"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ75"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40171.1"
FT                   /translation="MVSNSTLPAAFSPQRILVIKLRHHGDMLLVTPVISTLKRHYPSAQ
FT                   IDVLLYAETRDMLSANQDIHQLYCIDRQWKKQGVRHQLSQEWRLLRTLRAQRYDLVVNL
FT                   ADQWRSAIVTALSAAPVRIGFDFTKRRHPLWRTSHTHLASTAEHGKQHTVEQNLSILAP
FT                   LGLADDDSRVTMGYSEQDWQSASALIPTAWQAGYVVIQPTSRWFFKCWQEARMSEVINA
FT                   LSQAGYPILLTSGPDARERAMIDAIMQGCPTAQVTSLAGQLTLRQLAAIIDHARLFIGV
FT                   DSVPMHMAAALQTPLVALFGPSKLVFWRPWQARGDVIWAGDFGTLPDPDAIDTQTAERY
FT                   LDLIPSSAVIAAAKRLLE"
FT   gene            47887..48858
FT                   /locus_tag="ETAF_0049"
FT   CDS_pept        47887..48858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40172"
FT                   /db_xref="GOA:A0A0H3DLP2"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40172.1"
FT                   /translation="MSHPAFIITIDTEGDNLWQNHDRITTENARYLPRFQQLCEKYGFK
FT                   PVYLTNYEMASDPVYVEFAQDVIARGCGEVGMHLHAWNSPPEIPLTDNDWANKPYLIEY
FT                   PAEVIQQKVDYMTHLLEDTFQTKMVSHRAGRWAMNAFYLQLLLAHGYQVDCSVTPRVDW
FT                   RGARGAPQGNGGSDYSGYPDNAYFVDADDLRREGTSTLLEVPMSTRLKHAPLFNHLRGA
FT                   YDRLRGKRRPASVQWLRPRGGNLQEMQRVAEYHLSQGRDYVEFMLHSSEFMPGGSPTFR
FT                   NEQDIERLYHDLEALFDWLAPQVMGQTLAEYYQIKRGQRPAM"
FT   gene            complement(48944..50155)
FT                   /locus_tag="ETAF_0050"
FT   CDS_pept        complement(48944..50155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0050"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40173"
FT                   /db_xref="GOA:A0A0H3DLY9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLY9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40173.1"
FT                   /translation="MIDLRKVGGVETMFCDFLRYATQAYPHIQHTLIMEHSGIANALRP
FT                   RLQGLQQVSIQTIKRCGSFSLPNRPKLFRAWNRLRLIRDSAPDIVLIWNQFTEWHLSGS
FT                   RTARYLRCPVVYYEHGMSWYQHTPTLPQRFFAQVTHCLAVSHACKRMLELKHHITQPIA
FT                   VELNAPRSLPAHATPKPARHRGQPIIFGSAGRWVPLKCLGLLLLTSQVLQQRGIPHHCY
FT                   IAGEGKEADYLQHLRTALGVEKETTLLGFVSDMEAFYAKLDLYICPSMHETASLTALEA
FT                   GTYGIPTITSNIDGLPETVRHQQTGLCLTPTLSVEQYAHISAASTDFSPLVYDPVQDRL
FT                   TPPLILSPEQLADSIEDLYNNPETYQQLSDGAREYAAASRRFNDLAQALCQRLLTLAPP
FT                   RPHD"
FT   gene            complement(50362..51468)
FT                   /locus_tag="ETAF_0051"
FT   CDS_pept        complement(50362..51468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0051"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40174"
FT                   /db_xref="GOA:A0A0H3DNQ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNQ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40174.1"
FT                   /translation="MNIAHFETSMDWGGQELRIVEQAEWLNQNGYPTWIIARPGSAILA
FT                   KAQEKNLPTFAIRVRGSVHPKTLAPLLKFIRAQRIDILDCHGSRDAVYGALVKLLTGVK
FT                   VIRSRHVTDPIKMSGLHGLVWRHGNHGIITTAKKIQEMLETQGIPNKDKTLVAPAGVDP
FT                   QRFSPEHDAQQLRARLGIAADSLVIANIGMIRPDKGQNYYVEACKQLLDKGVPITCIQV
FT                   GEATSQTADFKRQVLELAQPYVDKQIRFLGYHNDIENYLAIADIVVVASVATEAQTRLV
FT                   SQAFLMKKNVVATTTGGLPEMIAHEQTGLLCPPHDAKALADAVCRLIEQPPLRAQLREN
FT                   AYQHALQYMTFDYMIKEMVKFYQATLHQ"
FT   gene            complement(51472..52629)
FT                   /locus_tag="ETAF_0052"
FT   CDS_pept        complement(51472..52629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0052"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40175"
FT                   /db_xref="GOA:A0A0H3DNT3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNT3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40175.1"
FT                   /translation="MAEKSIVHLVNLRDFGGVERLILDYVINGKEHNWVIINTANSLNK
FT                   RFNEHANSIIFCNRAIQSAAIQIPSFIRKKALWNKIKKINPSHVVIWNQIVSLEDKPDS
FT                   IKAIYYDHGAVWEVEKNKKTIDFFKRIDGCICVSQASKKILENKFEHRCDISVILNRTS
FT                   VESRDSIIADEKKKTFTIGCAARFSPLKALGLLPLIAEETALRGFNFNFIIAGTGEEES
FT                   ALASLIDKKNLKKSIKTIGFLDNLNDFYKHIDVYISTSAHETCSLSCIEAMSFGIPIIS
FT                   ANIDGQPEIISNGHTGFCISPTLSMEDYCKKTGMSLPFQKDIYYPENDTIGPPRLLSPK
FT                   DAADKIIEIYLHGVDDYKKNSRHRAKELFDDKTFEENLIKIVRNF"
FT   gene            complement(52631..53764)
FT                   /locus_tag="ETAF_0053"
FT   CDS_pept        complement(52631..53764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40176"
FT                   /db_xref="GOA:A0A0H3DQ79"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ79"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40176.1"
FT                   /translation="MKTNFIDKLPIYISALFCAFISLLSISDDNNIVSNIYYVSFALFI
FT                   VWCIRERKNIFNKASLLLGAFLLLSAISTYWSDHSKDTSRYIQHAVYIFIFSSIIYELR
FT                   GTLFFKNILFKSYVATCSIFVIINGFLFYSKYNLYDRFYPILGPSNTIDYAGILCLAII
FT                   FCCYLYQHEKNKAPYVIAGIVLLAGVILSQSRTPIIALAISLMVLFIKSKRSAIISLVT
FT                   ILAIIFLIHTVYPSIFTRDAVNGAPTPRIFTWLYTIQQVSEHHPWLGFGYNDTFAHYFK
FT                   PRNFTYNNAHSVFMSMLYYSGIIGVILFFSYILNIFFAAIKVFNENRYPIAFILISLIF
FT                   SSTQGYLYIYHPREIWLVLWLPLFLAIPMSKISSEQV"
FT   gene            complement(53754..54719)
FT                   /locus_tag="ETAF_0054"
FT   CDS_pept        complement(53754..54719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0054"
FT                   /product="Lipopolysaccharide heptosyltransferase I"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40177"
FT                   /db_xref="GOA:A0A0H3DLP4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40177.1"
FT                   /translation="MRILMVKTSSMGDVIHTLPALTDAQQAIPGLCVDWVVEEGFAQIP
FT                   SWHAAVDRVIPVAIRRWRKNLLSAQTRQEWRTFKQQLRQERYDAVIDAQGLLKSALLVT
FT                   HNALGTRHGFDRRSAREPLASLFYDRRHRVARDQHAVERTRQLVAQSLGYPLPAQRGDY
FT                   AIARHFTQQLPMDAGQYMVFLHATTRDEKHWPEAHWRELIAWVGRHTTQRIKLPWGAEH
FT                   EHQRALRLAEGFPHVDVLPKMALSDVATVLAGASQVISVDTGLSHLAAALDRPNITLYG
FT                   PTDPGLIGGYGKNQLEIIEPTHSLDALPSLAVVEYLKNEN"
FT   gene            complement(54707..55768)
FT                   /locus_tag="ETAF_0055"
FT   CDS_pept        complement(54707..55768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0055"
FT                   /product="ADP-heptose--lipooligosaccharide
FT                   heptosyltransferase II"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40178"
FT                   /db_xref="GOA:A0A0H3DLZ2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40178.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKATYPEAEIDVMAPNWCRPLL
FT                   ERMPEVHQAIPMPLGHGTLGLGERYRLGRQLREREYDRAYVLPNSFKSALIPFFARIPV
FT                   RTGWKGELRYGLLNDLRQLDKSAFPLMVERYAALAYPATQIRRAADLPQPLLWPALQVR
FT                   DEEIAETAAAFNLTDHRPVIGFCPGAEFGPAKRWPHYHYAALAQRLIGQGYQIALFGSA
FT                   KDTDAGEEIRRTLDEESREYCLNLAGHTSLDQAVALIAACQAIVSNDSGLMHIAAALDK
FT                   PLVALYGPSSPDFTPPLSQHARVIRLISGYHKVRRGEGETGYHQSLIDITPDRVEQTLQ
FT                   ALLHDEKESGCVS"
FT   gene            complement(55792..56721)
FT                   /locus_tag="ETAF_0056"
FT   CDS_pept        complement(55792..56721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0056"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40179"
FT                   /db_xref="GOA:A0A0H3DNR4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNR4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40179.1"
FT                   /translation="MIIVTGGAGMIGSNIVKALNDKGYTDILVVDNLKDGTKFVNLVDL
FT                   DITDYMDKEDFIAGIVAGDDFGDIDAVFHEGACSSTTEWDGKYVMDNNYQYSKELLHFC
FT                   LERQIPFLYASSAATYGMTDKFVEDRRYEGPLNVYGYSKFLFDQYVRRILPHAESQICG
FT                   FRYFNVYGPREGHKGGMASVAFHLNTQINNGEQPKLFEGSENFRRDFIYVGDVADVNLW
FT                   FWENGVSGIFNCGTGNAESFQAVADAVVAYHQKGSVTYIPFPDKLKGRYQAFTQADTTQ
FT                   LRAAGYSRPFKTVAQGVREYMEWLNRKP"
FT   gene            57012..58208
FT                   /locus_tag="ETAF_0057"
FT   CDS_pept        57012..58208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0057"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40180"
FT                   /db_xref="GOA:A0A0H3DNT7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNT7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40180.1"
FT                   /translation="MSADFYQQLAQQLVATRAEGLYKNERIITSAQQAEIAVADGSRVL
FT                   NFCANNYLGLADHPALIAAAKAGMDSHGFGMASVRFICGTQDSHKALEQQLADFLGMED
FT                   AILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKARRYRYANNDMAELKA
FT                   RLELARAEGARHIMIATDGVFSMDGVIADLRSICDLADEYDALVMVDDSHAVGFVGAHG
FT                   RGTPEYCGVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAI
FT                   VAASSQVLTLLAQGDDLRARLWDNARLFREKMTAAGFTLAGADHAIIPVMLGEAKLAQR
FT                   FADLLLQEGIYVTGFFYPVVPQGQARIRTQMSAAHTPAQIEQAVAAFIRVGKQLGVIA"
FT   gene            58218..59243
FT                   /locus_tag="ETAF_0058"
FT   CDS_pept        58218..59243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0058"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40181"
FT                   /db_xref="GOA:A0A0H3DQ84"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ84"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40181.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPLPALGHNDIMIKIRKTAICGTDVHIY
FT                   NWDAWSQKTIPVPMVVGHEYVGEVVAVGQEVSGFRIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTIGVGVNRQGAFAEYLVIPAFNAFKIPDNIPDTLAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCRHVGARHVVITDVNDYRLDLARKMGVTRAVNVSRESLPE
FT                   VMQALGMSEGFDVGLEMSGAPPAFRTMLDTMNHGGKIAMLGIPPGDMAIDWNQVIFKGL
FT                   LIKGIYGREMFETWYKMAALIQSGLDLTPIITHQYAIDDFQKGFDAMRSGHSGKVILNW
FT                   S"
FT   gene            complement(59299..60819)
FT                   /locus_tag="ETAF_0059"
FT   CDS_pept        complement(59299..60819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0059"
FT                   /product="Mg(2+) Chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40182"
FT                   /db_xref="GOA:A0A0H3DLP8"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40182.1"
FT                   /translation="MTLATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREA
FT                   KDRVRCAMLNSGFQFPPKRITLNLAPADLPKEGGRYDLPMALALLLASEQLAPRVSVGD
FT                   YEFIGELALSGDLRSVQGTLPAALSAARAKRTLIAPSDNAAELGLLAAPRPPVAPSLLA
FT                   VCAFLSGQASLETAPAGKMTSDCAGAGDMADIIGQAQARRALEIAAAGGHNLLLIGPPG
FT                   TGKTMLACRLPGLLPPMTPDEALEQAAISSLAYPGAMPPRYGMRPFRAPHHSASMAALI
FT                   GGGPLPKPGEISLAHHGVLFLDELAEFDRRTLDALREPLESGVVHLSRARIKVSFPARV
FT                   QLVAAMNPSSGGHADGRDRRAAPQQVLRYLSRLSGPLLDRFDLSIDVPPLSPGLLARQR
FT                   ADGEDSATLRRRVCAARARQYARGGRLNAHLEGAARDRDCRLAPDDALYLEQALTRLAL
FT                   SVRAWHRLLKVARTLADLEGCDDIARRHLAEALSYRAMDRLLLSLQRG"
FT   gene            61107..62342
FT                   /locus_tag="ETAF_0060"
FT   CDS_pept        61107..62342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0060"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40183"
FT                   /db_xref="GOA:A0A0H3DLZ7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40183.1"
FT                   /translation="MLGWSAQQRNVAIASFLSWTLDSFDFFILVFLLSDIARTFHVGVE
FT                   QVTLAILLTLAVRPIGALIFGRAAEKYGRRPILMLNIICFSLFELLSAAAPSLLIFLLL
FT                   RALYGVAMGGIWGVASSLTMETIPDRSRGLMSGIFQAGYPFGYLLAAVIYGLCAQTLGW
FT                   RGMFIVGAVPIVLLPFIYFYVPESPVWLAARAQHQSVALLPVLRRHWTLCVYLVALMAA
FT                   FNFFSHGTQDLYPTFLRVQHGFSTNVISIIAVAYNIASIIGGVFFGILSERIGRKRAIM
FT                   LAALLALPVIPLWAFSSGSLMLGVGAFLMQFMVQGAWGVIPTYLNELVPANARAVLPGF
FT                   VYQLGNLIASVNATMQASIAADHGQNYALAMAITAACVALTIVALIAFGRDTRGVSMAE
FT                   KIPRQDKSIKIS"
FT   gene            62751..64355
FT                   /locus_tag="ETAF_0061"
FT   CDS_pept        62751..64355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0061"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40184"
FT                   /db_xref="GOA:A0A0H3DNR9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNR9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40184.1"
FT                   /translation="MNQVFGYPGGAIMPLYDALYDGGVAHLLCRHEQGAVMAAIGYARA
FT                   SGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALIGTDAFQEMDVLGLSL
FT                   ACTKHSFMVTSLAELPEVMDRAFAIAMQGRPGPVLIDIPKDIQLAQGELATPLCSVASA
FT                   QAPCQPAALAQARAMLAQAQRPVLYVGGGVGMADAVLALRSLVSRSGMPVAATLKGLGA
FT                   ADDRHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGRLDAFAPQAQVIHLDI
FT                   DPAELGKLRQAHVSLCGDLNPLLSALTMPLDIAPWLQQVAALKAQHAWRYDHPGEAIYA
FT                   PLFLRQLSECKPPQAVVTTDVGQHQMWSAQHMQFSLPQDFITSSGLGTMGFGIPAAVGA
FT                   QVARPDDCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQRLGMVRQWQQLFFDAR
FT                   YSETDLSDNPDFLTLAQAFDIPGQRISCKAQVAGALEALFSTPGPYLLQVAIDEFENVW
FT                   PLVPPGAGNESMLENVS"
FT   gene            64352..64642
FT                   /locus_tag="ETAF_0062"
FT   CDS_pept        64352..64642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0062"
FT                   /product="Acetolactate synthase small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40185"
FT                   /db_xref="GOA:A0A0H3DNU2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40185.1"
FT                   /translation="MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDG
FT                   DCDSVSIELTVASTRPVTLLSSQLSKLLDVARVDVSAPRSLRMLPRRQALG"
FT   gene            64695..65624
FT                   /locus_tag="ETAF_0063"
FT   CDS_pept        64695..65624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0063"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40186"
FT                   /db_xref="GOA:A0A0H3DQ87"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ87"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40186.1"
FT                   /translation="MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYDT
FT                   HRGPAVFRHREHMQRLHDSARIYRMPLAYSVDELMAACRETLRRNQLSSAYIRPLVFIG
FT                   DVGMGVNPPAGYSTDVILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGIT
FT                   RDAIITLAQAQGLEVREQVLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPI
FT                   TKRVQQAFFGLFNGQTEDRFGWLDPVNP"
FT   gene            65726..67576
FT                   /locus_tag="ETAF_0064"
FT   CDS_pept        65726..67576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0064"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40187"
FT                   /db_xref="GOA:A0A0H3DLQ1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40187.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGRLVAAQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTKLSDRLIKLD
FT                   LVDAMIQGANPQVSDAQSEQIERAACPTCGSCSGMFTANSMNCLTEALGLALPGNGSLL
FT                   ATHADRRALFEEAGRRIVALTHRYYEQDDASALPRSIAGKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFTLADIDRLSRQVPHLCKVAPSTPDYHMEDVHRAGGVMGLLGELD
FT                   RAGLLNRGVVNVLGLDLNETLARYDIMRSDDEALRRLYSAGPAGLRTVEPFSQSCRWDA
FT                   LDRDRQHGCIRAREHAYSQDGGLAVLSGNLAQDGCIVKTAGVDPESLIFRGPARVFESQ
FT                   EGAVEAILGGRIQPGDVLVIRYEGPKGGPGMQEMLYPTAYLKSMGLGKQCALITDGRFS
FT                   GGTSGLSIGHVSPEAASGGAIALVRDGDPIEIDIPARHIRIAIAESELALRRQQEQARG
FT                   AQAWTPRDRRRAVSLALRAYASLATSADRGAVRDRAKLGG"
FT   gene            67579..69123
FT                   /locus_tag="ETAF_0065"
FT   CDS_pept        67579..69123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0065"
FT                   /product="Threonine dehydratase biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40188"
FT                   /db_xref="GOA:A0A0H3DM00"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM00"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40188.1"
FT                   /translation="MTSKPLISSAPDGAEYLRAVLRSPVYEVAQVTPLQAMEKLSGRLG
FT                   NHILVKREDRQPVHSFKLRGAYAMIAGLSEAQRACGVITASAGNHAQGVALSASRLGIA
FT                   ATIVMPRATAEIKVEAVRGFGGRVLLYGANFDEAKAHAIQMAQETGMTFIPPFDHPAVI
FT                   AGQGTLALELLQQDAHLDRIFVPVGGGGLAAGVAVLIKQLMPQVKVIGVEAEDSACLRA
FT                   ALDAGQPVDLPRVGLFAEGVAVKRIGDETFRLCQRYLDDVITVDSDAICAAVKDLFEDV
FT                   RAVAEPSGALALAGLKQYVQRHALRGERLAHVLSGANLNFHGLRYVSERCELGEQREAL
FT                   LAVTIPERKGSFLAFCQLLGGRSVTEFNYRYADADSACIFVGVRLTNGRGEREEIIASL
FT                   RGGGYQVVDLSDDEMAKLHVRYMVGGRPSKPLQERLYSFEFPEAPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFERPDSDASFEARLKELGYECHDETGNPAFRFFLQG"
FT   gene            complement(69127..70023)
FT                   /gene="ilvY"
FT                   /locus_tag="ETAF_0066"
FT   CDS_pept        complement(69127..70023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="ETAF_0066"
FT                   /product="HTH-type transcriptional regulator IlvY"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40189"
FT                   /db_xref="GOA:A0A0H3DNS5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNS5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40189.1"
FT                   /translation="MDIRDLKLFLHLSESRHFGRTAAAVHVSPSTLSRQIQRLEEELGQ
FT                   PLLLRDNRDVRLTAAGEQLQDFARQTLLHYRQLRGGLDSHGAALCGELHLFCSVTAAYS
FT                   HLPPILDRFRAHHPQVDIRLTTGDAADAVSKVQGGAADLAIAGRPQSLPAHVEFCPIGE
FT                   IPLRLIAPAQPCPVRRQAQSPRPDWAQIPFILPQHGPARQRIDQWFRRRRIPAPRIYAT
FT                   VAGHEAIVSMVALGCGIALLPEVVIDNSPDSVRARIVTLDNDVAIAPFELGVCVQHKRL
FT                   REPPIAAFWSLLARATP"
FT   gene            70222..71700
FT                   /locus_tag="ETAF_0067"
FT   CDS_pept        70222..71700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0067"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40190"
FT                   /db_xref="GOA:A0A0H3DNU7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40190.1"
FT                   /translation="MTNYFNTLNLRQQLAQLGKCRFMARAEFADGVNALRGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRAEAIAERRDSYRRATEHGFSVGDYQTLIPQADLVIN
FT                   LTPDKQHAAVVSAVQPLMKQGAALGYSHGFNIVEVGQQIRPDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPRGEGMAIAKAWASATGGDRAGVLVSSFVAEVKSDLMGEQ
FT                   TILCGMLQTGSLLCYERLVAEGADPAWAGKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALAEQLKTLMAPLFAKHMDDILSGAFSQGMMADWAADDDHLLTWRAETGESAFE
FT                   KAPPFEGKIDEQTYFDRGVLLVAMVKAGVELAFETMVASGIVAESAYYESLHELPLIAN
FT                   TIARRRLYEMNVVISDTAEYGNYLFANAAVPLLRQAFMATLQPGDLGQSLPAEAVDNAA
FT                   LREVNQAIRQHPIETVGERLRGYMTDMKRVAVAG"
FT   gene            complement(71697..71978)
FT                   /gene="ppiC"
FT                   /locus_tag="ETAF_0068"
FT   CDS_pept        complement(71697..71978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="ETAF_0068"
FT                   /product="parvulin-like peptidyl-prolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40191"
FT                   /db_xref="GOA:A0A0H3DQ91"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ91"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40191.1"
FT                   /translation="MARRAAALHILVESQAEAESLLQKLKRGAQFQTLARRHSRCPSKR
FT                   QGGDLGEFTKGSMVPEFDRAVFSGPLLTPIGPIKTRFGYHIIKVLYRS"
FT   gene            72039..74219
FT                   /locus_tag="ETAF_0069"
FT   CDS_pept        72039..74219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0069"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40192"
FT                   /db_xref="GOA:A0A0H3DLQ4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40192.1"
FT                   /translation="MRSPAGAMKTCVVYGGGAAQAMRRRRGFFSAVAFCYNRLPPTGVI
FT                   ISRNIVMRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRVCGYQARHIAAV
FT                   TFTNKAAREMKERVAQTLGRKEARGLMISTFHTLGLEIIKREYKALGMKSNFSLFDDQD
FT                   QLALLTDLTERWLEKDKTQLQQLIATISNWKNDLIDPAQAAAQARSARERLFADCYGLY
FT                   DTQLKSCNVLDFDDLILLPTLLLRRDPEVRERWQQRIRYLLVDEYQDTNTSQYELVKLL
FT                   VGTRARFTVVGDDDQSIYSWRGARPQNLVLLKEDFPALQVVKLEQNYRSSQRILKAANI
FT                   LIANNPHVFEKRLFSELGYGEPLKVITANNEDHEAERVVGELIAHHFIHKTAYSDYAIL
FT                   YRGNHQSRVFEKMLMQNRIPYKISGGTSFFSRAEIKDLLSYLRVLTNPDDDSAFLRIVN
FT                   TPRREIGPSTLQKLGAWANQRGISLFRASFDVGLEQTLSGRGLASLQHFTRWMDELSQL
FT                   CERDATAAVRDLIHGIDYESWLFETSASPRAAEMRMKNVNQLFGWMTDMLQGSDLDEPM
FT                   TLTQVVNRFTLRDMMERGESEEEADQVQLMTLHASKGLEFPYVYLVGMEEGLLPHQSSI
FT                   DEDNVDEERRLAYVGITRAQKELVFTLCRERRQYGELMRPEPSRFLLELPQDDLSWESA
FT                   RKVVSPQERMQRGQSHLANLKAQLARAKSAQD"
FT   gene            complement(74290..75792)
FT                   /locus_tag="ETAF_0070"
FT   CDS_pept        complement(74290..75792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0070"
FT                   /product="Guanosine-5-triphosphate,3-diphosphate
FT                   pyrophosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40193"
FT                   /db_xref="GOA:A0A0H3DM05"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM05"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40193.1"
FT                   /translation="MSKSAALYAAIDLGSNSFHMLVVREMAGGIQTLARIKRKVRLAAG
FT                   LDADNILSPDAMQRGWQCLHLFAERLQDIPTDHIRVVATATLRIARNADAFIARAQEIL
FT                   GRPVRIISGEEEARLIYQGVAHTTGGARRRLVVDIGGGSTELACGEGAKADVLFSLQMG
FT                   CVTWLERYFSDRHLTQANFARAGDAAHAMIAPVRDTLLRHGWQACVGASGTVQALQEIM
FT                   VAQGMDERITLDKLCQLRDRAIECGKLEELEIDGLTLERALVFPSGLAILIALFEALHI
FT                   DSMTLSGGALREGLVYGMLALPVGCDVRTRTLHNIQRRFLIDEGQAERVWRLADGLARQ
FT                   LSTPWPLDSCAHTLLHAACLLHELGLSVDVRQAPQHAAYLVRHLDLPGFTPAQKKLLAT
FT                   LLANQSGPLNLALFGQQNAVPLRTAQRLCRLLRLAIIFASQRHDGALPPLLTQVCEEDA
FT                   LRLILPVDWLADHPLRAESLQQESLWQGYAHWPLQIVDATSA"
FT   gene            complement(75798..77072)
FT                   /gene="rhlB"
FT                   /locus_tag="ETAF_0071"
FT   CDS_pept        complement(75798..77072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="ETAF_0071"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40194"
FT                   /db_xref="GOA:A0A0H3DNS7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNS7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40194.1"
FT                   /translation="MTEQKFADFALHPMVIKALESKGFHSCTPIQALALPLAIAGRDVA
FT                   GQAQTGTGKTLAFLASTFHYLLTHPAIAERKTNQPRALIMAPTRELAVQIHSDAEPLAQ
FT                   ETGLRLGLAYGGDGYDKQLRVLEQGVDILIGTTGRLIDYAKQGHVDLGAIQVVVLDEAD
FT                   RMFDLGFIKDIRWLFRRMPPTAQRLNMLFSATLSYRVRELAFEHMNNAEYVEVEPEQKT
FT                   GHRIQEELFYPSNEEKMRLLQTLLEEEWPDRCIIFANTKHRCEDIWGHLAADGHRVGLL
FT                   TGDVPQKKRLRILEDFTKGHIDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIG
FT                   RTGRAGASGKSISLACEEYVLNLPAIESYIGHSIPVSKYNSDALLKDLPAPKRLSRSRN
FT                   GAGARRPGSPRRGSGAPRPNRKRSG"
FT   gene            77233..77559
FT                   /locus_tag="ETAF_0072"
FT   CDS_pept        77233..77559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0072"
FT                   /product="thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40195"
FT                   /db_xref="GOA:A0A0H3DNV0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNV0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40195.1"
FT                   /translation="MSDKIVHLSDSGFEADVLKAEGPILVDFWAEWCGPCKMIAPILDE
FT                   IAAEYAGKLTIAKLNIDENPATAPKYGIRGIPTLLLFKNGAVAATKVGALSKTQLKEFL
FT                   DANL"
FT   gene            77993..79252
FT                   /locus_tag="ETAF_0073"
FT   CDS_pept        77993..79252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0073"
FT                   /product="Transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40196"
FT                   /db_xref="GOA:A0A0H3DQ97"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ97"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40196.1"
FT                   /translation="MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTPEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            79529..80617
FT                   /locus_tag="ETAF_0074"
FT   CDS_pept        79529..80617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0074"
FT                   /product="Undecaprenyl-phosphate N-acetylglucosaminyl
FT                   1-phosphate transferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40197"
FT                   /db_xref="GOA:A0A0H3DLQ7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40197.1"
FT                   /translation="MNLLTLSSKFFLIFIFSMAFLLVARRVAKKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVYAGICFTFLFFKPYIPHATLYLICAGILVLVGALDDRFDISVKFRATVQ
FT                   ALIAIAMMVAGGLYLRSLGFVLGPWEMILGPFGYLVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVTFAAMGILLQWDGQPDLALWCFAIIAATLPYILLNLGVVGPRFKVFMGDAGSTL
FT                   IGFTVIWILLESTQGRGHPMNPVTALWVIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLAAIGVLGEIWLPEYVMMALFLLAFALYGYCIKRAW
FT                   RVARMVKRFKRRLRRKSAGMHV"
FT   gene            80648..81685
FT                   /locus_tag="ETAF_0075"
FT   CDS_pept        80648..81685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0075"
FT                   /product="lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40198"
FT                   /db_xref="GOA:A0A0H3DM11"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM11"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40198.1"
FT                   /translation="MVSQNPMPVENELDVRGLCRALWRGKPWIVGTAALFAALALGVSL
FT                   LMPQKWSAAAITASPGVNSLGGYYSQQQFLRNLAQLSAPSGAVAQGSIADEAYAEFTTQ
FT                   LASYDTRREFWLHSPYYQSHKEGSAQADAALLDELINQIVFTPGDAAKHSDDSIRLTAD
FT                   GAAQANQLLRQYVAFATHRASANLNESLQGAWAARSIFLKAQVKRQEAVAQAIYQRELN
FT                   GLEQGLKIAAQQGITRSMATTAQVEVPDAELFMLGQPMLRARLEALRAVGPSYDIDYDR
FT                   NRAMLTTLSVGPVLDAAFQPYRYLRTPEEPVKRDSPRRLFMMVMWGAIGALVGAGIALS
FT                   RRARI"
FT   gene            81769..82899
FT                   /locus_tag="ETAF_0076"
FT   CDS_pept        81769..82899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0076"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40199"
FT                   /db_xref="GOA:A0A0H3DNT2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNT2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40199.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAADAAFDARVCVTAQHREMLDQ
FT                   VLGLFQIVPDYDLNIMRPGQDLSDITCRILEGLKPVLAEFRPDVVLVHGDTTTTLAASL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLASLHFAPTLTARANLLREGIRE
FT                   QTIHLTGNSVVDALLWVRDRICADAALQTRLAASYPFLAADKPLLLVTGHRRESFGGGF
FT                   ERICGALAQIARSHPQVQVVYPVHLNPNVSEPVNRILRDIENVFLIPPQDYLPFVYLMG
FT                   RAQLILTDSGGIQEEAPSLGKPVLVMRETTERPEAVQAGTVRLVGTDTATIVSQVSQLL
FT                   EDEQQYRAMSHATNPYGDGQACQRILSALKNYRATL"
FT   gene            82896..84158
FT                   /locus_tag="ETAF_0077"
FT   CDS_pept        82896..84158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0077"
FT                   /product="UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40200"
FT                   /db_xref="GOA:A0A0H3DNV4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNV4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40200.1"
FT                   /translation="MSFDTISVIGLGYIGLPTAVAFAGCRKQVIGVDVSQHAVETINRG
FT                   EIHIVEPDLDRAVKRAVEGGFLRAVMRPEPADAFLIAVPTPFKGDHEPDLTYVEAAARS
FT                   IAPVLKKGDLVILESTSPVGATEQMCAWLAECRTDLRFPHQDGEQADIRVAYCPERVLP
FT                   GKIMVELLRNDRVIGGMTPTCSAQACALYKLFLEGECVETNARTAEMCKLTENSFRDVN
FT                   IAFANELSLICDAQGIDVWQLIALANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAALADCLAAEDKRASEATIACFGLAFKPDIDDLRES
FT                   PAMEIAEMVAQWHSGTTLVVEPNIHQLPARLAGMAQLTDCATALAQADVVVLLVDHQPF
FT                   RALAPQAVTQRFVVDTKGVWR"
FT   gene            84149..85219
FT                   /locus_tag="ETAF_0078"
FT   CDS_pept        84149..85219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0078"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40201"
FT                   /db_xref="GOA:A0A0H3DQA1"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQA1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40201.1"
FT                   /translation="MAVRRILVTGGAGFIGSAVVRHIIMDTADSVVVVDKLTYAGNLAS
FT                   LAPAAGSDRYAFERADIGDRAAMDRILAQYRPDAIMHLAAESHVDRSIDGPADFIQTNI
FT                   VGTYTLLEATRRYWSALPAAPRAAFRFHHISTDEVYGDLHGPQALFREDTPYAPSSPYS
FT                   ASKAASDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLTIINALAAKPLPVYGNG
FT                   LQVRDWLYVEDHARALYRVLMTGRVGETYNIGGHNERRNIDVVTTLCALLQEMVPEKPA
FT                   GVRHFADLITYVADRPGHDVRYAIDASKIERELGWRPQETFESGIRKTVAWYLANERWW
FT                   RAVMDGSYAGERLGLA"
FT   gene            85252..86133
FT                   /locus_tag="ETAF_0079"
FT   CDS_pept        85252..86133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0079"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40202"
FT                   /db_xref="GOA:A0A0H3DLR1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40202.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IRDILLISTPQDLPAFQRLLGDGSDIGVRLQYAEQPRPEGLAQAFLIGESFLDGDSCCL
FT                   VLGDNIFFGQGFSPKLRQVAQRERGATVFGYQVMDPERFGVVEFDDDFRALSIEEKPQR
FT                   PRSNWAVTGLYFYDAQVVDFARRVTPSVRGELEITSINQMYLQRGELNVELLGRGFAWL
FT                   DTGTHDSLLEASAFVQTVEKRQGFKIACLEEIAWRNGWLDDHGVARAAASLGKTAYGAY
FT                   LRELLHVRPRQY"
FT   gene            86111..86806
FT                   /gene="rffC"
FT                   /locus_tag="ETAF_0080"
FT   CDS_pept        86111..86806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffC"
FT                   /locus_tag="ETAF_0080"
FT                   /product="Lipopolysaccharide biosynthesis protein RffC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40203"
FT                   /db_xref="GOA:A0A0H3DM15"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM15"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40203.1"
FT                   /translation="MSVHASIEPLAWESAFFALRSGRLRFDDRAPPLQASACDAYQLLQ
FT                   AKVDARDLARCDALQALGFRLAEGEADFVLPVSSAPTFGGQRQAQAQDCLWLRALARNA
FT                   FALSRFRAPWYRAEDSARFYAEWVEKAVYGTFDHACLLALDDEGTPQGFVTLRRQVDGS
FT                   ARIGLLAVDNASFRCGVGRRLVAQAQAWCHAQSLSRLYVATQIGNLAAQRLYLGCGAQL
FT                   AATAYWLYR"
FT   gene            86832..87962
FT                   /gene="rffA"
FT                   /locus_tag="ETAF_0081"
FT   CDS_pept        86832..87962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffA"
FT                   /locus_tag="ETAF_0081"
FT                   /product="Lipopolysaccharide biosynthesis protein RffA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40204"
FT                   /db_xref="GOA:A0A0H3DNT6"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNT6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40204.1"
FT                   /translation="MIPFNAPPVTGSESDYMQAAMASGKLCGDGGFTRRCQQWMEQRFG
FT                   SAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSFTFVSTANAFVLRGARIVFVDVRPDT
FT                   MNIDETRIEAAITEKTRAIVPVHYAGVACEMDTIMALAQQYGLYVVEDAAQGVMATYKG
FT                   RALGTIGHIGCYSFHETKNYTAGGEGGATLINDAALIERAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWAQLEVADRINQRRLQLWQQYHDALAPLAEAGRLTLPT
FT                   TPAHCGHNAHMFYLKLRDMRERSAFIDFLKEAEIMAVFHYIPLHCSPAGARFGRFVGED
FT                   RYTTCESERLVRLPLFYNLPDVNQRTVINSIQSFFR"
FT   gene            87962..89212
FT                   /gene="wzxE"
FT                   /locus_tag="ETAF_0082"
FT   CDS_pept        87962..89212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzxE"
FT                   /locus_tag="ETAF_0082"
FT                   /product="WzxE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40205"
FT                   /db_xref="GOA:A0A0H3DNW0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNW0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40205.1"
FT                   /translation="MSLARASLWTAGSTLIKIGAGLVVVKLLAVAFGPVGVGQAANFRQ
FT                   VITVLGVLSGAGIFNGITKYVAEYRQQPQRLRALLGTASTMILGFSLLLALIFTLGAAP
FT                   ISVALFGHDRYQAVIRLVALLQMGIACANYCLAVIKGYRDARGNALAVSLGSLLGVAAY
FT                   TLSYFLGGYRGALAGLALVPAAATLPALWVLWRQRHIPWRYVRPSWDRPLAASLGKFTL
FT                   MAVMTAVTMPVAYVMMRNQLAALDGWEAVGIWQGVSGISDAYLQFITASFSVYLLPTLA
FT                   GLHSRQAVGQEILRALRFVLPAVAAVSFTVWLLRDLVIWLLLSGKFSAMRDLFAWQLTG
FT                   DVFKVGAYVFGYLVIAKASLRFYLLCEISQFILLTLLSRILIPLHGALGAAQAYMATYI
FT                   IYFLLCGSVFWIYRNRA"
FT   gene            89209..90285
FT                   /locus_tag="ETAF_0083"
FT   CDS_pept        89209..90285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0083"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40206"
FT                   /db_xref="GOA:A0A0H3DQA5"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQA5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40206.1"
FT                   /translation="MTTLIHVLGADIPHHNLTLLRFFDGMLSQRAATAPRRRFMVVARD
FT                   AAPFADLTTLDIEVWPDKRALARALLARASADRALRFFLHGQFNPWLWLALLCGRLRPQ
FT                   QVLWHVWGADLYEEARGWKYRLYYGLRRRAQGRVGHVFATLGDLDYYRRRHPRVATSTL
FT                   YFPTRMDPALTCNQRARVTSGALTVLVGNSGDRSNRHLVALQRLHDTFGAQTRVIVPLG
FT                   YPANNQAYIAQVRERAEGLFGHNATLLTQQVAFTDYLALLARCDLGYFIFERQQGIGTL
FT                   CLLLQQGIPLVLSRQNPFWRDMVDQQLPVLFDDDAPDDAAVRAAQRQLAQRDLSRLAFF
FT                   DPNYTDGWLQALALGERP"
FT   gene            90282..91670
FT                   /locus_tag="ETAF_0084"
FT   CDS_pept        90282..91670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0084"
FT                   /product="Putative ECA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40207"
FT                   /db_xref="GOA:A0A0H3DLR3"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40207.1"
FT                   /translation="MTLMQFAGLALVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLL
FT                   TFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATAFYAIYYVTYKTRLRSATSASSGGS
FT                   AWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGVALKRFF
FT                   YFFIPAMLVVYFLRQTQAAWLFFLVSTVVFGLLTYVIVGGTRANIIIAFALFLFIGIQR
FT                   GWITLWMLALAGVVGVVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQ
FT                   HYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNSANYFTWQVLDNHSGLAISPTLIG
FT                   SLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCAASNRYRGAVIQAFCFGAVFNMIVLA
FT                   REGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRARAAIAAPSVGKGSPARKDR
FT                   NDGE"
FT   gene            91660..92400
FT                   /locus_tag="ETAF_0085"
FT   CDS_pept        91660..92400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0085"
FT                   /product="Probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40208"
FT                   /db_xref="GOA:A0A0H3DM18"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM18"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40208.1"
FT                   /translation="MESNGSIPHYAIRGIDIWGFRDSDQFLRHLLTETAVRPGTLVAIN
FT                   AEKVMTAEDDAALRALIAAAEYKYADGISIVRAIRRKYPGAQVSRIAGADLWEALMQRA
FT                   GELGIPVFLVGGQPDVLAQTEAALRRRWGVNVVGAQDGYFSPEQRNALFERIHASGAQI
FT                   VTVAMGSPRQEILMRDCRAYYPQALYMGVGGTYDVFTGRVRRAPHLWRRFGLEWLYRLL
FT                   SQPTRWRRQVKLLRFVAYYYARKL"
FT   gene            complement(92382..92534)
FT                   /locus_tag="ETAF_0086"
FT   CDS_pept        complement(92382..92534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40209"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40209.1"
FT                   /translation="MLSSAFLQKYRVWLHFAHSAVKAHAAEPKPTVRSRRHGLREATAR
FT                   YSFLA"
FT   gene            92575..92651
FT                   /gene="trnR"
FT                   /locus_tag="ETAF_3215"
FT   tRNA            92575..92651
FT                   /gene="trnR"
FT                   /locus_tag="ETAF_3215"
FT                   /product="tRNA-Arg"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            92710..92785
FT                   /gene="trnH"
FT                   /locus_tag="ETAF_3216"
FT   tRNA            92710..92785
FT                   /gene="trnH"
FT                   /locus_tag="ETAF_3216"
FT                   /product="tRNA-His"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            92800..92886
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3217"
FT   tRNA            92800..92886
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3217"
FT                   /product="tRNA-Leu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            92911..92987
FT                   /gene="trnP"
FT                   /locus_tag="ETAF_3218"
FT   tRNA            92911..92987
FT                   /gene="trnP"
FT                   /locus_tag="ETAF_3218"
FT                   /product="tRNA-Pro"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(93594..94793)
FT                   /locus_tag="ETAF_0087"
FT   CDS_pept        complement(93594..94793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0087"
FT                   /product="HemY protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40210"
FT                   /db_xref="GOA:A0A0H3DNW5"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNW5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40210.1"
FT                   /translation="MLKVLLLFIILIAGIVLGPMLAGHQGYVLIQTDSYNIETSVTSLV
FT                   IMLILLMLVLFALEWLLRRLLRTGARTRGWFMGRKRTRARRQTRAGLLKLTEGDYGQVE
FT                   KLLARNADHADQPLVNYLLAAEAAQQRGDELRANQYLERAAEVAGSDPLPVDITRVRLQ
FT                   LARGENHAARHGVDALLNYAPRHPEVLRLAEQAYLRTDAFGPLLEILPTLAKQGLHSDD
FT                   DIEKLQIRAYIGLMDQAMANGGSEGLKQWWKAQARKTRHETALQVALAEHLIECDDHGA
FT                   AQQIVVDGLKRRFDERLVQLMPRLKSGNPEQLEKLLQQQIRQHGASALLNSTLGQLLMR
FT                   HGEWQQAAEALRAALKQRPDAYDYAWLADTLDKLHRPEEAAQMRRDGLLLTLHQDQPTT
FT                   "
FT   gene            complement(94796..95944)
FT                   /locus_tag="ETAF_0088"
FT   CDS_pept        complement(94796..95944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0088"
FT                   /product="HemX protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40211"
FT                   /db_xref="GOA:A0A0H3DQB0"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQB0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40211.1"
FT                   /translation="MTEPTTPPDKAAAAETTTEQAQPLERAHKQDKQIVKKSAAGGPAL
FT                   GAIAIVLVIALGAGLYYHGHQQAQRQQASEQSLQEQLSALHTAQAQEKLRMEALLNKQA
FT                   KALDVATQLQASQSQQLKELEQKVAAISGNDANTWKLAQADFMVKLAERKLWSDQDVTT
FT                   AIALLKSADATLAGLDDPSLLGVRRALTEDISTLSTLNQIDFDGIILQLNQLANQVDDL
FT                   RLADNDSDEAPMDQDDGELSASLSQWRQNLAKSWHSFISEFITIRRRDSSAEPLLAPSQ
FT                   DVYLRENIRSRLLIAAQAVPRHQNQIYQQSLESVSAWVRAYFDVNDPSTKAFLNQIDAL
FT                   SQQSVSMILPDALKSQPLLDKLLHARSNALTAAPAAPATQGE"
FT   gene            complement(95963..96709)
FT                   /locus_tag="ETAF_0089"
FT   CDS_pept        complement(95963..96709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0089"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40212"
FT                   /db_xref="GOA:A0A0H3DLR6"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40212.1"
FT                   /translation="MSILVTRPSPAGEQLVERLRALGMEAWHTPLIDVAPGRQLALLPE
FT                   AVAALQRGDLLLAVSRHAVLYAAEALRLAGRGWPTTPRYAAIGHSTAQSLGAACHQSVI
FT                   FPPAPETSEALLALPAIRQLRARRALILRGNGGRDLIADALRARGVSVTLCECYRRVAI
FT                   AYPGDELCARWRQQKVSTLVVTSGEMLQQLYDLVPEYDRQRWLLSCRLIVVSERLAQRA
FT                   RDLGWQEIRVAESANNDALLRTLQIN"
FT   gene            complement(96716..97669)
FT                   /locus_tag="ETAF_0090"
FT   CDS_pept        complement(96716..97669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0090"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40213"
FT                   /db_xref="GOA:A0A0H3DM23"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM23"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40213.1"
FT                   /translation="MQSMTTATQPTLRIATRQSPLALWQAHYVRDQLLTHWPQLTIELV
FT                   PMVTRGDVLLDTPLAKVGGKGLFVKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTI
FT                   CQREDPRDAFVSPRFASLEQLPPGSVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLA
FT                   KLDAGDYDAIILAAAGLKRLQLDDRIRTPLTPEQSLPAVGQGAVGIECRLADDATRRLL
FT                   APLNHADTALRVCAERAMNTRLEGGCQVPIGSYAEIDGDQLWLRALVGAPDGSRIIRGE
FT                   RRGPLTQAEAMGTALADELLARGARTILDAVYCQKA"
FT   gene            97972..100527
FT                   /locus_tag="ETAF_0091"
FT   CDS_pept        97972..100527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0091"
FT                   /product="Adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40214"
FT                   /db_xref="GOA:A0A0H3DNU4"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40214.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALSAMGPAFQQVYTLLPTLLHFH
FT                   HPLMPGYLEGNVPHGICFFTPDEPQQNYLLHLEQRAPGSIPPVTGSDQMPITGLYTMGS
FT                   TSSIGQSCSSDLDIWVCHHSWLDASERSQLQQKCTLLEEWAASLGVEVSFFLIDENRFR
FT                   HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWSMVPGEEEEHYDEYVLSLYAQ
FT                   GALTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNTEL
FT                   LAMDIKQRLHKGEIVSFGLDPYCMMLDRVTHYLEQIGDHARLDLARRCFYLKVCEKMSR
FT                   ARACVGWRREILSQLVAHWGWDEALIRSLDNRANWKIGQVREAHNELLDAMMQSYRNLI
FT                   RFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSERDLTFIYVPVG
FT                   RANRSGWYLYNQAPTIDSIVSHQPLEYNRYLNKLVAWAYFNGLLTEETRLHIKANSSQC
FT                   DLNKLRELVRDVSNHFPLRLSAPTPKALYSPCEIRHLAIIVNLEHDPTATFSNQVVHFD
FT                   FRQLDVFSFGEQQQCLVGSVDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAP
FT                   PEAVEVFCYSRHLRGLIRTRLQQLVSECIDLRLSSSRQEPGRFKAVRVAGQTWGLFFER
FT                   LSVSVQKLENAVEFYGAISNNKLHGLSMQVETDQAHLPAVVDGYASEGIIQFFFEDGER
FT                   DGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQI
FT                   VTVEGRAQVIPFRSKAVTPPGAETEGDGDAAPRQQFKVY"
FT   gene            complement(100535..100858)
FT                   /gene="cyaY"
FT                   /locus_tag="ETAF_0092"
FT   CDS_pept        complement(100535..100858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="ETAF_0092"
FT                   /product="CyaY"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40215"
FT                   /db_xref="GOA:A0A0H3DNX0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNX0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40215.1"
FT                   /translation="MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFEN
FT                   GSKIVINRQEPLHQIWLATRAGGYHFDYRDGQWRCSRSGAPLHQVLNEACSAQAGVPVT
FT                   LDR"
FT   gene            100936..101163
FT                   /locus_tag="ETAF_0093"
FT   CDS_pept        100936..101163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40216"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQB5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40216.1"
FT                   /translation="MNRQFRSALLVLCAATLGGCGLKGPLYFPPAQQAPAAQKAPDAYS
FT                   VQAPSHEPVAQTPNTQTPNTAPAAEAGKAH"
FT   gene            101221..102045
FT                   /locus_tag="ETAF_0094"
FT   CDS_pept        101221..102045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0094"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40217"
FT                   /db_xref="GOA:A0A0H3DLR8"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40217.1"
FT                   /translation="MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQL
FT                   LVVEPPYDPDLDFHYRIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNGRM
FT                   TLHVGEDDRVTVNMGEPQFEPGRIPFKAAKAEKTYILRVAQQTVLCGAVSMGNPHCVLQ
FT                   VEDVSRAQVELLGPVLESHERFPERVNVGFMQVVERDHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQGLLDEQVQVDLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL"
FT   gene            102059..102763
FT                   /locus_tag="ETAF_0095"
FT   CDS_pept        102059..102763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40218"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM27"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40218.1"
FT                   /translation="MSERDSRDLLQPSLADEQVVAYLQQHPDFFIRNARQVEQMMIPHP
FT                   VRGAVSLLEWQLGRQRRQIAALDQEIEQLITLARDNERLFGSLLALQSHLASAQDMDDF
FT                   LQRLQRWARSLGLSGAYIRLFADRWRLGAPSRFSHLAIARSDVELLRIQRLGDANHYLG
FT                   SLNGQELLLLLPQARHVGSVALSLMGDFADLGLLVFTSADAQHYQQGMGTALLEQLARL
FT                   IPPMLTRWIERQ"
FT   gene            102760..103671
FT                   /gene="xerC"
FT                   /locus_tag="ETAF_0096"
FT   CDS_pept        102760..103671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="ETAF_0096"
FT                   /product="Tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40219"
FT                   /db_xref="GOA:A0A0H3DNU8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40219.1"
FT                   /translation="MTSLPEALSTPVAAFLQMMRVERQLSPRTVETYRRQLAASAALLL
FT                   EGGLCDWAALDTTRVRSLVARSRRQGLEPASLALRLSALRSFLDWQVSRGALTANPAKG
FT                   VAAPRQGRHLPKNLDVDDVNRLLDIDEGDTLAVRDRAMLEVMYGGGLRLSELVGLDCRH
FT                   VDLTTGEVWVLGKGSKERRLPVGREAVRWLQTWLSLRLSLQPQDDALFVSRLGGRISPR
FT                   SVQKRFAEWGVKQGVTSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKT"
FT   gene            103671..104387
FT                   /locus_tag="ETAF_0097"
FT   CDS_pept        103671..104387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0097"
FT                   /product="2-haloalkanoic acid dehalogenase"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40220"
FT                   /db_xref="GOA:A0A0H3DNX6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNX6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40220.1"
FT                   /translation="MHFYRPLQRPAALTFDLDDTLYDNHPVIVRSEQAALDFLRRRFPA
FT                   LQDFQSADWQRLRAELRASDPEIYHDVTQWRWRTVYEALWRAGLSPTYCHDGADEAMAH
FT                   FAQWRSRITVSTETHQILAALAARLPLAAITNGNADPARCGLGAYFRFVLRAGPDGRAK
FT                   PYSDMYLAAARHFNLAPGQILHVGDDLTTDVAGAVRSGMQACWVNDRGRSLLCAADGRL
FT                   LPHVEISRLDSLLALI"
FT   gene            104464..106623
FT                   /locus_tag="ETAF_0098"
FT   CDS_pept        104464..106623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0098"
FT                   /product="ATP-dependent DNA helicase UvrD/PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40221"
FT                   /db_xref="GOA:A0A0H3DQB9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQB9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40221.1"
FT                   /translation="MDVSDLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAW
FT                   LLAVENCSPFSIMAVTFTNKAAAEMRHRIEALIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   AGLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPARQGMWYINGKKDDGLRPQHIESYG
FT                   NPVEQTWLRIYQAYQEACDRAGLVDFAELLLRAHELWLHKPQILEHYRARFNNILVDEF
FT                   QDTNRIQYAWIRMLAGDSGRVMIVGDDDQSIYGWRGAQVENIQKFLDDFPGAQTIRLEQ
FT                   NYRSSGNILRAANALIENNDGRLGKKLWTEDGEGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGALKECAILYRSNAQSRVLEEALLQAATPYRIYGGMRFFERQEIKDALAYLRLLS
FT                   NRNDDAAFERVVNTPVRGIGDRTLDVVRQTARDRQLTLWQATRALLQEQVFPGRAANAL
FT                   RRFLELIEALAQDSDDLPLHVQTDRVIRDSGLRQMYEQEKGEKGQTRIENLEELVTATR
FT                   QFSYEDDDDLSPLQAFLSHAALESGEGQADAYQDAVQLMTLHSAKGLEFPQVFIVGMEE
FT                   GMFPSQMSLDEGGRLEEERRLAYVGVTRAMRKLTLTYAESRRLYGKEVYHRPSRFVGEL
FT                   PETCVEEVRLRASVTRPVSHARMGTPLSQSDSGYRLGQRVAHAKFGEGTIINLEGSGEH
FT                   TRLQIAFKGEGIKWLVAAYARLEVL"
FT   gene            106969..107877
FT                   /gene="corA"
FT                   /locus_tag="ETAF_0099"
FT   CDS_pept        106969..107877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="ETAF_0099"
FT                   /product="Magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40222"
FT                   /db_xref="GOA:A0A0H3DLS1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40222.1"
FT                   /translation="MELDDTDHLTASLWVDLVEPEEDERRRVQSELGQSLATRPELDDI
FT                   EASARFFEDEDGLHIHSFFYYEDAEDHAGNSTVAFTIREGRLFTLRERELPAFRLYRMR
FT                   ARNQMLVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIMEGQQGDEYDDALST
FT                   LAELEDIGWKVRLCLMDTQRALNFLVRKARLPASQLEQAREVLRDIESLLPHNESLFQK
FT                   VNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGA
FT                   ILLMILAGLAPYLYFKRKKWL"
FT   gene            107988..109043
FT                   /locus_tag="ETAF_0100"
FT   CDS_pept        107988..109043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0100"
FT                   /product="Putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40223"
FT                   /db_xref="GOA:A0A0H3DM29"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM29"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40223.1"
FT                   /translation="MERLAHAEQWSILAVLSLGLGGLFLWLRLPAALLLGPMLAAVALG
FT                   LRGATIRVHRLAMPIAQAILGCMIARALSLSLLSPLLDDWPVVLLVLLCTQLCSAITGW
FT                   LLVRLSDLPGPTGAWGSSPGGASAMVAMAGEFGADVRLVAFMQYLRVLFVAAAAALVVR
FT                   VGLGDAPQGVPLAPPWFPALGWAFVATLLLAGGGAWLGRRLRIPAGALLLPMLIGALCN
FT                   TTGVMTPQTPEWLLAIAYALIGWQVGLLFTRTLFVLALRALPQIILSIAALMLCCALMA
FT                   WGLTQVLPIDPLSAYLATSPGGLDTIAIIAAGSQVNLAFVMALQMLRLFTILLMGPAVA
FT                   RWISRHAASAP"
FT   gene            complement(109032..109922)
FT                   /gene="rarD"
FT                   /locus_tag="ETAF_0101"
FT   CDS_pept        complement(109032..109922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="ETAF_0101"
FT                   /product="RarD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40224"
FT                   /db_xref="GOA:A0A0H3DNV2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNV2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40224.1"
FT                   /translation="MDTQHTRQGVILALTAYLIWGIAPIYFKLLQQVPATEILTHRVIW
FT                   SFFFMLILLAIGRSWRQLYALRHTPYKIALLALSACLIGGNWLLYIWAVNHNHMLEASL
FT                   GYFINPLVNVLLGMLFLGERFRRMQWLAVALAIVGVMVQLWQFGSVPVIALGLAFSFAF
FT                   YGLLRKKIAIDAQSGMLMETLWLLPLALYYLFVAADSPTSHLSANPLSLNLLLIAAGVV
FT                   TTVPLLCFTAAATRLRLSTLGFFQYLGPTLMFLLATLCYGEQMTRDKLIAFGFIWSALL
FT                   LFIIDALYTQRRLRR"
FT   gene            110130..111017
FT                   /locus_tag="ETAF_0102"
FT   CDS_pept        110130..111017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0102"
FT                   /product="Phospholipase A1 precursor; Outer membrane
FT                   phospholipase A"
FT                   /EC_number="3.1.1.32"
FT                   /EC_number="3.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40225"
FT                   /db_xref="GOA:A0A0H3DNY1"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNY1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40225.1"
FT                   /translation="MNACKKYLMAGVAALPLVAQAAPSASESGAAPALSDNEGVIANML
FT                   RHYDNPFTLYPYSTNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIA
FT                   GDNSVLGAAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGG
FT                   VHQSNGRSDPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPNKDDNPDITKYMGYYE
FT                   AEMGYRLGESVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFR
FT                   QTRFGVGVMLNDIL"
FT   gene            111086..112915
FT                   /gene="recQ"
FT                   /locus_tag="ETAF_0103"
FT   CDS_pept        111086..112915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="ETAF_0103"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40226"
FT                   /db_xref="GOA:A0A0H3DQC3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQC3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40226.1"
FT                   /translation="MATAAVINTERLAEGVLKDTFGYQQFRPGQQAIVEAAIAGRDCLV
FT                   VMPTGGGKSLCYQIPALVRDGLTIVVSPLISLMKDQVDQLQANGVNAACLNSTLNREQQ
FT                   QAVYAGCRSGEIRLLYIAPERLMMDNLLDTLPQWNPTLLAVDEAHCISQWGHDFRPEYS
FT                   ALGQIKRRFPQMPVIALTATADDATRQDILGLLDLRDPLVQVSSFDRPNIRYTLIEKFK
FT                   PLDQLWHFVQSQRGKSGIIYCNSRAKVEDTAARLQSRGLSVGAYHAGLDNGRRAEVQEA
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEALLFY
FT                   DPADMAWLRRCLEEKPEGAQKEIERHKLNAMNAFAEAQTCRRLVLLNYFGEGRQESCDN
FT                   CDICLDPPKRYDGLLDAQKALSTVARVGQRFGIGYVVEVLRGANSARIREWGHDKLSVY
FT                   GIGREHSTEHWVSILRQLIHLGLVTQNIALHSALQLTEAARPVLRGEVALPLAVPRVIN
FT                   LKARSSAQKSYGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLLEMAEQMPLRAG
FT                   DLLSINGVGQRKLERFGAPFMTLIREHLDEGQD"
FT   gene            complement(112922..113821)
FT                   /locus_tag="ETAF_0104"
FT   CDS_pept        complement(112922..113821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40227"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40227.1"
FT                   /translation="MRIIRLTLLLLGTLYIHGALAAQALVLQTDFSLRDGAVSAMKGVA
FT                   FGVDSQIHLFDLTHEIPPYDIWQAAYRLHQTARYWPAGTVFVSVVDPGVGSERRSVVLK
FT                   TKNGQFFVSPDNGTLTLVAQTLGIDSVREIDEQTNRLQGSEKSYTFHGRDVYAYTGARL
FT                   ASGTIRFEQVGPRLPNQITEIPYQQAQWQPGKVSGTIAILDVQYGNLWSNIGDEMLEKA
FT                   GIALNDRLCITIAQQGQTRYQGHAPYVHSFADVPPGQPLVYLNSLLNVAVALNMDSFAE
FT                   KQRIAAGAEWQITLQKCR"
FT   gene            113977..114585
FT                   /locus_tag="ETAF_0105"
FT   CDS_pept        113977..114585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0105"
FT                   /product="L-lysine permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40228"
FT                   /db_xref="GOA:A0A0H3DM33"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM33"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40228.1"
FT                   /translation="MMLFLTVAVVHLLALMTPGPDFFFVSQTALSRSRAEALRGVAGIS
FT                   LGIVIWAGVALMGLHLLLMKMAWLHSIITVGGGLYLCWMGLQMLRAARRPQGDAPQGVT
FT                   SLHGGAFWRGFLTNLSNPKAVIYFGSVFSLFVGDEVTGAQRIGLFILIVSETFIWFSLV
FT                   ASVFALPVMRRGYQRMARWIDGVAGTLFAAFGLHLILSR"
FT   gene            complement(114659..115975)
FT                   /gene="gntU"
FT                   /locus_tag="ETAF_0106"
FT   CDS_pept        complement(114659..115975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntU"
FT                   /locus_tag="ETAF_0106"
FT                   /product="Low-affinity gluconate/H+ symporter GntU"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40229"
FT                   /db_xref="GOA:A0A0H3DNV8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNV8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40229.1"
FT                   /translation="MTAVGSVLLLLFLVMKARMHAFVALMLVSIGAGIFSGMPIDKIAQ
FT                   TMQNGMGGTLGFLSIVVALGAMFGKILHETGALDQIAARLLKSFGEKRAHYALGIAGLV
FT                   CALPLFFDVAIVLLIGVVFAVARRTGGNVVKLAIPLFAGVAGAAAFLLPGPTPMLLASQ
FT                   MGADYGWMILIGLCAAIPGMILAGPLYGNFISKHVTLALPKDIQEPSLGKGQLPSFSFS
FT                   LALVLFPLVLVGLKTIGARFVEQGSELYKWLEFIGHPFTAILLACLVATYGLAIRRGMS
FT                   KEKVMDICSAAIQPAGIILLVTGAGGVFKQVLVDSGVGPALGNSLIGAGLPIAVACFVL
FT                   AAAVRVIQGSATVACLTTVGLVLPVIGELGYSGAQLAALSVCIAGGSIVLSHVNDSGFW
FT                   LYGKFTGATEAQTLKTWSVMETILGTTGAIVGMLFFMAL"
FT   gene            complement(116008..116538)
FT                   /locus_tag="ETAF_0107"
FT   CDS_pept        complement(116008..116538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0107"
FT                   /product="Gluconokinase"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40230"
FT                   /db_xref="GOA:A0A0H3DNY6"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNY6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40230.1"
FT                   /translation="MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPR
FT                   ANISKMADGHALNDDDRTPWLQALNDAVFAMQRTNDVSLIVCSALKKRYRDMLRDGNTN
FT                   LSFIYLQGDFALIESRLLARKGHFFKPQMLVSQFAALEEPTTEERDVYAIDISQPLDSV
FT                   VADTLNTIKSIIA"
FT   gene            complement(116758..117762)
FT                   /locus_tag="ETAF_0108"
FT   CDS_pept        complement(116758..117762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0108"
FT                   /product="Gluconate utilization system Gnt-I
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40231"
FT                   /db_xref="GOA:A0A0H3DQC6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQC6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40231.1"
FT                   /translation="MKMKKKRPVLQDIADRVGVTKMTVSRYLRNPELVSLPLRGKIAAA
FT                   LDELGYIPNRAPDILSNATSRAIGVLLPSLTNQVFAEVLRGIESVTDQHHYQTMLAHYG
FT                   YRKEKEEERLTSLLSYNIDGLILAERDHTPRTLKMIEVAGIPVVELMDSVSPCLDMAVG
FT                   FDNVEAARAMTQAIIARGHRRTVYFGARLDERTVMKQRGYEAAMRAADLTPRSVMIPRS
FT                   SSYSVGGELLREALKRYPDMDSIFCTNDDLAVGAAFECQRLGLRIPQDMAIAGFHGHDI
FT                   GQVMEPQLASVLTPRQRMGQLAAERLLARLRGERSVEAAAIDVGFTLLHGGSI"
FT   gene            117980..120286
FT                   /locus_tag="ETAF_0109"
FT   CDS_pept        117980..120286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0109"
FT                   /product="Lead, cadmium, zinc and mercury transporting
FT                   ATPase; Copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.3"
FT                   /EC_number="3.6.3.4"
FT                   /EC_number="3.6.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40232"
FT                   /db_xref="GOA:A0A0H3DLS8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40232.1"
FT                   /translation="MTHKHIHSGGPDAACGCGHQHAAMQHGCSRPAHGALKISMASPLT
FT                   PAADGACCMAIHDHDGVEEDADPHPLPPLASGRQRFSWRVEGMDCPSCARKIETAVAQI
FT                   SGVERAAVLFATQKLVVDAQQDLSPTIERAVRQAGFSLQAVGAKRAESAALRWHEVMPP
FT                   IALALLMLLSYGLTLMDPSLGRVAFIATTLVGLAPIMLKAMRLMRSGSYFAIETLMSIA
FT                   ALGALFIGATQEAAMVLLLFMLGERLESYAANRARKGVSALMALVPDDAVVIEQERRRT
FT                   LAVSALRPGMEIEVAPGGRLPADAELLQESVSFDESALTGESLPVDRQPGARVPAGALV
FT                   VDRVCRLRVISQPGQNAIDRILQLIEEAEERRAPIERFLDRFSRYYTPAIMALALLVIL
FT                   IPPLAFAQPWDTWIYRGLTLLLIGCPCALVISTPAAITSGLAAASRHGALIKGGAALEQ
FT                   LGRVRTIAFDKTGTLTQGTPQVSGVFGVEGVSAERLLTLAAAVEVGSHHPLAKAVILAC
FT                   EQRGLPVVQAQARQAQAGIGVAGEVDGVAVQVAAPSRLAPETLSEALLTQIAAWEALGQ
FT                   TVVAVLLDGVAIGAIAMSDTLRPDAAEALDALRALGIEAVMLTGDNPRAAAAIAGSLGI
FT                   DFRAGLLPQDKVHQVEALSRRADTAMVGDGINDAPAMKAASIGIAMGGGTDVALETADA
FT                   ALTHNRLIGLAQMIALSRATHANIRQNITLALGLKGVFLITSLLGITGLWLAVLADSGA
FT                   TALVTANALRLLRRR"
FT   gene            120439..121500
FT                   /locus_tag="ETAF_0110"
FT   CDS_pept        120439..121500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40233"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM38"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40233.1"
FT                   /translation="MLSCLSGVLMSGVTHAATQDNTTELSSTLPTYYGLPQSQAHAADS
FT                   VPTAQTSAPEAQKGSILPIWGDEARARGYDLPEPFGINVNYMNMRQNIVVDSISFSGLG
FT                   WDSYSLPTDLFNIKVGSTRQRSVTQTIKLDAWVLPFMNVYGIVGKTRGSSLSKVSVDAD
FT                   PSQYPLGSMDWIIATVVKGMNKSGQLRDLDFQLNFKGTTYGAGTVLAGGYGNWFGLVDM
FT                   NYTQTRFDILDGSIDAFTLSPRVGYRFTTPGIDAVGLPDGKLSLWVGSMYQDVQQEFKG
FT                   SLSDLSMPGGLSALMEIANKQGQGRFDVRQHLSSPWNVLIGAQYEITRNFNLTTEVGFA
FT                   ERNSFFIAGEYRF"
FT   gene            121500..122633
FT                   /locus_tag="ETAF_0111"
FT   CDS_pept        121500..122633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0111"
FT                   /product="Outer membrane protein/protective antigen OMA87"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40234"
FT                   /db_xref="GOA:A0A0H3DNW3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNW3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40234.1"
FT                   /translation="MRRPLMTLALVCALSPLAGQAALLPTRAQIDEWLGHLGGDDRFDP
FT                   DKGIDWGILPGPFFNPELGLGIGAAVAGLYRPDPSDTTSQNSSITLSGYLSSTGAFGLG
FT                   VRSYSFFDNDRWRIFVTGGISDTPTYYWGQGFRAGADDDGRQKYTAQSLRLQPEVLYRV
FT                   ASQTYLGVGWSLSAMHAADVKQTDRLAQIHYGRSVFSSGPSLSLQYDSRDFVPNPRRGM
FT                   LASLRYTHYTPETGSDTRFDNLTTRFSTYHALDETRVLAWEIDGEFTQGAVPWNMLPSL
FT                   GGDQRMRGYYQGRYRDRNLISSQLEYRQKLSWRHGVVAWAGAGTMGPNVRELGSSRWLP
FT                   TVGVGYRFAFKPGINIRLDYGIGRGSSGFYFQVGEAF"
FT   gene            122633..123766
FT                   /locus_tag="ETAF_0112"
FT   CDS_pept        122633..123766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40235"
FT                   /db_xref="InterPro:IPR025130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNZ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40235.1"
FT                   /translation="MAVVRGCCVALLAWCGLAGAFGLPMSLDLAQLQPLQAAHAWPVSA
FT                   PLPPPDGLRPCCAFGYDLNAEALGVPIPFYRLNNVVEADALGGHRYNDSLFGALASLAG
FT                   LGSERNGLVYTRRGGFLDLAHVRDSADMTVYIFSHLYPRLGQPFHLALGDELAQRQLVF
FT                   SAFTPPSAARERYTLAAYLAARLAFEVAAWHEIAQWYGYESIPGFSEGVSAFSPEDLYS
FT                   NLLGTRLALTLILNGHAASLGQYSAALTTLLPQALCQLQAQPAVLTRFQFDMLDGKWWD
FT                   SRQAVPQKFLVLKRNYDTRDDRLPTPVSGELTPPLRLMLPGQVYRYDLATLAELRLLPG
FT                   TSMKRLPAPPHYYTWRDFAHLAAFAGTQDALQLSRKR"
FT   gene            123886..124785
FT                   /locus_tag="ETAF_0113"
FT   CDS_pept        123886..124785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40236"
FT                   /db_xref="GOA:A0A0H3DQD0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQD0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40236.1"
FT                   /translation="MFLLLATTLLWAFSFSLIGVYLAGQVDSWFAVLVRVALATLVFLP
FT                   FLRWRGVRPRQALAYMLVGAFQLGLMYLFYYPAFLYLTVPEVLLFTILTPLYVTLIYDL
FT                   LQGRRLRPGYLGSALLAVLGALIIRYNPLSSQFLLGFALIQGANLCFALGQVGYKRLME
FT                   VMPLPQYRAFSWFYLGALTVALPAWWLYGNPQMLPTTSLQWGILLWLGVGASGLGYFMW
FT                   NYGATQVDAGTLAIMNNALIPAGLLVNLAIWQQHPDWFRLTLGGTVIALSLWVHRRWIV
FT                   PHHGQTAGRRRRGGAPAE"
FT   gene            complement(124664..125626)
FT                   /gene="metR"
FT                   /locus_tag="ETAF_0114"
FT   CDS_pept        complement(124664..125626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="ETAF_0114"
FT                   /product="Transcriptional activator MetR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40237"
FT                   /db_xref="GOA:A0A0H3DLT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40237.1"
FT                   /translation="MIELKHLRTLQALRGGGSLAAAAARLHQTQSALSHQFSELEQRLG
FT                   YRLFVRKSQPLRFTPQGEILLALAEQVLPQVQQALQTCQVPPQQTLRLAIECHSCIQWL
FT                   TPALTQFQAQFPQVTLDFRSGVTFDPQPALQQGELDLVLTSDILPRDTLYYAPLFDYEV
FT                   RLVMAPGHPLARRGAVRPQDLAQETLLIYPVARQRLDVWNHFLQPAGIAPRLKQVDNTL
FT                   LLLQMAAAGMGIAALPHWVAESAERQGALTTRPLGEGLWRRLYAALRTGEQRQSVMDGF
FT                   IQLARRHACDALPFVRDVVRSNAGAPKATGRSLSHPASA"
FT   gene            125750..128026
FT                   /locus_tag="ETAF_0115"
FT   CDS_pept        125750..128026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0115"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40238"
FT                   /db_xref="GOA:A0A0H3DM42"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM42"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40238.1"
FT                   /translation="MQVISHTLGFPRIGLQRELKKALEAYWSGSAPQSALLACGAELRA
FT                   RHWRQQHQAGIDLLPVGDFAWYDHVLATSLMLGNVPARHRRADGVIDLDTLFGIARGRA
FT                   PGGKPAAAAEMTKWFNTNYHYIVPEFTRGQRFSFGWRQLLEEVDEALALGYRVKPVLLG
FT                   PLTYLWLGKVKGAPFDRLSLLEEVLAVYRQVLAALAERGVEWVQVDEPALVLTLPPAWR
FT                   DAYQHAYQALRGPVKLLLTTYFGDIGHHLPTICALPVQGLHVDLVQGAGDALALHRQLP
FT                   ADWVLSLGAIGGRNVWRADLADWQTRLQPLVGQRPVWLGSSCSLLHTPIDLSAETQLDE
FT                   EVKSWFAFALQKCSELALLTQALNDPASRREALLSYSAPLYLRRRSERVHNPAVTERLA
FT                   ALSDADTQRTSAYPQRARRQRQRFALPLWPTTTIGSFPQTPAIRTLRLDFRRGQLTPQH
FT                   YHRGIAEHIRQAIREQERLGLDVLVHGEAERNDMVEYFGEQLAGFVFTCNGWVQSYGSR
FT                   CVKPPVIVGDISRPAPLTVEWTTFAQAQTSRPVKGMLTGPITMLCWSFAREDVPREVIA
FT                   RQLALALRDEVDDLQRAGIGIIQIDEPALREGLPLRQDEWQAYLAWAVAAFRLTAAVAY
FT                   DDTQIHTHMCYCEFNDIMAAIAALDADVITIETARSDMELLEAFSRFDYPNEVGPGVYD
FT                   IHSPNVPTQAAMVSLLRRAAQHIPAERLWVNPDCGLKTRGWEETRRALSNMVAAARLLR
FT                   AQTQA"
FT   gene            complement(128073..128840)
FT                   /locus_tag="ETAF_0116"
FT   CDS_pept        complement(128073..128840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0116"
FT                   /product="Uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40239"
FT                   /db_xref="GOA:A0A0H3DNW8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNW8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40239.1"
FT                   /translation="MSKPEVFHLGLAKSDLHGATLAIVPGDPERVEKIAKLMENPVKLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRVGTTGAIQPHINV
FT                   GDVLVTTASVRLDGASLHFAPMEFPAVADFTCTTALVDAARAVGAATHVGITASSDTFY
FT                   PGQERYDTFSGRVTRRFRGSMKEWQEMGVMNFEMESATLLTMCSSQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKQTESHAVKIVVDAARRLLQD"
FT   gene            129208..131016
FT                   /locus_tag="ETAF_0117"
FT   CDS_pept        129208..131016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0117"
FT                   /product="Carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40240"
FT                   /db_xref="GOA:A0A0H3DNZ6"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNZ6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40240.1"
FT                   /translation="MQHAITFVLATLCILAICYRLYGLFFVRKVLRADDSEVTPSHTYE
FT                   DGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQFGYLPGFLWLLIGCVIGGAVHDTV
FT                   VLFASMKHQGKSLSEVAKSELGPIAGWCTGLAMLFIITITMAGLSMVVVHALERNPWGT
FT                   FAVFMTIPIAICVGLWERITGSMKGATYAGIAAIILCVFAGPYIQHTTFGEWLTWKSST
FT                   VSLLLPAYAFFATALPVWMLLTPRGYLSSFMKIGVFGALVVGVVFINPEIQFPAITQFI
FT                   HGGGPVLSGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAECV
FT                   VGVMALIAATSLHPADYFAINSSAQAWAGLGMEVVHLPQLSQEIGLDLYGRTGGAVTLA
FT                   VGMTDIFIRVPWFSSLASYFFQFVIMFEAVFILTAVDSGTRVARYLLQDFLGDLWAPLK
FT                   RTDWLPGSIFCSVVACLLWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRLAT
FT                   KRIYMLTCIIPLVYLFITVNYAGYWMVKHVYFNPQAAGYNLFNGTISIIMLVLGMVILL
FT                   SALRKWRELWIKRGDELAAAQAEATA"
FT   gene            131135..131662
FT                   /locus_tag="ETAF_0118"
FT   CDS_pept        131135..131662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0118"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40241"
FT                   /db_xref="GOA:A0A0H3DQD3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQD3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40241.1"
FT                   /translation="MLDSIIQGTIEFVRLHQGWAVPLVFFLAFGESLAFISLLLPATVI
FT                   LFALSALLGEGGVPFVPVWLAAAGGAFLGDWLSYWLGYHYQHQIGHMWPLSRSPQILQR
FT                   GHRYFARWGFWGVFFGRFLGPLRAAVPLVAGICAMRQRYFQLANLLSALIWGAGILAPG
FT                   MLGIRWLGQWIG"
FT   gene            131765..133174
FT                   /gene="rmuC"
FT                   /locus_tag="ETAF_0119"
FT   CDS_pept        131765..133174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmuC"
FT                   /locus_tag="ETAF_0119"
FT                   /product="DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40242"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40242.1"
FT                   /translation="MENVTLWILAASLAGMAIGWLAAALRAQQARVAHEQALGALDSQL
FT                   AAAQERIAQQRLWHEECERLNQELRAQRDVNSAQEAELREVTIRLEETRMGAEEKQRLL
FT                   LNAEQRLNVQFENLANRIFEHSGRRVEEQNRQSLDALLTPLREQLDGFRRQINDSFGQE
FT                   ARERHTLTHEIRSLQQMNAQMAREALNLTRALKGDNKMQGNWGEVVLSRVLESSGLREG
FT                   HEYRTQVSVQTEESGRMQPDVVVHLPQGKDVVVDAKMSLVAYERFFNAEDERERELALQ
FT                   QHILSLRAHIRQLGRKDYQRLPGLRTLDYVLMFIPLEPAFLAAIERDPELISEALRHNI
FT                   MLVSPTTLLVALRTINNLWRYEYQSQNAQKIADRAAKLYDKVRLFVDDMSTLGQSLERA
FT                   QSSYRQAMNKLSHGRGNLIGQVESFRGLGVEVKRPISPALVQEACQLPQDGDPAAVSGE
FT                   VVAHHGTPSVQ"
FT   gene            133297..134052
FT                   /gene="ubiE"
FT                   /locus_tag="ETAF_0120"
FT   CDS_pept        133297..134052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="ETAF_0120"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40243"
FT                   /db_xref="GOA:A0A0H3DM48"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM48"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40243.1"
FT                   /translation="MVDQTPETTHFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSF
FT                   GIHRLWKRFTIDCSGVRQGQRVLDLAGGTGDLAAKFSRMVGEQGEVVLADINDSMLKIG
FT                   REKLRNMGIAGNLNYVQANAEALPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPG
FT                   GRLLVLEFSKPQFAALSKAYDAYSFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLK
FT                   GMMASAGFENTTYDNLTGGIVALHRGYKF"
FT   gene            134068..134673
FT                   /gene="yigP"
FT                   /locus_tag="ETAF_0121"
FT   CDS_pept        134068..134673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yigP"
FT                   /locus_tag="ETAF_0121"
FT                   /product="YigP"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40244"
FT                   /db_xref="GOA:A0A0H3DNX3"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNX3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40244.1"
FT                   /translation="MLTPLCTALLETALNAALYRDRALQSARQRLAGRVLQISLAELED
FT                   PFFLIFSQRQVDVLAQWEGAVDCQVTTRLSVLPQLRARRQLAALMQCGDLRVDGDIQVV
FT                   QQLVALLDLAEWAPAELLAPYTGDIVAQGLCSVAQRSGHALLGSLRRQRHYARDALIEE
FT                   WRLAPGTLEFTWFQEEAAALQRQASALEQRLARLEKCV"
FT   gene            134670..136301
FT                   /gene="ubiB"
FT                   /locus_tag="ETAF_0122"
FT   CDS_pept        134670..136301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="ETAF_0122"
FT                   /product="Ubiquinone biosynthesis monooxygenase UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40245"
FT                   /db_xref="GOA:A0A0H3DP01"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP01"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40245.1"
FT                   /translation="MTPSELRRLCLIIRVFLAYGLDELIPPMRITLPLRIGRRCLFWMR
FT                   NRHGDKPLGERLRLALQTLGPVWIKFGQMLSTRRDLFAPAIADQLALLQDRVAPFDGAL
FT                   ARRQIEAALGGPLEQWFDDFDSQALASASIAQVHTATLRENGREVVLKVIRPDIQPIIR
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDAS
FT                   PMLYVPEVFSDYCRESVLVMERIYGVPVSDIAALRAQNTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPQDPQYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPPDTNVEEFEFAIRTVCEPIFEKPLDQISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLENWLHDQVGLPALMRALKAKAPYWSE
FT                   KLPELPELLYDSLQQQRRLQHSMDSMTHRLGQQGNRQGRARYLFGIGATLLLSGTILTM
FT                   ANIALWPIGLYVAGVVIWLAGWRYTR"
FT   gene            136414..136683
FT                   /gene="tatA"
FT                   /locus_tag="ETAF_0123"
FT   CDS_pept        136414..136683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="ETAF_0123"
FT                   /product="Twin-arginine translocation protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40246"
FT                   /db_xref="GOA:A0A0H3DQD7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQD7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40246.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGD
FT                   EEKTPPSTNANSSAAPQDADFKSIVEQQPEVKKEESKSQNKEQV"
FT   gene            136687..137211
FT                   /gene="tatB"
FT                   /locus_tag="ETAF_0124"
FT   CDS_pept        136687..137211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="ETAF_0124"
FT                   /product="Twin-arginine translocation protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40247"
FT                   /db_xref="GOA:A0A0H3DLT8"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40247.1"
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPVAVRTVAGWIRALRSLATS
FT                   VQNELSQELKLQELQDSLKKAESAGLQNLTPELKASMDELKQAAESMKRSYHSEITGSD
FT                   TEKEPSAAETIPHADMPKPEADAALAPRQSAVQEAPAAQAAPATHADAVTASAQPASSP
FT                   STSHDSSQHGR"
FT   gene            137201..137989
FT                   /gene="tatC"
FT                   /locus_tag="ETAF_0125"
FT   CDS_pept        137201..137989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="ETAF_0125"
FT                   /product="Twin-arginine translocation protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40248"
FT                   /db_xref="GOA:A0A0H3DM55"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM55"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40248.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNAIICILVVFLALVYFANDIYHLV
FT                   SAPLINQLPHGASMIATDVASPFFTPIKLTMIVSVFVSAPFILYQVWAFVAPALYKHER
FT                   RMLTPLLVSSTLLFYIGMAFAYFVVFPLAFGFFAKTAPAGVTIATDINNYLDFVMALFM
FT                   AFGVSFEVPVAIILLCWTGVTTPAELKKKRPYVVVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   CLLFEVGVFFARFYVGKRRRDPEEEDEDEASHDEEQPKAS"
FT   gene            138163..138945
FT                   /gene="tatD"
FT                   /locus_tag="ETAF_0126"
FT   CDS_pept        138163..138945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="ETAF_0126"
FT                   /product="Deoxyribonuclease TatD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40249"
FT                   /db_xref="GOA:A0A0H3DNX8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNX8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40249.1"
FT                   /translation="MLDIGVNLTNGQFSGDVPQVVARARQAGLNGMIITGTNLTESAQA
FT                   LHLAQAYPDFCWATAGVHPHDAHRWNENSAADLEPLLRSPAVVAVGECGLDFARNFSTP
FT                   AQQEAAFEAQLALAAQIGKPVFLHCREAHARFIALLRPWLSRLPGAVLHCFTGTRDELD
FT                   ACLSLGLYIGITGWICDERRGMPLRALLPHIPAERLLLETDAPYLLPRDIQPKPKSRRN
FT                   EPCFLPHIAEQAARWRQQDANWLKQVTENNARQLFRLA"
FT   gene            138961..139983
FT                   /locus_tag="ETAF_0127"
FT   CDS_pept        138961..139983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0127"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40250"
FT                   /db_xref="GOA:A0A0H3DP07"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP07"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40250.1"
FT                   /translation="MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVME
FT                   GNNHQEAVSSMPGVQRMTIDVLVREAEAVAKLGVPVLSLFPVVGTDKKSLYAEEAYSSD
FT                   GLVQRAVRALKDAVPELGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSH
FT                   AEAGADIVAPSDMMDGRIGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGN
FT                   LKGGNKKTYQMDPANGDEALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMTR
FT                   "
FT   gene            complement(140055..140546)
FT                   /gene="rfaH"
FT                   /locus_tag="ETAF_0128"
FT   CDS_pept        complement(140055..140546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="ETAF_0128"
FT                   /product="Transcriptional activator RfaH"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40251"
FT                   /db_xref="GOA:A0A0H3DQE2"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQE2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40251.1"
FT                   /translation="MESWYLLYCKRGQLTRAREHLTRQEIPCVTPMITLEKVVRGKRTQ
FT                   VQEPMFPNYMFIELDPERIHTTTVQSTRGVSHFVRFGKLPATVPFSIVKQLMMAPTPTA
FT                   IAPQTPIPGDRVRITQGAFSGMEAIYRESDGEKRAILLLNLLNQEVSHTLSNSAFEKIL
FT                   "
FT   gene            140797..141522
FT                   /locus_tag="ETAF_0129"
FT   CDS_pept        140797..141522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0129"
FT                   /product="Alpha-aspartyl dipeptidase Peptidase E"
FT                   /EC_number="3.4.13.21"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40252"
FT                   /db_xref="GOA:A0A0H3DLU0"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40252.1"
FT                   /translation="MELFLLSNGKVSGESELLGYAKGMIQSMLLEKKIRRALLIPYALI
FT                   RSSYDARAAELEHSLGITVESIHHHADPVKALEEAECILISGGNTWVLNQMLHEHGLIV
FT                   PIQRAVRERGIPYIGWSAGCNVATPSIRTTNDMPVRNSVVLPSLGLFPVQINPHYIDAH
FT                   LSGHMGETRDERIAEFCAVNPSESVIALREGSLLHVSGETLQYYSAKAQGYKVFRHGEE
FT                   THEYHDTQALAALVPFHCR"
FT   gene            141593..143128
FT                   /locus_tag="ETAF_0130"
FT   CDS_pept        141593..143128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0130"
FT                   /product="3-polyprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40253"
FT                   /db_xref="GOA:A0A0H3DM60"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM60"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40253.1"
FT                   /translation="MKNAYNGLFTRIDKNAMKYRDLREFIALLEQRGELKRIQQSIDPY
FT                   LEMTEIADRTLRAGGPALLFENPKGYDIPVLCNLFGTPQRVALGMGQEEVGALRDVGKL
FT                   LAFLKEPDPPKGFRDLVEKLPQFKQILNMPTKRLSKAPCQARVFQGDDVDLATLPVMHC
FT                   WPQDVAPLVSWGLTVTRGPCKSRQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQEWCQA
FT                   HPGERFPVAVALGADPATLLAAVTPVPDSLSEYAFAGLLRGHKSEVVKCLSCDLEVPAS
FT                   AEIVLEGYIEPGETAPEGPYGDHTGYYNEVERFPVFTVTHLTQRDRPIYHSTYTGRPPD
FT                   EPAVLGLALNEVFVPLLQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVW
FT                   SFLRQFMYTKFVIVCDDDINARDWQDVIWALTTRMDPARDTLLIENTPIDYLDFASPVS
FT                   GLGSKMGLDATNKWPGETQREWGHPIVMDEAVRVRVDTLWNELDIFANDKDAQ"
FT   gene            143218..143868
FT                   /locus_tag="ETAF_0131"
FT   CDS_pept        143218..143868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0131"
FT                   /product="FMN reductase"
FT                   /EC_number="1.16.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40254"
FT                   /db_xref="GOA:A0A0H3DNY3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNY3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40254.1"
FT                   /translation="MYRVRLVPGRAVDFRAGQYLMVVMDERDKRPFSMASTPLQSDCIE
FT                   LHIGASELNLYAMAVMDRILQDRTLCVDMPHGDAWLREDSLRPLVLIAGGTGFSYTRSI
FT                   LLMALSQQPQREISLYWGGRELKHLYDLNELYALSARYPQLKVIPTVEQPDADWQGRSG
FT                   TVISAVMQDFGSLAQHDIYIAGRFEMAKIARERFCAEREANPDHIYGDAFAFI"
FT   gene            144011..145342
FT                   /gene="pepQ"
FT                   /locus_tag="ETAF_0132"
FT   CDS_pept        144011..145342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="ETAF_0132"
FT                   /product="Xaa-Pro dipeptidase PepQ"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40255"
FT                   /db_xref="GOA:A0A0H3DP12"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP12"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40255.1"
FT                   /translation="MDTLASLYTKHLATLQQRARTILERHQLDALLIHSGEPIARFLDD
FT                   QDYPFKINPHFKAWVPVTQVPNCWLWIDGVNKPKLWFYAPQDYWHSVSPLPQAFWTEQV
FT                   EMTALRHADDIAALLPAARGNVAYIGPNADRARSLGIDEAHQNPQAVLNFLHYHRAYKS
FT                   EYEQACMREAQKIAVDGHQAALEAFRAGMSEFDINLAYLSATGQGENDVPYDNIIALNR
FT                   HAAVLHYTHLERRAPSEMHSFLIDAGAEFHGYAADLTRTYAANGQSDFAALVAEVNQAQ
FT                   QALIATLQTGVRYTDYNLQFHQRLAAILRHHHILTGISDEAAVAQGLTTPFLPHGLGHP
FT                   LGLQVHDVAGFMQDELGTQMAAPDRYPYLRCTRIMEPGMVMTIEPGLYFIDTLLAPWLE
FT                   GEFGQHFNRSRIDALRPYGGIRIEDNVIFHAHGVENMTRDLHLA"
FT   gene            145360..145956
FT                   /locus_tag="ETAF_0133"
FT   CDS_pept        145360..145956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0133"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40256"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQE6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40256.1"
FT                   /translation="MPAQPVSVCEEIKKSRFITLLAHTPGVDAAKAFVQETRRAHPDAR
FT                   HHCWAFVAGAPGDTQRLGFSDDGEPSGTAGKPMLAQLMGSGVGEVCAVVVRYYGGIKLG
FT                   TGGLVRAYGSGVQQALQALVRRQKVPMAAYTLCCDYAQLTLVEGIVAQAGGSVLDSAFS
FT                   AQVMLRLSLPLGSQDEVDEKLRNASRGALQLQATS"
FT   gene            146009..147460
FT                   /gene="trkH1"
FT                   /locus_tag="ETAF_0134"
FT   CDS_pept        146009..147460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH1"
FT                   /locus_tag="ETAF_0134"
FT                   /product="Trk-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40257"
FT                   /db_xref="GOA:A0A0H3DLU4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40257.1"
FT                   /translation="MHFRAIIRIVGLLVILFSGTMFVPGLVALIYRDGAGRAFVETFFV
FT                   ALGIGMLLWWPQRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSVTDAFFE
FT                   SFSGLTTTGATTLVGLDALPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGLQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVMLTIACAIALWGAGMDVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIAVFLLISGCNFSLHFAFLSGRSPRVYWRDPEFRMFIAVQ
FT                   LTLVSVCTLVLWLHNVYASGWQTLNQAFFQVVSMATTAGFTTDSIAKWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFIISMLAIIATGVDDFSAFAAVVATLNNLGPGLGVVADNFTSMNDVAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRN"
FT   gene            147478..148026
FT                   /gene="hemG"
FT                   /locus_tag="ETAF_0135"
FT   CDS_pept        147478..148026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="ETAF_0135"
FT                   /product="Protoporphyrinogen IX oxidase HemG"
FT                   /EC_number="1.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40258"
FT                   /db_xref="GOA:A0A0H3DM66"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM66"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40258.1"
FT                   /translation="MKTLVLYSSHDGQTKAIATAIATAMSETLDCELRDLEQAGDIDLN
FT                   AYQAVAIGAAVRYGHFPRALYRFASDHTSQLNTMPSAFFAINLTARKPEKRTPQTNGYT
FT                   RKFLLSTPWKPAQCVVFAGALRYPRYGWLDRTMIKMIMKMTGGETDTTKEVEYTDWQQV
FT                   DRFARDFARFVSTLAKETA"
FT   gene            148501..149929
FT                   /gene="rrsA"
FT                   /locus_tag="ETAF_3219"
FT   rRNA            148501..149929
FT                   /gene="rrsA"
FT                   /locus_tag="ETAF_3219"
FT                   /product="Small Subunit Ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            150028..150103
FT                   /gene="trnE"
FT                   /locus_tag="ETAF_3220"
FT   tRNA            150028..150103
FT                   /gene="trnE"
FT                   /locus_tag="ETAF_3220"
FT                   /product="tRNA-Glu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            150272..153200
FT                   /gene="rrlA"
FT                   /locus_tag="ETAF_3221"
FT   rRNA            150272..153200
FT                   /gene="rrlA"
FT                   /locus_tag="ETAF_3221"
FT                   /product="Large Subunit Ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            153289..153408
FT                   /gene="rrfA"
FT                   /locus_tag="ETAF_3222"
FT   rRNA            153289..153408
FT                   /gene="rrfA"
FT                   /locus_tag="ETAF_3222"
FT                   /product="5S ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(153664..154485)
FT                   /locus_tag="ETAF_0136"
FT   CDS_pept        complement(153664..154485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40259"
FT                   /db_xref="GOA:A0A0H3DNY9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNY9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40259.1"
FT                   /translation="MRILCHLFGIHRSVYYALVKRPVNVQRIELRSRVRAFHALSRGAA
FT                   GSRAISQMLRQSGVNAVRWLARQLMRECGLTSRQPVKHRYRVNEDNSPPLPNLLNRQFN
FT                   PTAPNRVWCGDISFIRLRDRRCHLALVVDLYSRRIIGSALSLTADADLACRALRNALET
FT                   RSRDGRLLFHSDQGVQYKSNKYRRLLWRYGVMQSMSRRGNCLDNSPMERVFRSFKSEWL
FT                   PKGGYGDFSHAVRDINQWINGYYNVYRPHTNNGGLSPCLHEEKWKQVITVS"
FT   gene            complement(154512..154700)
FT                   /locus_tag="ETAF_0137"
FT   CDS_pept        complement(154512..154700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40260"
FT                   /db_xref="GOA:A0A0H3DP17"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP17"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40260.1"
FT                   /translation="MRKWIRLYKQELQGIEPTGNAITPEQREIQQLKAQIKRLEMEKEI
FT                   LKQAAVLMSEIPGKLSR"
FT   gene            155087..156124
FT                   /locus_tag="ETAF_0138"
FT   CDS_pept        155087..156124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0138"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40261"
FT                   /db_xref="GOA:A0A0H3DQF0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQF0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40261.1"
FT                   /translation="MSKHLTSLTEFTTFGLPARAEQILTADSSAALLSHWQAATARRQP
FT                   VLILGGGSNVLFMEDFAGSVILNRIPGIQVDEDEESWHLHVGAGENWHDLVRYTLDHGM
FT                   AGLENLALIPGCVGSAPIQNIGAYGVELQHVCDYVDAMDLRNGTLQRLPAAACGFGYRE
FT                   SIFKHRYRDGYAIVAVGLRLSKRWQPMLSYGDLTRLDAMTATPRAVFDAVCHMRRTKLP
FT                   DPAQQGNAGSFFKNPVVSAEAAEAIRARYPQAPCYPQENGEVKLAAGWLIDRCELKGYQ
FT                   IGGAAVHRQQALVLINQHQASAQDVIALARYVRRRVGEAFSVWLEPEVRFIAAQGEVNA
FT                   VEVLS"
FT   gene            156121..157080
FT                   /locus_tag="ETAF_0139"
FT   CDS_pept        156121..157080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0139"
FT                   /product="Biotin-protein ligase / Biotin operon repressor"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40262"
FT                   /db_xref="GOA:A0A0H3DLU6"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40262.1"
FT                   /translation="MKDITVPLKLISQLADGDFHSGEHLGESLGMSRAGINKHIQTLRD
FT                   WGIDVFTVPGKGYCLPTPMQLLNADTIGTLLPQGRVTVLPVVDSTNQYLLERIGELASG
FT                   DACVAEYQQAGRGRRGRHWFSPFGANLYLSMYWKLEQGPAAAMGLSLVIGIVMAEVLQA
FT                   LGAAGVKVKWPNDLYLNDRKLAGILVELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQ
FT                   WINLQEAGVNIDRNQLVACLLSRLRSTLADFEVRGLSPFIARWRALDNFIDRPVRLIIG
FT                   EQVIHGIARGIDAQGALLLERDGVITPFIGGEISLRAG"
FT   gene            complement(157156..158103)
FT                   /locus_tag="ETAF_0140"
FT   CDS_pept        complement(157156..158103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0140"
FT                   /product="Pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40263"
FT                   /db_xref="GOA:A0A0H3DM72"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM72"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40263.1"
FT                   /translation="MKKEQSLATPYLQFDRHQWAALRNSVPLTLTEEEIARLKGINEDL
FT                   SLDEVAQIYLPLSRLLNFYFSSSVSRQAVLEKFLGTHSPRIPYIIGIAGSVAVGKSTTA
FT                   RVLQALLSQWPEHRRVELITTDGFLHPNKVLQERGLMKKKGFPQSYDMHRLVKFVSDIK
FT                   SGVPRVTAPQYSHLIYDVIPDSRKVIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDFV
FT                   DFSIYVDADEHQLQAWYINRFLKFREGAFSNPDSYFHHYSQLPESEAIAIATGLWNEIN
FT                   GLNLRQNILPTRERASLIMTKGSNHAIESVRLRK"
FT   gene            158534..158609
FT                   /gene="trnT"
FT                   /locus_tag="ETAF_3223"
FT   tRNA            158534..158609
FT                   /gene="trnT"
FT                   /locus_tag="ETAF_3223"
FT                   /product="tRNA-Thr"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            158631..158715
FT                   /gene="trnY"
FT                   /locus_tag="ETAF_3224"
FT   tRNA            158631..158715
FT                   /gene="trnY"
FT                   /locus_tag="ETAF_3224"
FT                   /product="tRNA-Tyr"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            158840..158914
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3225"
FT   tRNA            158840..158914
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3225"
FT                   /product="tRNA-Gly"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            158922..158997
FT                   /gene="trnT"
FT                   /locus_tag="ETAF_3226"
FT   tRNA            158922..158997
FT                   /gene="trnT"
FT                   /locus_tag="ETAF_3226"
FT                   /product="tRNA-Thr"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            159125..160309
FT                   /locus_tag="ETAF_0141"
FT   CDS_pept        159125..160309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0141"
FT                   /product="Translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40264"
FT                   /db_xref="GOA:A0A0H3DWS6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DWS6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40264.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGEAEWEAKIIELAETLDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGDEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSITPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   gene            160652..160987
FT                   /gene="secE"
FT                   /locus_tag="ETAF_0142"
FT   CDS_pept        160652..160987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="ETAF_0142"
FT                   /product="Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40265"
FT                   /db_xref="GOA:A0A0H3DP22"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP22"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40265.1"
FT                   /translation="MKWLVVAVLLIVAIVGNYIYRDVSLPLRALAVVVIIAAAGGIALM
FT                   TAQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVS
FT                   FITGLRF"
FT   gene            160989..161534
FT                   /gene="nusG"
FT                   /locus_tag="ETAF_0143"
FT   CDS_pept        160989..161534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="ETAF_0143"
FT                   /product="Transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40266"
FT                   /db_xref="GOA:A0A0H3DQF4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQF4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40266.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNEGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKA"
FT   gene            161695..162123
FT                   /locus_tag="ETAF_0144"
FT   CDS_pept        161695..162123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0144"
FT                   /product="LSU ribosomal protein L11p (L12e)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40267"
FT                   /db_xref="GOA:A0A0H3DLU8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40267.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKDKVGKVTRA
FT                   QVREIAETKAADMTGSDVEAMARSIEGTARSMGLVVED"
FT   gene            162127..162831
FT                   /locus_tag="ETAF_0145"
FT   CDS_pept        162127..162831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0145"
FT                   /product="LSU ribosomal protein L1p (L10Ae)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40268"
FT                   /db_xref="GOA:A0A0H3DM79"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM79"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40268.1"
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAVALLQELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRTVRVAVFTQGPNAEAAKAAGADLVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHSTIGKASFSAEQLKENLEALMVALKKAKPATAKGVYIKKVCLSTTMGAGV
FT                   TIDQATLSAVAN"
FT   gene            163148..163645
FT                   /locus_tag="ETAF_0146"
FT   CDS_pept        163148..163645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0146"
FT                   /product="LSU ribosomal protein L10p (P0)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40269"
FT                   /db_xref="GOA:A0A0H3DNZ9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNZ9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40269.1"
FT                   /translation="MALNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   gene            163712..164080
FT                   /locus_tag="ETAF_0147"
FT   CDS_pept        163712..164080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0147"
FT                   /product="LSU ribosomal protein L7/L12 (L23e)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40270"
FT                   /db_xref="GOA:A0A0H3DP29"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP29"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40270.1"
FT                   /translation="MSITKEQILDAVAEMSVMDVVELISMMEEKFGVSAAAAVAVAAGG
FT                   AAEAVEEKTEFDVVLTAAGGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDD
FT                   AEALKKTLEEAGASVEVK"
FT   gene            164412..168440
FT                   /locus_tag="ETAF_0148"
FT   CDS_pept        164412..168440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0148"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40271"
FT                   /db_xref="GOA:A0A0H3DQF8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQF8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40271.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALDFTTEQILD
FT                   LFFDKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VKLIEVPVEYIVGKVAAKDYIDESTGELICAANMELSLDLLAKLSQSGYKRIETLFTND
FT                   LDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLMRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDMLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGIVTDEIHYLSAIEEGNFVIAQANSNLDEEGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGMVQYVDASRIVIKVNEDEMFPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTSIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHDVLVAGGVEAEKL
FT                   EKLPRDRWLELGLADEAKQNQLEQLAEQYDELKAEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQKAYDLGDHTRQQVDLNTFTD
FT                   EEVLRLAENLKKGLPVATPVFDGAKEREIKGLLELGGIPTSGQITLYDGRTGERFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGSHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   gene            168520..172740
FT                   /locus_tag="ETAF_0149"
FT   CDS_pept        168520..172740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0149"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40272"
FT                   /db_xref="GOA:A0A0H3DLV3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40272.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKGMDLEAECEQLREELGETNSETKRKKLTKRIK
FT                   LLEAFILSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITQYSKSADGEMVPNTGLIDTTVGR
FT                   AILWMIVPKGLPYTIVNQPLGKKAISKMLNACYRALGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSTETVINRDGEEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVLKPGTADILVPRNTLLNEKWCDL
FT                   LEEHSVDSVKVRSVVSCETDFGVCAHCYGRDLARGHLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGNLKLTNAKFVVNTDGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGATLAKGDGAEVNGGETVANWDPHTMPVITEVSGFIRFADMIDGQTVTR
FT                   QTDELTGLSSQVVLDSAERTGSGKDLRPALKIVDANGDDVLLPGTDMPAQYFLPGKAIV
FT                   QLEDGIAISAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGVVSFG
FT                   KETKGKRRLVITPLDGSDAYEEMIPKWRQLNVFEGERVERGDVISDGPESPHDILRLRG
FT                   VNAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIANAGSSEFLEGEQVEVSR
FT                   VKIANRLLESDGKIAATYMRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRAADTSSAPQVSAEEASANLAELLNAGLLG
FT                   GNDE"
FT   gene            complement(172852..173496)
FT                   /locus_tag="ETAF_0150"
FT   CDS_pept        complement(172852..173496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0150"
FT                   /product="Thiamin-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40273"
FT                   /db_xref="GOA:A0A0H3DM83"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM83"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40273.1"
FT                   /translation="MRQPLFAPVPTRLGLYPVVDSVEWIERLLRAGVRTLQLRIKDCRE
FT                   DQIGDELAQAIALGHHYQARLFINDYWRQAIRLGAYGVHLGQEDLDRADLAAIRRAGLR
FT                   LGLSTHDDAEMDRALAAGPSYVALGHVFPTDSKQMATAPQGLSDLRRQVARLGTYPSVA
FT                   IGGISIARVPDVLACGVGSIALVSAITRAPDWLAATDTLLQLIEGRHANDA"
FT   gene            complement(173496..175427)
FT                   /gene="thiC"
FT                   /locus_tag="ETAF_0151"
FT   CDS_pept        complement(173496..175427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="ETAF_0151"
FT                   /product="Thiamin biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40274"
FT                   /db_xref="GOA:A0A0H3DP04"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP04"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40274.1"
FT                   /translation="MSTLTHRDAPRRQRRAQAQAFIDNLQAQAYPSSQRIYLQGSRADI
FT                   RVPLREISLSPTLIGGTPEQPQWRDNEAIAVYDTSGAYGDPQAEIDLRRGLPAIRSAWI
FT                   AERNDSEILPGRSSDYTRRRQADRDLETLRFEQRSSARRARPGHRVTQLYYARQGIITP
FT                   EMEFIALRENMGRERIRSAVLRQQHPGIAFGAHLPDNITPAFVRDEVAAGRAIIPANIN
FT                   HPESEPMIIGRNFLVKVNANIGSSSVTSSIEEEVEKLVWATRWGADTVMDLSTGRYIHE
FT                   TREWILRNSPVPIGTVPIYQALEKVNGIAENLDWPLVRDTLLEQAEQGVDYFTLHAGLL
FT                   LRFIPMTAERLTGIVSRGGAIMAKWCLSHHQENFLYTHFREICEICSAYDIALSLGDGL
FT                   RPGSIQDANDPAQFAELHTLGELTRIAWEYDVQVMIEGPGHVPMHMIQRNMEEELSHCH
FT                   EAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPDKDDVKQGL
FT                   ITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPVTARAYHDATLPQA
FT                   SGKLAHFCSMCGPKFCSMKISREVREHAARQQAADPGMAQMAQQFRDQGGEIYLADVTD
FT                   SAPSRKES"
FT   gene            175821..176594
FT                   /locus_tag="ETAF_0152"
FT   CDS_pept        175821..176594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0152"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40275"
FT                   /db_xref="GOA:A0A0H3DP34"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP34"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40275.1"
FT                   /translation="MAQQLSDSDSGWWVVSDRGRIWLPEGELPYGSAAQWHLVGETAYR
FT                   IGEWQGMPVWLLCLTYPQDMTSVRQLIDADRGLFQLAGRGVQLAEFFQSHRFCGSCGHP
FT                   MHASQQEWARLCAHCQQRYYPQIAPCIIVAIRRDDHILLARHNRHRNGIYTVLAGFVEV
FT                   GETLEQAAAREIFEESRLQVKNLRYVTSQPWPFPHSLMMAFLADYAAGDLCHDPKELQE
FT                   ADWYRYDRLPQLPPAGTVARRLIEDTVALCRAQHE"
FT   gene            176642..177706
FT                   /locus_tag="ETAF_0153"
FT   CDS_pept        176642..177706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0153"
FT                   /product="Uroporphyrinogen III decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40276"
FT                   /db_xref="GOA:A0A0H3DQG4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQG4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40276.1"
FT                   /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYNATRAQAGN
FT                   FIALCKNAELACEVTLQPLRRFPLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTHPVT
FT                   CHADIQRLPIPDPEQELGYVMDAVRTIRRDLRGDVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYSDPAALHLLLDKLAQSVILYLNAQIRAGAQAVMIFDTWGGVLTGRDYREF
FT                   SLRYMHQIVDGLQRESEGRRVPVTLFTKGGGQWLEAMADTGCDALGLDWTCDIADARRR
FT                   VGDRVALQGNMDPSLLYAPPARIEQEVATILAGFGQGEGHVCNLGHGIHPDVPPEHAGV
FT                   FVDAVHRLSVPYHR"
FT   gene            177721..178407
FT                   /locus_tag="ETAF_0154"
FT   CDS_pept        177721..178407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0154"
FT                   /product="Endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40277"
FT                   /db_xref="GOA:A0A0H3DLV6"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40277.1"
FT                   /translation="MDLQALRSEQRARAVQVERADRWEAPVLIAGADVGFEQDGAVTRA
FT                   ALAVLCYPELTLVEYQVARIETQMPYIPGFLSFREYPALLQSWGQLRHRPQLVMVDGHG
FT                   IAHPRRLGIASHFGLLVDVPTIGVAKRRLCGQFAPLDETPGSTVALMDGGEQLGWVLRS
FT                   KARCNPLFISGGHRVSTDSALAWVQRCLRGYRLPEPTRWADAIASRRPAFLRWQSAQPR
FT                   SAVQVE"
FT   gene            178513..179103
FT                   /locus_tag="ETAF_0155"
FT   CDS_pept        178513..179103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40278"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM91"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40278.1"
FT                   /translation="MLRNPIHKRLEKLESWQQLTFMACLTERMYPNYQAFCQQSAFGEA
FT                   AVYRRILDLVWELLTVKDVKINFDSQLEKLEAAIPDADAYDMYGVYPAIDACVALSEIL
FT                   HAQLGGEMLAHAIAVSETSLYTVSMLEMTQSGREMSDDELKALPAIQDELDIQWEIYRL
FT                   LSEAEERDLELIKGLRADLREAGVSNIGIELAQ"
FT   gene            179293..179565
FT                   /locus_tag="ETAF_0156"
FT   CDS_pept        179293..179565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0156"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40279"
FT                   /db_xref="GOA:A0A0H3DP09"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP09"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40279.1"
FT                   /translation="MNKTQLIDVIADKADLSKTQAKAALESTLAAITESLKAGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGNEIKIAAANVPAFVSGKALKDAVK"
FT   gene            179627..180283
FT                   /locus_tag="ETAF_0157"
FT   CDS_pept        179627..180283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40280"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP39"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40280.1"
FT                   /translation="MCRRVRGLLPVALLLTGCHSTAPVAPFTATGYIADGGIVRLWRLE
FT                   GAGHQPQAMMRVFTPLDGTETQIDRYTYRDGHLYQIRQQTGQGNDDVLQLRFDMQGSLS
FT                   YMQRLRNGSKEMPGSDEVAKAQYQARHAQEMATTLAAGGVNLIQGRWQGGIFTRCDGQV
FT                   APLPLSGWQAAQLARREANSRGPLWVAWLSAPEGAQLLQVANHNICAWAPTEKTV"
FT   gene            complement(180318..181595)
FT                   /locus_tag="ETAF_0158"
FT   CDS_pept        complement(180318..181595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0158"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40281"
FT                   /db_xref="GOA:A0A0H3DQG9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQG9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40281.1"
FT                   /translation="MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTALEPALEN
FT                   IDIAATDIDALVAFALRHQVGLTIVGPEAPLVLGVVDAFRAAGLPIFGPSQSAARLEGS
FT                   KAFSKDFLARQRIPTAAYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTREE
FT                   AEAAVHDMLAGNAFGDAGHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGD
FT                   SGPNTGGMGAYSPAPVVSDAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGA
FT                   PKVIEFNCRFGDPETQPIMMRMQSDLVALCLAGANGTLDQQSSAWDPRPALGVVLAAGG
FT                   YPGDYRQGDVIHGLTQGTAQAKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRN
FT                   AYRLADALSWEGGFCRRDIGYRALQR"
FT   gene            complement(181637..183226)
FT                   /locus_tag="ETAF_0159"
FT   CDS_pept        complement(181637..183226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0159"
FT                   /product="IMP cyclohydrolase /
FT                   Phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40282"
FT                   /db_xref="GOA:A0A0H3DLW0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40282.1"
FT                   /translation="MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLS
FT                   QAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVN
FT                   LYPFAQTVARPDCTLEEAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFDNIIAEMDAH
FT                   HGALTQATRFDLAIKAFEHTAAYDSMIANYFGTLVAPYHGDTQSPSGRFPRTLNLNLIK
FT                   KQDMRYGENGHQQAAFYIEEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFAEP
FT                   ACVIVKHANPCGVALGDDPLDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIIARQFV
FT                   EVIIAPHVTEDALDLLSAKQNVRVLACGEWDARIPGLDFKRVNGGLLVQDRDLGMVDVA
FT                   DLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLPVAGSVMASDAFFPFRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHGI
FT                   AMIFTGMRHFRH"
FT   gene            183887..185315
FT                   /gene="rrsA"
FT                   /locus_tag="ETAF_3227"
FT   rRNA            183887..185315
FT                   /gene="rrsA"
FT                   /locus_tag="ETAF_3227"
FT                   /product="Small Subunit Ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            185414..185489
FT                   /gene="trnE"
FT                   /locus_tag="ETAF_3228"
FT   tRNA            185414..185489
FT                   /gene="trnE"
FT                   /locus_tag="ETAF_3228"
FT                   /product="tRNA-Glu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            185658..188586
FT                   /gene="rrlA"
FT                   /locus_tag="ETAF_3229"
FT   rRNA            185658..188586
FT                   /gene="rrlA"
FT                   /locus_tag="ETAF_3229"
FT                   /product="Large Subunit Ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            188675..188794
FT                   /gene="rrfA"
FT                   /locus_tag="ETAF_3230"
FT   rRNA            188675..188794
FT                   /gene="rrfA"
FT                   /locus_tag="ETAF_3230"
FT                   /product="5S ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(189073..189636)
FT                   /locus_tag="ETAF_0160"
FT   CDS_pept        complement(189073..189636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40283"
FT                   /db_xref="GOA:A0A0H3DM95"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM95"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40283.1"
FT                   /translation="MHNELANPAPLGLMGFGMTTVLLNMHNAGIFALDAMILAMGIFFG
FT                   GLAQIFAGLLEFRKGNTFGLTAFTAYGAFWLTLVTLLLLPKMGLADAVTPPSLAAYLAL
FT                   WGIFTLFMFFGTLRANRALQFVFASLTLLFFMLAYGNLTGNAGLLHIAGVEGIICGASA
FT                   IYLAMAEVINGQLGRCVLPIGEPR"
FT   gene            complement(189722..191677)
FT                   /locus_tag="ETAF_0161"
FT   CDS_pept        complement(189722..191677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0161"
FT                   /product="Acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40284"
FT                   /db_xref="GOA:A0A0H3DP14"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP14"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40284.1"
FT                   /translation="MSQIHTYPVPADIARHAFINAEMYREMYLASVEDPEAFWAEQGQI
FT                   ISWITPYSRVKNTSFDPGHINIRWFEDGTLNLAANCLDRHLAERGEQTAIIWEGDDPQE
FT                   SRRVTYRQLHGEVCRFANVLKSLQVEKGDVVAIYMPMVVEAAVAMLACARIGAVHSVIF
FT                   GGFSPEAVAGRIIDSGAKLVITADEGVRAGRTIPLKRNVDEALQHPQVNSVHHVVVFRR
FT                   TGGAGEWDSGRDRWWHELMAQADEHCPAVEMNAEDPLFILYTSGSTGKPKGVLHSTGGY
FT                   LVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLANGAITLMFEGVPNYPGIN
FT                   RLSQIVDKHQVNILYTAPTAIRALMAEGQRAVADTQRTSLRIMGSVGEPINPEAWEWYY
FT                   HTIGNGHCPIMDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNSGEILEG
FT                   ASEGNLVILDSWPGQARTLFGAHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHSIKGQAIYAYITLNVGEEPSPALY
FT                   AEVRDWVRKEIGPIATPDILHWTDALPKTRSGKIMRRILRKIASGDISNLGDTSTLADP
FT                   GVVEKLLEEKQAMQPR"
FT   gene            192175..193497
FT                   /locus_tag="ETAF_0162"
FT   CDS_pept        192175..193497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0162"
FT                   /product="Proton/glutamate symport protein /
FT                   Proton/aspartate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40285"
FT                   /db_xref="GOA:A0A0H3DP44"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP44"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40285.1"
FT                   /translation="MMKRFTLTLAWQIVIALILGIAVGAALHDQTESRQWLVSNVLGPA
FT                   GDIFIRLIKMIVIPIVISTLIVGIAGVGDAKKLGRIGLKTILYFELITTVAIVVGITLA
FT                   NLFQPGLGVDMSHLAAVDISQYERTTEQVQSGAHSLVGTLLALIPANLFSAMAKGEILP
FT                   IIFFSVLFGLGLSSLPADHKEPLLRVFRAVSESMFKVTHMIMRYAPIGVFGLISVTVAN
FT                   FGFASLIPLAKLVLLVYAAILFFALVVLGTVARLCHLRIWTLIVILKDELILAYSTASS
FT                   ETVLPRIMEKMEAYGAPKSITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIQLSLGQ
FT                   EIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNV
FT                   VGNALAVLVVAKWEHQFDRTKAHAYEARMHTPQGVAQQDLL"
FT   gene            complement(193572..194999)
FT                   /locus_tag="ETAF_0163"
FT   CDS_pept        complement(193572..194999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0163"
FT                   /product="Type I secretion outer membrane protein, TolC
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40286"
FT                   /db_xref="GOA:A0A0H3DQH4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQH4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40286.1"
FT                   /translation="MKKLLPLLIGLSLSGFSALSQAENLMQVYQQAKESNPDLRQAAAN
FT                   RDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSNNYGASLALTQTIFDMSKWR
FT                   QLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQLTYTEANKQAIYNQLDQTT
FT                   QRFNVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALRQITGQYYPQLSALNIDR
FT                   FSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETGYMPTLNLTASTGVSNT
FT                   DYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQVKQAQYNFVGASEAL
FT                   DSAHRSVVQNVRSSFNNISAAISGVSAYKQAVVSAQSSLDATQAGYQVGTRTIVDVLNA
FT                   TTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLALNGDLSKPVPTAADSIAPDD
FT                   AAQAAKANGPIPGGGVR"
FT   gene            195215..195844
FT                   /locus_tag="ETAF_0164"
FT   CDS_pept        195215..195844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0164"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40287"
FT                   /db_xref="GOA:A0A0H3DLW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40287.1"
FT                   /translation="MCVDKPSPVTFGKDDVEIIARETCYRGFFSLDRYRFRHRLFNGEM
FT                   SGEVVREVFERGHAAVLLPYDPRRDEVVLIEQLRMPAYTSSRTPWLLEMVAGMIEVGES
FT                   VEQVARREAQEEAGITVGRCQPVLSYLASPGGTSERLSIVVGEVDAATASGVHGLAEEH
FT                   EDIRVHVVSREQAYRWVEQGVIDNAASVIALQWLALNHSRLRAQWA"
FT   gene            196271..197098
FT                   /locus_tag="ETAF_0165"
FT   CDS_pept        196271..197098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0165"
FT                   /product="3,5-cyclic-nucleotide phosphodiesterase"
FT                   /EC_number="3.1.4.17"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40288"
FT                   /db_xref="GOA:A0A0H3DMA0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMA0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40288.1"
FT                   /translation="MESLFHLAVASGAPVRILQITDTHLFAGQQETLLGVNTYRSYQAV
FT                   LAAIRAEAHPFDLIVATGDLAQDHSAAAYQHFAAGVAALHRPCLWLPGNHDFQPAMVDA
FT                   LAQAGVHANKRALLGDRWQIVLLDSQVVGVPHGELSDYQLEWLEQTLASEPQRHTMLLL
FT                   HHHPLPSGCTWLDQHSLRNAHALDEILRRYPQVNTLVCGHIHQELDLDWNGCRLLATPS
FT                   TCVQFKPLCTNFTIDTISPGWRYLTLYPDGRVTTAVHRLASSEFRPDLDADGY"
FT   gene            197101..197682
FT                   /locus_tag="ETAF_0166"
FT   CDS_pept        197101..197682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0166"
FT                   /product="Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40289"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP19"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40289.1"
FT                   /translation="MPTLLYLHGFNSSPRSAKATALQRWLAEYHPQITMLIPQLPPYPA
FT                   DAAQMLEELVMERAGRPLGLVGSSLGGYYATWLSQCFTLPAVVINPAVKPFELLLDFLG
FT                   QNENPYTGQQYVLESRHVFDLKVMQVDPLESPDLIWLLQQTGDEVLDYRQAVTYYTPCR
FT                   QTIEEGGNHAFVGIERFFPQIIDFLGLSAE"
FT   gene            complement(197651..197785)
FT                   /locus_tag="ETAF_0167"
FT   CDS_pept        complement(197651..197785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP48"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40290.1"
FT                   /translation="MIRKSRCLSIRWEKQGRPLAHPLLYPPVGIGRWRAIPRSAPKSL"
FT   gene            197789..199684
FT                   /locus_tag="ETAF_0168"
FT   CDS_pept        197789..199684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0168"
FT                   /product="Topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40291"
FT                   /db_xref="GOA:A0A0H3DQH9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQH9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40291.1"
FT                   /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHATRIEVILHPDQSLEVIDNGRGMPVDIHPEEGVPAIELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSRRVEVSVRRDGQIYQMAFENGEKVEDLHVSGTVGRRNTG
FT                   TSVHFWPDAQFFDSARFSVSRLTHLLKAKAVLCPGVEILFRDLVNGSEQRWCYQDGLTD
FT                   YLMESVNGLVTLPEQPFTGTFASDTEAVDWALLWLPEGGELLTESYVNLIPTPQGGTHV
FT                   NGLRQGLLDAMREFCEFRNLLPRGVKLTADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQSAELLAELAINSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRPLVQA
FT                   GHVYVAMPPLYRIDLGKEVFYALSEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTIEDEDMERTVAVMDMLLAKKRAEDRRNWLQENGNLAELDV"
FT   gene            199870..202146
FT                   /locus_tag="ETAF_0169"
FT   CDS_pept        199870..202146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0169"
FT                   /product="Topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40292"
FT                   /db_xref="GOA:A0A0H3DLW8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40292.1"
FT                   /translation="MSDLTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTE
FT                   AEIITPRDEIRKIYRTGRGSVRMRAVWRKEESEIVISALPHQTSGAKVLEQIASQMRAK
FT                   KLPMVDDLRDESDHENPTRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDR
FT                   RPAVKDLREILSEWLSYRRETVRRRLNYRLEKVLKRLHILEGLLCAFLNIDEVIHIIRS
FT                   EDEPKPVLVARFGLSDTQAEAILELKLRHLARLEEVKIRGEQDALAQERDRLQTLLASE
FT                   RKLGTLIKKEIMADAETYGDARRSPLQERSEARAMSEHDFVPSEPVTIVLSEGGWVRSA
FT                   KGHDIDPSGLNYKAGDAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAADNQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENAKVL
FT                   TPLEINGDDDMLLAITEAGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLL
FT                   VLAPQTSLTLHVGKRKLVMKPQDLQKFRAERGRKGTLLPRGLQRIERVDVDAPQSLRLD
FT                   ADGDA"
FT   gene            202237..202980
FT                   /locus_tag="ETAF_0170"
FT   CDS_pept        202237..202980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0170"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40293"
FT                   /db_xref="GOA:A0A0H3DMA6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMA6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40293.1"
FT                   /translation="MLFIFRVILITLLCLVICIVGSLYCLFSPRNPRHVARFGHWFGRL
FT                   SPLFGLKVETRLPPDAATYGNAIYIANHQNNYDMVTASNAVQPNTVTVGKKSLAWIPFF
FT                   GQLYWLTGNLLIDRKNRTKAHNTIAAVVEQFRTRRISFWMFPEGTRSRGRGLMPFKTGA
FT                   FHAALAAGVPIVPICVSSTHDKVKLNRWNNGVVIVEMLPPIDTSRWGKDQVRELAEHCR
FT                   TLMAKKIEQLDAEVAAREAQAGKRA"
FT   gene            203029..204447
FT                   /locus_tag="ETAF_0171"
FT   CDS_pept        203029..204447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0171"
FT                   /product="Putative cell division protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40294"
FT                   /db_xref="GOA:E0T5V0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/Swiss-Prot:E0T5V0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40294.1"
FT                   /translation="MSLSRRRFIQASGLALCAGGLPLQARASGAQAVLPVPPLLESRRG
FT                   QPLFLSLERTHWAFMGGRKVGTWGVNGVYLGPTVRVHSGDDVKLIYSNRLSESVAMEVA
FT                   GLLVPGPLAGGPARQMSPGVDWSPVLPIRQAAATLWYHADTPRHMAPQVYSGLAGLWLV
FT                   EDQYSKNAPLPNHYGVDDFPLILQDKRLDNFGVPEYDPPSSGGFLGDTLLVNGVQDPYV
FT                   EVSRGWVRLRLLNASNARRYLLQLSDGRPFFVIASDQGLLPAPLQADTLPLAPGERREV
FT                   LIDMSKGEEISITAGEAAGIMDRLRGLFEPSSMLVSTRVLTLRPTGLLPLMTDTLPARL
FT                   AADPLPEGDVVNNRSIMLGSASSPGINGALWDPGRIDVQARQGTWERWTVRADTPQSFY
FT                   IQGAQFLVKSVNNAPPLVEDRGWKDSVWVDGEVSLLVYFPQPSSEHFPFLFYSGTLELA
FT                   DRGSVGQMVVQPAQ"
FT   gene            204731..208414
FT                   /locus_tag="ETAF_0172"
FT   CDS_pept        204731..208414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0172"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40295"
FT                   /db_xref="GOA:A0A0H3DP24"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP24"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40295.1"
FT                   /translation="MNTTLERLRRRLEKRILVLDGGMGTMIQRYGLSEQDFRAERFADW
FT                   PCDLKGNNDLLALTRPDIISAIHYAYLEAGADILETNTFNATRIAMADYRMEALAPEIN
FT                   YRAACLARACADEWTARTPHQPRFVAGVLGPTNRTASISPEVNDPACRNITFDQLVAAY
FT                   RESARALIEGGVDLLMIETVFDTLNAKAAVYALECEFAALGVTLPVMISGTITDASGRT
FT                   LSGQTTEAFYNALRHARPLSFGLNCALGPEDLRQYVAELSRVAECHVSAHPNAGLPNAF
FT                   GEYDLSPQAMAQQIAEWARAGYLNIVGGCCGTTPEHIAAISRAVQGITPRALPTLPVAC
FT                   RLSGLEPLTIDETSLFVNVGERTNVTGSAKFKRLIKENKYDEALDVARQQVASGAQIID
FT                   INMDEGMLDAEAAMVRFLNLIAGEPDIARVPLMIDSSRWSVIEAGLKCIQGKGIVNSLS
FT                   LKEGEANFLEHARQVRRFGAALVVMAFDEQGQADTRERKVAICRRAYQLLTERIGFPPE
FT                   DIIFDPNIFAVATGIEEHSNYAVDFIASCAEIKAQLPHALISGGVSNVSFSFRGNEAVR
FT                   EAIHAVFLYHAIRHGMDMGIVNAGQLAIYDDLPDDLRTAAEAVILNQSPDATDRLLALA
FT                   ERYRDTQGSAQAEAQQAEWRSWPVAQRLEYALVKGIGEFIAQDTEAARLEADRPIAVIE
FT                   GPLMAGMNRVGDLFGDGKMFLPQVVKSARVMKQAVAYLSPFIEASKQRGSSAGKVLLAT
FT                   VKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPAERILRVAREERVDIIGLSGLITPSLD
FT                   EMVNVASEMERQGFTLPLLIGGATTSKAHTAVKIAPAYGGPTVYVQNASRTVGVVAALL
FT                   SEAQRGPFIDRTRREYEAARAQHGRQTPRTPPVTLAQARANGVVTDWSACPPPVPLRLG
FT                   VQTVQPGIARLRDYIDWTPFFLTWSLAGKYPRILQDEVVGEEARRLLADANGLLDRLEA
FT                   SGSLTPRGVFGLFAANRRGDDVLIYRDESRREVLAVSHHLRQQSDKRVGPNYCLADFVA
FT                   AADEGIADYIGAFAVTGGLEEEALAQAFDAQHDDYHKIMVKALADRLAEAFAEYLHQQV
FT                   RKVHWGYAADEALDNEQLIRENYRGIRPAPGYPACPEHSEKATLWRLLDVERHTGMRLT
FT                   ESYAMWPGASVSGWYFSHPHSKYFAVARVQRDQVADYAARKGMTLAEAERWLAPNLGYE
FT                   VA"
FT   gene            complement(208462..209811)
FT                   /locus_tag="ETAF_0173"
FT   CDS_pept        complement(208462..209811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0173"
FT                   /product="Aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40296"
FT                   /db_xref="GOA:A0A0H3DP53"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP53"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40296.1"
FT                   /translation="MQQTIIAKFGGTSVADADAMLRCADIILSNPAVRVVVLSAAAGVT
FT                   NHLIALAEGQEAAERLRLIGEVRRIHDAILAALPDGVVVRSEIERMLENIAMLAEAAAL
FT                   ATSAALTDELVSHGELMSTLLFSELLRVRGVSVEWFDIRRIMRTDDRFGKAEPDREQLQ
FT                   ALAQQSLAPRLTTHLIITQGFIGSERKGRTTTLGRGGSDYTAALLAEALDAARVDIWTD
FT                   VPGIYTTDPRIVPAARRIDEIAFSEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSRD
FT                   PGAGGTLVCNKSAQPPLFRALALRRSQTLLTLHSLNMLHARGFLAEVFGILARHRISVD
FT                   LITTSEVSIALTLDTTGSCTGGASLLTSALLTELSAQCRVEVEEDLALVALIGNQLSSA
FT                   CGVGRQVFGAMEPFNIRMICYGASSHNLCFLVPGNDADAVVRTLHARLFE"
FT   gene            209812..210108
FT                   /locus_tag="ETAF_0174"
FT   CDS_pept        209812..210108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQI5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40297.1"
FT                   /translation="MMPRVRGRCPCCPAGQSISPAPGALNGTGRRMRAPQVLHLTVPST
FT                   EAGGRGDSPRGCPEGRCALARRSGAALLKGDAGGGVPPRFAQTGLYTGCTGHF"
FT   gene            210635..212284
FT                   /locus_tag="ETAF_0175"
FT   CDS_pept        210635..212284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0175"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40298"
FT                   /db_xref="GOA:A0A0H3DLX2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40298.1"
FT                   /translation="MKNINPTRTAAWQALQQHFEQMKSVQMRDLFAADADRFSKFSATF
FT                   DDQMLVDYSKNRINAETLEKLQALARETDLQGAIAAMFAGEKINRTEDRAVLHIALRNR
FT                   SNTPIYVDGKDVMPEVNAVLAKMKQFCVRVIDGEWRGYTGKTITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLAMHFVSNVDGTHIAETLQRLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLQAAGDERHVAKHFAALSTNAQAVAAFGIDTANMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSIGYDNFEQLLAGAHAMDRHFASAPLQQNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGQAVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLGDHHSKLLSNFFAQTEALAFGKSREAVEEEFAKAGKSAAEVQHIV
FT                   PFKVFEGNRPTNSILLREITPYSLGMLIALYEHKIFTQGAILNIFSFDQWGVELGKQLA
FT                   NRILPELEDAQPVRSHDSSTNALINRFKAWRA"
FT   gene            complement(212345..213592)
FT                   /locus_tag="ETAF_0176"
FT   CDS_pept        complement(212345..213592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0176"
FT                   /product="H+/sodium:glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40299"
FT                   /db_xref="GOA:A0A0H3DMB2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40299.1"
FT                   /translation="MHILRHYTFTLCLLLGIILGGLAGILFGERATLVQPIGELFLNLM
FT                   FVVIVPLVFLSIASSIADMRQMSRLGKIMGTVFSVFIATALFAALIGFVATHLFNPFHN
FT                   VDTQSLIAHLPPAPQEQSKGLGEVIVSTFTVPDFLQLFTKSNLLPLIVFSILFGLATAF
FT                   SGEQGRPVAQFLSAGTTVILRMVKIIMYAAPLGLGCYFAATVGALGPQIIHGYLNAFLL
FT                   YVVLTVIYFFGANTLYAFIAGGRPAVRLFWGNVFTPAITAIATASSAACIPVNLVASKK
FT                   MGVPADIAETVIPLGANTHKDGSVIGGIIKIVFLFTLFGRDMSDPMSIAAIISVAFLVG
FT                   AVMGAIPSGGMTGELMICAVFGFSPELVGTIMIISTIIDIPATLLNSTGNTVCAMLVTR
FT                   FVEGKAWLQRQWETAE"
FT   gene            213649..213789
FT                   /locus_tag="ETAF_0177"
FT   CDS_pept        213649..213789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP30"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40300.1"
FT                   /translation="MILADYANYLPLSPPAPNLCDARRAACDVGGFLAPGDRRQNGNIV
FT                   N"
FT   gene            213826..214233
FT                   /gene="psiE"
FT                   /locus_tag="ETAF_0178"
FT   CDS_pept        213826..214233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiE"
FT                   /locus_tag="ETAF_0178"
FT                   /product="PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40301"
FT                   /db_xref="GOA:A0A0H3DP59"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP59"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40301.1"
FT                   /translation="MPGTERANRVATVLQWILNIGLMALAAILVIFLAKETFTLAGVLF
FT                   DANQNASTYMLVEGIVIYFLYFEFIALIVKYFQSGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ESPNDTLIYSFAILVLVIALYLANTDRLKRE"
FT   gene            complement(214322..215212)
FT                   /gene="malG"
FT                   /locus_tag="ETAF_0179"
FT   CDS_pept        complement(214322..215212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="ETAF_0179"
FT                   /product="Maltose/maltodextrin ABC transporter, permease
FT                   protein MalG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40302"
FT                   /db_xref="GOA:A0A0H3DQJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQJ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40302.1"
FT                   /translation="MAMVQPQSLRYRLWLTHLLMILFIALIMFPLLMVIAISLRAGNFA
FT                   TGSLIPDQISWEHWKLALGISVTAPDGRVTPPPFPVLLWLWNSIKVAVTTALGILTLST
FT                   TCAYAFARMRFRGKSSLLKGMLIFQMFPAVLSLVALYALFDRIGQYVPFLGLNTLGGVI
FT                   FAYMGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNTYTLAVGMQQYLNPQNYLWGDFAAAAVLSAMPITAVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            complement(215227..216798)
FT                   /gene="malF"
FT                   /locus_tag="ETAF_0180"
FT   CDS_pept        complement(215227..216798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="ETAF_0180"
FT                   /product="Maltose/maltodextrin ABC transporter, permease
FT                   protein MalF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40303"
FT                   /db_xref="GOA:A0A0H3DLX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40303.1"
FT                   /translation="MSLSQTEYPASEPRRLCPRTGLKWLAVGLLTLLTGYLTIVMYAQG
FT                   EYLFAMLTLILLGGGLYIFANRRAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSST
FT                   NQLSQERAQSVLLQRMFTSGQTYAFSLYPDGDQWRLQLTDAQNGQRYLSGPFTLSQSDL
FT                   QISMAPADGAPQGSAATLRTVTQHRQTLNSLVALLPDGAALRMSSLRQFAASRPLYTLG
FT                   DDGRTLTDNQSGIAYRPNMQSGFYQAVNADGNWRSERLSPGFTVTTGWKNFLRVLDDEG
FT                   IRQPFISIFIWTLVFSVLTVIFTVAVGMVLACVVQWEALRGRAAYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMMLSQLFGIRPAWFSDPLTAKCMILIVNTWLGYPYMMILCMG
FT                   LLKAIPEDLYEASAMDGAGPLQNFFRITLPMLIKPLTPLMIASFAFNFNNFVLIQLLTN
FT                   GGPDMLGTSTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKA
FT                   SKMNFD"
FT   gene            complement(216936..218129)
FT                   /gene="malE"
FT                   /locus_tag="ETAF_0181"
FT   CDS_pept        complement(216936..218129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="ETAF_0181"
FT                   /product="Maltose/maltodextrin ABC transporter, substrate
FT                   binding periplasmic protein MalE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40304"
FT                   /db_xref="GOA:A0A0H3DMB7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40304.1"
FT                   /translation="MTKTSAIKTIALSALAALVISAPALAKIEEGKLVIWINGDKGYNG
FT                   LADVGKKFEQETGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   IHPSKAFQEKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKSWEEIPALDS
FT                   KLRAQGKSAIMWNLQEPYFTWPLIAADGGYAFKYANGRYETNNVGVDNAGSRAGLQFLV
FT                   DMVKNKHINADTDYSIAEAAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGHPS
FT                   KPFVGVLSAGINAASPNKELATEFIENYLLTDSGLAMVNQDKPLGAVALKSYQEILEKD
FT                   PRIAATMQNSQNGEIMPNIPQMSAFWYAERAAIINAINGRQSVTQALESAKERILKK"
FT   gene            218184..218333
FT                   /locus_tag="ETAF_0182"
FT   CDS_pept        218184..218333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP33"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40305.1"
FT                   /translation="MAAYRTLRSWGYRRVPAGRRGQERRCCVIVRESRPILILPRSTPC
FT                   GAFL"
FT   gene            218613..219722
FT                   /gene="malK"
FT                   /locus_tag="ETAF_0183"
FT   CDS_pept        218613..219722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="ETAF_0183"
FT                   /product="Maltose/maltodextrin transport ATP-binding
FT                   protein MalK"
FT                   /EC_number="3.6.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40306"
FT                   /db_xref="GOA:A0A0H3DP64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP64"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40306.1"
FT                   /translation="MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELQIAGVRMNDVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   VNKAEIQRRVNQVAEILQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLQRTMIYVTHDQVEAMTLADKIVVLDAGRIAQVGKPLALY
FT                   HYPADRFVAGFIGSPKMNFLPVKVSEAQPQRVRVELPNGQHIWLPVAGEGLRPGSNLSL
FT                   GIRPEHLVPSAAADVTLSGEVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGAT
FT                   LAIGLPAERCHLFREDGSACQRLYQEPGV"
FT   gene            219790..221067
FT                   /locus_tag="ETAF_0184"
FT   CDS_pept        219790..221067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0184"
FT                   /product="Maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40307"
FT                   /db_xref="GOA:A0A0H3DQJ6"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQJ6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40307.1"
FT                   /translation="MMNMRKLPLALAVASVVLSAQAMAVDFHGYARSGIGWSSKGGDQK
FT                   CFQADGAGSKYRLGNECDTYAELKLGQELWKSGDQSFYLDTNVAYGIDQANDWESTSPA
FT                   FREINVQGKNVITWLPGSTLWAGKRYYQRHDVHMIDFYYWDISGPGAGLENIDLGFGKL
FT                   SLAVTRNTESGGSYSYFVNQSNEKYIRNTANDVYDIRLAGLQTNPGGSLELGFDYGRAN
FT                   LDDGYHLAPGATKDGYMFTAEHTQSLWGGFNKFVVQYATDAMSNTNNAGHSSGSSVNND
FT                   GHLIRVLDHGAMDFNDKWGLMYVAMYQDVDHDVQNGSTWYTAGVRPMYKWTPTMSTLFE
FT                   AGYDNVKSQKTGARNELYKLTLAQQWQAGDSVWSRPAIRIFATYANGKNNWNTDKDGIQ
FT                   VNTQPGDIRAEGVPGWSFGAQMEAWW"
FT   gene            221164..222069
FT                   /gene="malM"
FT                   /locus_tag="ETAF_0185"
FT   CDS_pept        221164..222069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /locus_tag="ETAF_0185"
FT                   /product="Maltose operon periplasmic protein MalM"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40308"
FT                   /db_xref="GOA:A0A0H3DLY3"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLY3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40308.1"
FT                   /translation="MMKTALNRLSRGVLLACALCSAPQAFADTLLPTDVAAAPELSHTA
FT                   LQALRWQPLTPPVDTTITLGPDSQTLAQGDIQGAVAALALPANRGSLEITLSSRLHNKR
FT                   LYVPNVLVLDQHLRPAAYYPGSYFTYRQPGVMSGDRLEGTLKLTPVLGQQQIYLLIYTT
FT                   RQDLATTTRMVNPAKAYAAGVGNAVPDIPDPQAAHASQGGLSIQARVERQSGNVMIGGL
FT                   LPGGDTPADVAVGSPASAAAVAAPATPMLDDTAAYFDRSIRSAVRQGDIDKALRLMNEA
FT                   QRLGSTTARETFIRSVKGKG"
FT   gene            222326..222838
FT                   /locus_tag="ETAF_0186"
FT   CDS_pept        222326..222838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0186"
FT                   /product="Chorismate--pyruvate lyase"
FT                   /EC_number="4.1.3.40"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40309"
FT                   /db_xref="GOA:A0A0H3DMC4"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40309.1"
FT                   /translation="MYGMAEHSAALANIDWQPLADAAAPADYGSWLAEQGSMTRRLEQR
FT                   CDRLQVTVLREGPVDATQLSDDERGQLSPCAQYWLREVILLGDGIPWLFGRTLTPSSTL
FT                   QGEGEALRRLGNTPLGRYLFSGVALERESLRVGCLGPLWARRSRLRVAGQPLLLTELFL
FT                   ADAPIYG"
FT   gene            222864..223727
FT                   /locus_tag="ETAF_0187"
FT   CDS_pept        222864..223727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0187"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40310"
FT                   /db_xref="GOA:A0A0H3DP38"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP38"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40310.1"
FT                   /translation="MEGCVTQSKWLAYCRLMRIDKPIGSLLLLWPTYWALWLAGGAAPG
FT                   GKLLLVFTCGVFFMRAAGCVINDFADRHFDGHVKRTCQRPLPCGALSEREAKTLFVLLV
FT                   ALSFALVLTLNAMTIWLSVAALTLAWLYPFMKRFSHLPQVILGMAFGWSIPMAYAAVGE
FT                   SLPLSCWLLFVANICWTVAYDTQYAMVDRDDDLRIGIKSTAILFGRYDRLMIGLLQFAT
FT                   LLLLLWVGDLNQLQGAYYWGVLLAAALFVYQQRLIARRARTSCFRAFMNNNYVGLILFL
FT                   GILLAL"
FT   gene            224016..225692
FT                   /locus_tag="ETAF_0188"
FT   CDS_pept        224016..225692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0188"
FT                   /product="MFS permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40311"
FT                   /db_xref="GOA:A0A0H3DP70"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP70"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40311.1"
FT                   /translation="MSVDNSVPTPRDGERRAADVRPGFFSKARIIARPGFNRWLVPPAA
FT                   LAIHLCIGMAYGFSVFWLPLSQALGDGAARACPAPMSAWQELFTTQCDWRISMLGWTYT
FT                   LFFIFLGCSAALWGSWLEKAGPRKVGVVAACCWCGGLMFSALGVYLHQLWMLWLGSGVI
FT                   GGIGLGLGYISPVSTLIRWFPDRRGMATGLAIMGFGGGAMVGAPLANSLMHFYAAAGGV
FT                   GVWQTFLTLALIYWVFMLSGALAYRIPPIGWRPQGMAAATATPAARGFTHVEVHVSVAC
FT                   RTPQFWLVWAVLCLNVSAGIGIIGMASPLLQEVFAGRLLGGSQTFAELSSAQLAQIAAI
FT                   AAGFTGLLSLFNIGGRFFWASLSDRIGRKRTFFLFFTLGVALYSLLPTLGALGSVTLFV
FT                   LAFCLIVSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWSAAGILGPVLVNYLREYQ
FT                   LSRGVARAQAYSETLYILAGLLLVGLVCNLLIRPVDRRHSMSEAQLAQARSLYKVNPNA
FT                   QLSWAADAGSRPWVALSWLAVGLPLLWGCWITLLQAGQLFG"
FT   gene            complement(225750..228206)
FT                   /locus_tag="ETAF_0189"
FT   CDS_pept        complement(225750..228206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0189"
FT                   /product="Glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40312"
FT                   /db_xref="GOA:A0A0H3DQK0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQK0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40312.1"
FT                   /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPTDPVAELRLDTTRPVFYVL
FT                   PYNSKADLLTLRDRCLALDLPDPLDDNEIDGVILPRYVFIDDGPRVFRYYAPKQASVKL
FT                   FLDYLDLHRGNPALDIQMIPVSVMFGRAPGREDHKGAPQLRLLNGIQKFFAVLWLGRDS
FT                   FVRFSNTVSLRYMADEHGTDKTIAQKLARVARMHFSRLRLAAVGPRLPDRQALFNKLLG
FT                   SKAIEKAVEDEARSKKISREKAQQNAVALMEEIAADFTYEAVRLSDRVLSWTWNRLYQG
FT                   INVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPA
FT                   GPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFMEGGRSRTGRLLEPKT
FT                   GTLAMTLQAMLRGGKRPITLVPVYIGYEHVMEVATYAKELRGATKEKESLPQMVRGLRK
FT                   LRNLGQGYVNFGEPISLNVWLNQHVPEWREAIDPIEAQRPHWLTPSVNSIAGEVMVNIN
FT                   KAAAANAMNLCATALLASRQRALTREQLLEQLECYLQLLRNVPYAPDATLPQRTPQELL
FT                   DHALQMNKFEVEKDNIGDLIILPREQAVLMTYYRNNIQHMLVLPSLVASMVIHHRQISR
FT                   GELLRQAAVIYPMLKQELFMHYAPETLPQVLSPVIDELCRQQLISLQDDTLSINPPRIR
FT                   ALQLLAAGVRETLQRYAITFSLLSANPSISRGALEKESRILAQRLSVLHGINAPEFFDK
FT                   AVFATLVTTLRAEGYINDVGDAVREQTLEIYNLLADLLTPEIRLTIESVSIAALEDASG
FT                   ASDGAA"
FT   gene            228299..228694
FT                   /locus_tag="ETAF_0190"
FT   CDS_pept        228299..228694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0190"
FT                   /product="Diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40313"
FT                   /db_xref="GOA:A0A0H3DLY8"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLY8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40313.1"
FT                   /translation="MPANAHRYGLSMNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQE
FT                   SLLLAAAVALACWLDVTAVERILLIGSVTLVVILEILNSAIEAVVDRIGSERHELSGRA
FT                   KDMGSAAVFVALWLALFVWVSILWTHW"
FT   gene            complement(228817..230274)
FT                   /locus_tag="ETAF_0191"
FT   CDS_pept        complement(228817..230274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0191"
FT                   /product="Citrate Succinate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40314"
FT                   /db_xref="GOA:A0A0H3DMD0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40314.1"
FT                   /translation="MSKEKIGKLLAPLVVMGIMFMIPVPDGMPPQAWHYFAVFVAMIVG
FT                   MILEPIPATAISFIAVTIVVIGNQFLLFDAKELADPAFNASKQALKWGLAGFSSTTVWL
FT                   VFGAFIFALGYEVSGLGRRIALLLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTARTGG
FT                   TVFPVIKNLPPLFDSHPNDPSSRRIGSYLMWMMVISTSISSSMFVTGAAPNVLGLEFVS
FT                   KIAGIQISWMQWFLGFLPVGLLLLIVAPWLSYVLYKPTVTHSEQVATWAGSALKEMGAL
FT                   TRREITLICLVLLSLALWVFGDDFINATAVALLAVALMLALHVVPWKDVTKYSGAWNTL
FT                   VNLSTLVVMANGLTRSGFIEWFAKTMSTHLAGFSPTATVIALVLVFYFAHYLFASLTAH
FT                   TATMLPVILAVAQSIPGVPMDQLCLLLVLSIGLMGCLTPYATGPGIIIYGCGYVKSQDY
FT                   WRLGAIFGVIYIAALLGIGWPIMAMWN"
FT   gene            complement(230304..231215)
FT                   /locus_tag="ETAF_0192"
FT   CDS_pept        complement(230304..231215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0192"
FT                   /product="2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A
FT                   synthase"
FT                   /EC_number="2.4.2.52"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40315"
FT                   /db_xref="GOA:A0A0H3DP43"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP43"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40315.1"
FT                   /translation="MQHPTTYSPHRLSLSQACRHYATLGWRAMLAEVNLTPKPGLVDRH
FT                   NSGAHRDMAHSDFVRSADAIAPWLARFVEYGADSAALDGGSVLPGLRALGIACEADMFR
FT                   ATAGVNTHKGSIFSLGLLCAAAGRSHQRGHPITPARLCGYAAQFCRGLVARELAPLRPA
FT                   QASTAGQRLFMTLGITGARGEAEAGYPLVLNLALPHYQRTLAAGRDPELALLDTLVQLM
FT                   AHNQDTNVAARGGEGGLRWMQQRAAALLATGGIRTPADLQALHRFDAECIDRHLSPGGS
FT                   ADLLILTWFLAHLCYPILQAEH"
FT   gene            complement(231193..231744)
FT                   /locus_tag="ETAF_0193"
FT   CDS_pept        complement(231193..231744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0193"
FT                   /product="Apo-citrate lyase phosphoribosyl-dephospho-CoA
FT                   transferase"
FT                   /EC_number="2.7.7.61"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40316"
FT                   /db_xref="GOA:A0A0H3DP75"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP75"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40316.1"
FT                   /translation="MMTLLPHLAASHTVTLPELLLSRECRQSRQAAWLTRHTCTLISFT
FT                   VVAPGPVKDSPLTRRIFNAGIAALNQLAQRQEWPLREQRSLELATGPEGLMAIDAPAEQ
FT                   VKRAAIALEQAHPLGRLWDMDVLASDGQILSRSDYQLPARRCLICQRPAVLCARERRHD
FT                   VAQLLAHMEALVHDATPDNV"
FT   gene            complement(231748..233268)
FT                   /locus_tag="ETAF_0194"
FT   CDS_pept        complement(231748..233268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0194"
FT                   /product="Citrate lyase alpha chain"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40317"
FT                   /db_xref="GOA:A0A0H3DQK5"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQK5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40317.1"
FT                   /translation="MTQDTQRNARVAAFSQRDGALPAFNDVSKAQYHDGRARDRKLCTS
FT                   LEEAIRRSGLRDGMTISFHHAFRGGDLTLNQVMDAIAAMGFKDLTLASSSLSDCHAPLV
FT                   GHIRNGVVRKIYTSGLRGPLADAVSHGLLDEPVQIHSHGGRVHLIDSGELSIDVAFLGV
FT                   PACDAFGNANGYTGNACCGSLGYARADAEAANSVVLLTEEILPYPHNPASLTQDQVDLI
FT                   VQIDHVGDASKIGADATRMTSNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGASLAV
FT                   TRFLEDKMRRADIRADFALGGITSTIVDLHEKGYIRKLLDVQSFDRAAAGSLARNPNHI
FT                   EISANQYANWSSKGASVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDTAIG
FT                   SALSIIVAPLVRGRIPTIVDSVLTCVTPGSSIDILVTDHGIAVNPARPELAQRLRDAGL
FT                   PLVSIEWLRDRALSLTGEPKPIAFTDKVVAVVRYRDGSVIDVVRQVKE"
FT   gene            complement(233279..234175)
FT                   /locus_tag="ETAF_0195"
FT   CDS_pept        complement(233279..234175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0195"
FT                   /product="Citrate lyase beta chain"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40318"
FT                   /db_xref="GOA:A0A0H3DLZ3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40318.1"
FT                   /translation="MTPQQKTRTRRSMLFVPGSNAAMLSNAFIYKADALMFDLEDSVVL
FT                   REKDAARRLVYHALQHPLYHDIETIVRVNALDSAYGVADLEAVVRAGVDVVRLPKTDSA
FT                   DDVIAIENEIARIERACGREVGSTGLLAAIESAQGITQAVAIAHASPRLIGIALGAEDY
FT                   VRNLRTERSAEGIELLFARCSILQAARSAGIQAFDTVYSDANNDEGFLREASHIKQLGF
FT                   DGKSLINPRQIELLHNLYAPTQKEVDHARLVVDAAEASAREGRGVVSLNGKMVDSPVIE
FT                   RARLVLSRAALSGIREE"
FT   gene            complement(234172..234471)
FT                   /locus_tag="ETAF_0196"
FT   CDS_pept        complement(234172..234471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0196"
FT                   /product="Citrate lyase gamma chain, acyl carrier protein"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40319"
FT                   /db_xref="GOA:A0A0H3DMD5"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40319.1"
FT                   /translation="MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDA
FT                   IRATVLDVLNRYQVRGVQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA"
FT   gene            complement(234468..235544)
FT                   /locus_tag="ETAF_0197"
FT   CDS_pept        complement(234468..235544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0197"
FT                   /product="Citrate (pro-3S)-lyase ligase"
FT                   /EC_number="6.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40320"
FT                   /db_xref="GOA:A0A0H3DP49"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP49"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40320.1"
FT                   /translation="MFSNTVFTQIKRSEQKRIADITHFLRENGLNIDTSVEIFICAQRD
FT                   NKIIACGGIAGDIIKCVAISATARGEGLALTLATELVNLAYELGRNNLFIYTKEENEEM
FT                   FHQCGFSTITRVPGIMVLMENSKVRLQRYAETLATLRHPGKKIGAIVMNANPFTNGHRY
FT                   LVRQAASQCDWLHLFLVREDTSRFPYEDRLALVRSGVSDIANITLHPGSEYIISRATFP
FT                   CYFIKEQGVADNCYTEIDIKIFRQYLAPALGITHRFVGTEPFCPVTAKYNQDMRYWLET
FT                   PALPSPPIHLVEVARLTYHNTPISASWVRKLLVRKDLPAITPLVPDATRAYLARLIASM
FT                   PAGAERRPQESVLVTGDK"
FT   gene            235932..237575
FT                   /gene="dpiB"
FT                   /locus_tag="ETAF_0198"
FT   CDS_pept        235932..237575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpiB"
FT                   /locus_tag="ETAF_0198"
FT                   /product="Sensor kinase CitA, DpiB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40321"
FT                   /db_xref="GOA:A0A0H3DP79"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP79"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40321.1"
FT                   /translation="MVRMPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASF
FT                   EDYMMRQVRDMAMNQAKIIASMDSIVDGVKDRDTHRLALIADRLGTGTDFDYVVIGDRN
FT                   AIRLYHPNPAKIGHKMQFNKPGAIEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVV
FT                   SLGYLVSKIDSWRLDFLLPMAGVFVCVLLLLMLLSWLFAAHIRRQMMGMEPRQIARVVR
FT                   QMEALFGAVFEGLIAVDPDGQITAINRNARKMLGLSAPGRQWLGQPISQVVSPSGFFTD
FT                   RINEDRRDAILTFNGLSVIANRATIRSDDGDTLLGAIISFRSKDDINTLNAQLTQIRQY
FT                   VDSLRTVRHEHLNWMSTLSGLLQMKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAG
FT                   LLFGKVHRARELGLTLTIVDGSQLHALPAGLDSTEFAAVLGNLLDNAFDASLKNPQGGG
FT                   CVEVYLSDEGSEVIIEVADQGCGVPDTLKDKIFEQGVSTKAEEPGEHGIGLYLIARYVG
FT                   RCGGTITLEDNQPYGTLFSVFIPKVKSEHE"
FT   gene            237568..238254
FT                   /gene="dpiA"
FT                   /locus_tag="ETAF_0199"
FT   CDS_pept        237568..238254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpiA"
FT                   /locus_tag="ETAF_0199"
FT                   /product="Transcriptional regulatory protein CitB, DpiA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40322"
FT                   /db_xref="GOA:A0A0H3DQL1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQL1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40322.1"
FT                   /translation="MNKINILIVEDETPLAEMHAEFIRNHPCCGQLWLAGNLAQARAMI
FT                   KSFHPDLVLLDNYLPDGVGVHLLHELTQQRYPGGVVLTTAASDMDTVSEAVRSGAFDYL
FT                   IKPIAYERLGQTLERYQQRNSMLSGHQNASQRQIDSMYNAYARGDSKEDLPVGIDALTL
FT                   EKVQGLFVDDTVRHTAESVAQSLMLSRTTARRYLEFCAARQQIVAEIVYGKVGRPQRIY
FT                   RAQGKS"
FT   gene            238375..238983
FT                   /gene="lexA"
FT                   /locus_tag="ETAF_0200"
FT   CDS_pept        238375..238983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="ETAF_0200"
FT                   /product="SOS-response repressor and protease LexA"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40323"
FT                   /db_xref="GOA:A0A0H3DLZ8"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40323.1"
FT                   /translation="MKALTARQQQVYDLIRDHIEQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALQRKGVIEIVSGASRGIRLLMEDETGLPLIGQVAAGEPLLAQQHIEGFYQVDPSL
FT                   FKPSADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIEDEVTVKRLKKQGN
FT                   MVQLLPENSDFQPIVVDLREQNFTIEGLAVGVIRNGDWI"
FT   gene            239139..240470
FT                   /locus_tag="ETAF_0201"
FT   CDS_pept        239139..240470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0201"
FT                   /product="DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40324"
FT                   /db_xref="GOA:A0A0H3DME0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40324.1"
FT                   /translation="MRGFFQEDKALWRLALPMILSNVSVPLLGIVDTAVIGHLDSPVYL
FT                   GGVAVGSMATTFLFMLLLFLRMSTTGLCAQAFGAADRPALARALVQPLIMALLAGVGII
FT                   LLRQPLSALMLQIVGAEAAIQTQAQLFMQIRWLSAPATLANLVILGWLLGVQYARAPVL
FT                   LLIVGNAVNIALDLWLVVGLGWKVAGAAWATVIADYVTLLMGVALLLHVMRLRGLRRAH
FT                   FRRAWRGNLRRLLALNRDIMLRSLLLQLCFASLTVIGARMGADVVAVNAVLMNLLTFTA
FT                   YALDGFAYAVEAYSGQAYGARDASALRRVWRAACRQAGAVALLFALAYGLFGRDIVNLL
FT                   TSLPQVQSLALDYLPWQVVLPLLGVWCYLLDGMFIGATRGADMRNSMAVAALGYGMTLL
FT                   SIPWLGNHGLWLALAVFLTLRGLSLWLIWRRCWRAQRWFPAGAA"
FT   gene            complement(240487..240960)
FT                   /locus_tag="ETAF_0202"
FT   CDS_pept        complement(240487..240960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0202"
FT                   /product="Zinc uptake regulation protein ZUR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40325"
FT                   /db_xref="GOA:A0A0H3DP54"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP54"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40325.1"
FT                   /translation="MTTPTLQRLLAQAEQICRQRNVRLTPQRMEVLRLMAAQQGAISAY
FT                   DLLDLLRVSEPQAKPPTIYRALDFLLEQGFIHKVESTNSYVMCHHLDEPCHTSALFICH
FT                   RCGQVHERSADLLQQQLETLAQQAGFTLQHSVIEAHGLCHACAQAPDGETSAR"
FT   gene            241402..242073
FT                   /locus_tag="ETAF_0203"
FT   CDS_pept        241402..242073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP84"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40326.1"
FT                   /translation="MDLILAIEHWPLRQAIVALYRRQFTIISLPDAVPFSPRILSALQR
FT                   TGSLLVTDRQRNHLLQTVERVRRHSLTPVIIINRRESYLTQLIARFFNNAHALSYDGFY
FT                   RHIQRRTFHPLDLYFLPYSRGAPDACWGAGETVHARLNAFGLMTLYQRGVTLREAAVLL
FT                   SLSYHNSTAMTARLLGIHEQAVVYCKRTLGNKLGLDHNRPDFISHIFLSPGARQGARAT
FT                   E"
FT   gene            242191..243249
FT                   /locus_tag="ETAF_0204"
FT   CDS_pept        242191..243249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0204"
FT                   /product="tRNA dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40327"
FT                   /db_xref="GOA:A0A0H3DQL6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQL6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40327.1"
FT                   /translation="MGYGEQAMTQAAHIEQATGARGRDQAGVFPSQRFSIAPMLDWTDR
FT                   HCRYFHRLLSRQTLLYTEMVTTGAIIHGKGDYLAYSEEEHPLALQLGGSNPADLARCAH
FT                   LAEARGYDEINLNVGCPSDRVQNGRFGACLMGEAQLVADCVKAMRDVVSIPVTVKTRIG
FT                   IDAQDSYPFLCDFIGTVAGQGECDTFIVHARKAWLSGLSPKENREVPPLDYPRVYRLKQ
FT                   DFPQFTIALNGGVKRLDEALTHLQHVDGVMMGREAYHNPGILAQVDRQLFDADAAVPDS
FT                   VAVVRALYPYIERELAQGTYLGHITRHILGLFQGIPGARQWRRHLSENAHRPGAGIDVV
FT                   EQALRFVDRRAE"
FT   gene            243413..243625
FT                   /locus_tag="ETAF_0205"
FT   CDS_pept        243413..243625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40328"
FT                   /db_xref="GOA:A0A0H3DM03"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM03"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40328.1"
FT                   /translation="MLEVMFVLAFFMMLLLTGISLLGVIAALAVAALLLVFGGLFVLVI
FT                   KLLPWLALAIVVVWLYRALRKPASY"
FT   gene            243960..244097
FT                   /locus_tag="ETAF_0206"
FT   CDS_pept        243960..244097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40329"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40329.1"
FT                   /translation="MVEIDNDEWRGIQVTPQNRLRLYGTVDKEMAEQSSVDVDRIEILR
FT                   "
FT   gene            244279..245691
FT                   /locus_tag="ETAF_0207"
FT   CDS_pept        244279..245691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0207"
FT                   /product="Replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40330"
FT                   /db_xref="GOA:A0A0H3DP58"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP58"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40330.1"
FT                   /translation="MAGNNPGSKSREAPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNER
FT                   WDHVAERVVSNDFYSRPHRLIFGEMQRLLEQGRPIDLITLSESLEQQGHLDSVGGFAYL
FT                   AELSKNTPSAANINAYADIVRERAVVREMIAVANEIADAGYDPQGRSSEDLLDLAESRV
FT                   FQIAENRASKDEGPKSIDRILEDTVSRIEQLYQRPHDGVTGVSTGYQDLDKKTAGLQKS
FT                   DLIIVAARPSMGKTTFAMNLCENAAMTQEKPVLIFSLEMPGEQIMMRMLASLSRVDQTR
FT                   IRTGQLDDEDWARISSTMGLLLEKRNMYIDDSSGLTPTEVRSRARRIFREHDGLSLIMI
FT                   DYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSD
FT                   LRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIILGKQRNGPIGTVRLTFNGQWSRF
FT                   DNYAGPAYNDED"
FT   gene            complement(245764..245877)
FT                   /locus_tag="ETAF_0208"
FT   CDS_pept        complement(245764..245877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP87"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40331.1"
FT                   /translation="MSQSAAINDGGCRFHVASLVPLMSLVGYRVGRTAPGS"
FT   gene            245833..246924
FT                   /locus_tag="ETAF_0209"
FT   CDS_pept        245833..246924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0209"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40332"
FT                   /db_xref="GOA:A0A0H3DQM1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQM1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40332.1"
FT                   /translation="MKAATAIIDRRALRHNFQQIRKFAPHSRLIAVVKANAYGHGLLET
FT                   AKILHQADCYGVARIGEALMLRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQ
FT                   LQALENARLERPIKVWMKLDTGMHRLGVRPEQAEAFYRRLCTCPNVAQPVNFMSHFSRA
FT                   DEPECGRTEQQLACFDDFVQGKAGEQSIAASGGILLWPQSHRDMVRPGIIMYGVSPQAD
FT                   LSLAADHYGLQPAMTLQSSLIAVREHKAGEPVGYGGAWVAQRDTRLGVVAIGYGDGYPR
FT                   SAPSGTPVLINGREVPIVGRVSMDMISVDLGPQAADRVGDNVIMWGPGLPVEKVAACTG
FT                   ISAYELITKLTSRVAMEYIGEEA"
FT   gene            complement(246997..248154)
FT                   /locus_tag="ETAF_0210"
FT   CDS_pept        complement(246997..248154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0210"
FT                   /product="putative iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40333"
FT                   /db_xref="GOA:A0A0H3DM09"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM09"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40333.1"
FT                   /translation="MENFVLHTPTKILFGRDQIANLRDEIPPQARVLITYGGGSIKRNG
FT                   VLDQVHAALHGRHVFEFGGIEPNPHYETLMQAVEMVHNEKIDYLLAVGGGSVIDGTKFI
FT                   AAAADYVGDPWHIMETVGSDVTRAIPMGVVLTLPATGSEMNMGAVITRSATGDKLHFMS
FT                   PFVMPRFAVLDPQVTYTLPPRQIANGVVDAFVHIVEQYLTYPVDARVQDRFAEGLLQTL
FT                   IEEGPRALQEPENYGVRANIMWCATMALNGLIGAGVPQDWSTHMLGHELTAMHGLDHAQ
FT                   TLAIVLPNVLQLKRDKKHTKLLQYAERVWNIHSGSDEQRIDAAIDATRAFFEQMGVKTR
FT                   LSDYGLDGSTIPALLDKLQEHRMTALGEHGDITLEQSRQIYHAAR"
FT   gene            248589..249275
FT                   /gene="yqhC"
FT                   /locus_tag="ETAF_0211"
FT   CDS_pept        248589..249275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqhC"
FT                   /locus_tag="ETAF_0211"
FT                   /product="Hypothetical transcriptional regulator YqhC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40334"
FT                   /db_xref="GOA:A0A0H3DMF0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40334.1"
FT                   /translation="MLMTLPLPCECETFASPQEPLIGLALRVDVQMLQDLLMDIGDGMR
FT                   TAVRPHADGVRSVALDDAMLCACERLVEAMEDPLHARVLGPQIVREMLFHALCGAGGDA
FT                   LLALASRHSHFSQIAKALRLIEQNYASSLNVDRLAQSVNMSISSFHHNFKAVTATSPLQ
FT                   YIKSYRLHKARMMILHDGLKASTAASRVGYESPSQFSREYKRFFGNTPSDQASRYRSGG
FT                   LRIAEL"
FT   gene            249334..250623
FT                   /locus_tag="ETAF_0212"
FT   CDS_pept        249334..250623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0212"
FT                   /product="putative prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40335"
FT                   /db_xref="GOA:A0A0H3DP63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP63"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40335.1"
FT                   /translation="MIERAFLVPGMAVREFRTEVPLNWRDPSDGRRLTLFARELCAPGR
FT                   EADEMPCLLFLQGGPGGKCPRPTSHSGWLAEALRDYRVILMDQRGTGNSSRIEASVLRD
FT                   MTPEQAADYLSHFRADAIVRDAEHLRLRHFGGRRWTTLGQSYGGFITLTYLSQAPQGLH
FT                   ACYITGGLPAIAPDATRLYEATYRLVAQRNQHFFTRYPQAREQLDRIVALLREQAVYLP
FT                   DGDLLSVERLLTLGLDMGMSEGYERLLWLLDEAFNQEGELSDTFLNQVMQRSGFADNPL
FT                   YAVLHESIYADADSGATRWVAQRVRDDLPAFSPERSSPLLTGEMIYPWMFDQMQSLRPF
FT                   RAAVELLARRETWPVLYDAARLRDNDIPVMAAVYYHDMYVDVGLSLESAAQIGNLQTWI
FT                   TSEYDHNGLRVAPVFRRLRDMMAERGVATE"
FT   gene            complement(250670..251302)
FT                   /locus_tag="ETAF_0213"
FT   CDS_pept        complement(250670..251302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0213"
FT                   /product="porin opacity type"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40336"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP91"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40336.1"
FT                   /translation="MKAFTKLALFVGLVSGATLANAAGINNTGYYAGAKMGISAEHLFD
FT                   QKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRANATSSHTNDAAETN
FT                   DSRLGLQTLMVNGYYDIKTGTPFTPYVGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVG
FT                   TGVIYNVNERLDLDLGYKYLDAGKASAGNSQAKVTTHDVTLGVNYYF"
FT   gene            complement(251414..251533)
FT                   /locus_tag="ETAF_0214"
FT   CDS_pept        complement(251414..251533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQM6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40337.1"
FT                   /translation="MSARKPFLSRSLPRFSCYFQRMENIRYNFIFPFDFIHIK"
FT   gene            252237..252764
FT                   /locus_tag="ETAF_0215"
FT   CDS_pept        252237..252764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0215"
FT                   /product="Superoxide dismutase Cu-Zn precursor"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40338"
FT                   /db_xref="GOA:A0A0H3DM14"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM14"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40338.1"
FT                   /translation="MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPAIGEVTVS
FT                   ETPYGLLFTPSLHGLPQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMG
FT                   PYSDAGHLGDLPGLVVNADGTANYAVLAPRLKSLSQLKGHALMVHVGGDNYDDHPHALG
FT                   GGGARMACGVIQ"
FT   gene            complement(252824..253504)
FT                   /locus_tag="ETAF_0216"
FT   CDS_pept        complement(252824..253504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0216"
FT                   /product="Respiratory nitrate reductase gamma chain"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40339"
FT                   /db_xref="GOA:A0A0H3DMF6"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40339.1"
FT                   /translation="MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMAN
FT                   GRYSRYALNLFHVGMLGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSFFGTLLLI
FT                   GALMLLARRLFCARVAATSSFSDKLILILLTIQICLGMLTIPVDLLHPSGATLQNLISW
FT                   SQGIVTFRPDPAQYLQEVNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVV
FT                   KTLR"
FT   gene            complement(253515..254171)
FT                   /locus_tag="ETAF_0217"
FT   CDS_pept        complement(253515..254171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0217"
FT                   /product="Respiratory nitrate reductase delta chain"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40340"
FT                   /db_xref="GOA:A0A0H3DP68"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP68"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40340.1"
FT                   /translation="MLSLLMLARLLDYPDEALWQARGELEAALPQCREMTAAQQKRLQA
FT                   FIAHYWEAPLASRQSDYIAQFDHTRRCALYLCEHQLAESKNRGQAMVNILSHYRQAALE
FT                   PAPRELPDYLPMVLEFAYLRSQQQPEEGRRILTQIAEVAEILYRRTHDGMYGVLFQLLL
FT                   QLAGRETDGLVPEADGTPTAAIDAEWDRAHAPARVELPDIPQGRPAPVHYLDLER"
FT   gene            complement(254175..255695)
FT                   /locus_tag="ETAF_0218"
FT   CDS_pept        complement(254175..255695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0218"
FT                   /product="Respiratory nitrate reductase beta chain"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40341"
FT                   /db_xref="GOA:A0A0H3DP96"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP96"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40341.1"
FT                   /translation="MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVE
FT                   TKPGRGFPRDWEDQDKWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAVGDYYEPYS
FT                   FDYAHLHNAPAGARHQPTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGL
FT                   DKQLYAQFEQTFMMYLPRLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMC
FT                   VSACPYKKIYYNWKSGKSEKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPA
FT                   AAAEEDPQALYDAQMKIFLDPNDPDILAQARRDGISDEILAHAQRSPVYRLIKEWRLAL
FT                   PLHPEFRTLPMVWYVPPLSPIRFDDASLAEPHDIRLAELAQMRIPIDYLANLLCAGNRK
FT                   PVEAALTRLIALRHYRRSLLSPQAPQWLQQADLSAPQAEAMYRLLALAPYHERFVIPTG
FT                   MHRPGSDREYIEHGSCGFSFNTPHDTDGTNLTGYRPDDRLVINTHSKE"
FT   gene            complement(255722..259393)
FT                   /locus_tag="ETAF_0219"
FT   CDS_pept        complement(255722..259393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0219"
FT                   /product="Respiratory nitrate reductase alpha chain"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40342"
FT                   /db_xref="GOA:A0A0H3DQN1"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQN1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40342.1"
FT                   /translation="MSTFLKKIRYFTAGKPMAANAHELYLQDSSDWEQSYRSRWQYDKV
FT                   VRSTHGVNCTGSCSWKIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIY
FT                   SANRIKYPLMRRALLDLWREQRAQHPDAVDAWQAILDNPELSQRYKRERGMGGLVRVSW
FT                   QEANELIAASNVATVKRFGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYC
FT                   DLPPSSPQTWGEQTDVPESADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAV
FT                   SADYAENCKFADEWLAPRAGTDAALALALGQVILQQFYLQQPCDYFIRYAKRFTDFPML
FT                   VMLTPCAGQENTYQSGRYLRAADLATWQDQPLAQWKTLAFDQDSQQIVIPRGSAGFRWD
FT                   QGGQWNTVQQDALSGAAIDPLLSLQTLGEDEVCVVQPDFSHDNANDRYTLGQVPVHWIT
FT                   TTRGERVAVATVFDLMLAHYGLRPRAGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEF
FT                   ATNARITHGRSLIIVGAGINHWFHSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLR
FT                   PLAGWAPVALAGDWQSPARLMNGTSFFYNHTSQWRYENVDAHTLLSPLAERDQFPHSLI
FT                   DFNVIAERLGWLPSSPQLDRNPLTLAAEAADGDVKAEVAQALKQGTLRIASEDPDAPGN
FT                   YPRVLFVWRANLLGSSSKGHEYFLKHLLGTRHGVMEQDLQQKGLPLPQQVAWRDSVEGK
FT                   LDLLVTLDFRMSTTCLYSDVILPSATWYEKEDLSSTDMHPYVHPFTRAIDPMWEARSDW
FT                   EIFKGIARQFSALCAGHLGKERDVMLTPLLHDSPAELGQACGVSDWKNDPQTFVAGKTA
FT                   PAIAVVERDYPQTYFKYTHLGPALAAHGNGGKGVHWDTRPEIDSLCARHGSETLDGVGP
FT                   CANMQDATQALETILTLAPETNGQVADRAWRDLAAKTGQQEIADLAADKKGVHYRFADI
FT                   QRQPGRVIASPLWSGIDSDRHAYTAGSLNITHAVPWRTLTGRQQAYQDHAWMQAFGEGF
FT                   ACYKPPLDTQSCRSVREHTANGQPELVLNFGTAHQKWGIHSTYTDNQIMQTLSRGGPLI
FT                   WISEHDAQRGAIADNDWVELFNGNGAMVARAVVSQRIPAGLALMYHAQERTLNMPLSEV
FT                   TGERGGIHNSITRICPNPIHMIGGYAHLSWGYNYYGTIGSNRDETVIIRRLNRVEWD"
FT   gene            complement(259412..260794)
FT                   /locus_tag="ETAF_0220"
FT   CDS_pept        complement(259412..260794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0220"
FT                   /product="Nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40343"
FT                   /db_xref="GOA:A0A0H3DM19"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM19"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40343.1"
FT                   /translation="MSNQPLESQNARVLKNWDPEDETFWNATGNSIAKRNLWVSVFCLV
FT                   LAFCIWMVFSSVVIKLNHIGFDFTTNQLFWLAALPSISGALLRIPFSFVVPIFGGRRWT
FT                   TISTALLLIPSIWLGFAIQDPQTSFYSFACIAILCGIGGGNFASSMANISFFFPKRLQG
FT                   YGLGINGGLGDGGIGVVQLCVPLVIGIGLFGSLGGAPQHVDYNTMIWLQNAAFLWVPFI
FT                   IIACLLSWFMMNDIAGMQSSLSSQFVILGKKDTWITSLIYLATFGSFVGFSAGFALLTK
FT                   TQFPDIDIIDYAFVGPLLGAIARPIGGRLSDKFSGYRITQVAFFFMIIFSLLIVPTLPS
FT                   EHSSGSFILFYIVFMGLFIFTNLGSGSSFQLISQIFHQKSAQEAQQQGMQGKHVDQYAD
FT                   VMSSAALGFTSAIGAFGGFIIPKTFGSAITLTHSVLLPLVCFSVFYLLCMGVTWLSYGR
FT                   HH"
FT   gene            complement(261139..261300)
FT                   /locus_tag="ETAF_0221"
FT   CDS_pept        complement(261139..261300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40344"
FT                   /db_xref="GOA:A0A0H3DMG2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40344.1"
FT                   /translation="MDIADDATLIYGKKIIILIFINISFIQSHGAVLINLCGKKSCHIA
FT                   PYYIDISH"
FT   gene            261825..263279
FT                   /locus_tag="ETAF_0222"
FT   CDS_pept        261825..263279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0222"
FT                   /product="Citrate Succinate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40345"
FT                   /db_xref="GOA:A0A0H3DP73"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP73"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40345.1"
FT                   /translation="MKKGYSILIPFIVGGALACLPAPAGLSHHAWLYFSIFIGSIVGLI
FT                   IEPLPGAVIGLIAIVIIAGLGRWVLFSPEQVALPHFHAASAAFKWAVSGFSNSTVWLIF
FT                   SAFMFALGYEKTGLGRRISLLLVKSLGRRSLTLGYAIAIADLVLAPFTPSNTARSAGTI
FT                   YPVISNLPPLYDSKPNDPSARRIGSYLMWVSISITCVTSSMFLSALAPNLLSSALINQM
FT                   TGLQISWGSWFIAFLPCGIVLWLLTPLLGYWLYTPEVKINDEVPKWAKQELENLGGLSR
FT                   REKLLLLFVALALLLWVFGGGLINSAIAALLVIALMLITNVISWDDVIGNKAAWNTLFW
FT                   FGTLVSLASGLSTVGFVHWFGLVISHYLNGMSVAVASVSLLLCFYLLHYFFASTTAHAT
FT                   ALIPVMIAAAMDIHGINMMEFSLAISLSLGIMGIITPYGTGPSPIYFGSGYLPSKDFWR
FT                   LGAIFGLVNLLAYLFICLPWINYLYR"
FT   gene            complement(267155..267230)
FT                   /gene="trnF"
FT                   /locus_tag="ETAF_3231"
FT   tRNA            complement(267155..267230)
FT                   /gene="trnF"
FT                   /locus_tag="ETAF_3231"
FT                   /product="tRNA-Phe"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            268159..269178
FT                   /gene="speF2"
FT                   /locus_tag="ETAF_0223"
FT   CDS_pept        268159..269178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speF2"
FT                   /locus_tag="ETAF_0223"
FT                   /product="Ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40346"
FT                   /db_xref="GOA:A0A0H3DPA1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPA1"
FT                   /protein_id="ADM40346.1"
FT                   /translation="MNSLKIAVSLNVIAYFNTSRTTVDINDSDLTDVAAVVLSVQDALG
FT                   GALDKVEQSAFGLPVFVAEACDQRLPAEYLPRLTGVFACGDGNQDFYGKQLESAAQKYE
FT                   AELLPPFFGSLQAYVQQGNAAFDCPGHQGGQFFRRHPTGRQFFDYFGEALFRADLCNAD
FT                   VSMGDLLIHEGAPCAAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLAPGDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFEEKYLRDLVRDVAPARAGERR
FT                   PFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMKECSRCCWS"
FT   gene            269154..270320
FT                   /gene="speF"
FT                   /locus_tag="ETAF_3339"
FT   CDS_pept        269154..270320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speF"
FT                   /locus_tag="ETAF_3339"
FT                   /product="Ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40347"
FT                   /db_xref="GOA:A0A0H3DTJ6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DTJ6"
FT                   /protein_id="ADM40347.1"
FT                   /translation="MLPLLLELNENDPGILVTQSVHKQQAGFSQTSQIHKKDRHIKGQA
FT                   RYVNHKRLNNAFMMHASTSPFYPLFAALDVNARMHAGDSGKRMWMECVRVGIETRKLLL
FT                   QTCQHIRPFVPETVDGRPWGAFDTEEMANDLRFFNFIPGERWHAFEGYAEHQYFVDPCK
FT                   LMLTTPGIDAKSGEYQSFGVPATILANFLRENGIVPEKCDLNSILFLLTPAEDMAKMQH
FT                   LVAQIARFERLLEQDAPLAEVLPSIYRANEARYRGYTLRQLCQEMHDLYVSHDVKQLQK
FT                   EMFRKAHFPRVVMNPQQANIEFVRGNVELVSLARAEGRIAAEGALPYPPGVLCVVPGEI
FT                   WGGSVQRYFLALEEGINRLPGFAPELQGVYIQQDEDGRKRAYGYVIKQ"
FT   gene            270433..271728
FT                   /gene="potE"
FT                   /locus_tag="ETAF_0224"
FT   CDS_pept        270433..271728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="ETAF_0224"
FT                   /product="Putrescine/proton symporter, putrescine/ornithine
FT                   antiporter PotE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40348"
FT                   /db_xref="GOA:A0A0H3DM22"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM22"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40348.1"
FT                   /translation="MGVVQLTILTAVNMMGSGIIMLPTKLAEVGTISIVSWLVTAVGSM
FT                   ALAYAFAKCGMYSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAIAISAVGYGT
FT                   ELIGASLSPMGICLATIGVLWLCTAANFGGARITGRISSVTVWGVIIPVVGISVIGWFW
FT                   FSPTLYVDSWNPHHLPTFEAIGSSIAMTLWAFLGLESACANTDVVENPERNVPIAVLGG
FT                   TLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGMAFAQMFDPTVGKIIMALMVMSCCGSL
FT                   LGWQFTIAQVFKSSADEGYFPAIFRRVTQSGAPVKGMLAIVAIQSVLSLMTISPSLNAQ
FT                   FNVLVNLAVVTNLIPYILSMAAVLIIQRVAGIDPAKARLPNILAFVGAMYSFYALYSSG
FT                   EQAMMWGAIATFLGWTLYGFVSPRFEMRDRQV"
FT   gene            271847..272293
FT                   /gene="nikR"
FT                   /locus_tag="ETAF_0225"
FT   CDS_pept        271847..272293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikR"
FT                   /locus_tag="ETAF_0225"
FT                   /product="Nickel responsive regulator NikR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40349"
FT                   /db_xref="GOA:A0A0H3DMG9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014160"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40349.1"
FT                   /translation="MMQRVTLSLDDDLMAEIDAIMKARNYQNRSEAIRDLARAGLQSMT
FT                   EAPSQSSHCVAALFYVYDHESRELSKRLTRTFHDHHDLSLASLHVHLDHGRCLEVSLLK
FT                   GAGGEVTRFAEQVIAERGVRHGKLVVVPGDDGEAHAHPHLHAHD"
FT   gene            complement(272309..273388)
FT                   /locus_tag="ETAF_0226"
FT   CDS_pept        complement(272309..273388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0226"
FT                   /product="Membrane-bound lytic murein transglycosylase C
FT                   precursor"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40350"
FT                   /db_xref="GOA:A0A0H3DP77"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP77"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40350.1"
FT                   /translation="MKKVLALALIAPLLISCSGKKPDSNGEEYIKDTNGFDILMGQFAH
FT                   NIENIWGINEVLIAGPKDYVKYSDRYLTRSHINFETGQITIETIATLDPAESLRQAIVT
FT                   TLLMGDDPGAIDLYSDANDIKPSREPFLYGQVLDNTGQPIRWSGRANSFASYLLQNKLM
FT                   KRTSGLHVIYSVTIQLVPNHLDKRAHKYLGMVRRASERYGVDESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVMQHTAGKDVFVSKGKWGTPSRSYLFDPEKNIDTGTAYLAILQNTYL
FT                   GGIQNATSRRYAVITAYNGGAGSVLRVFSSDKGQAVSIINQMSPGDVYEALTQRHPSAE
FT                   SRRYLYKVNSTQKNYRRIR"
FT   gene            complement(273436..273708)
FT                   /gene="yggX"
FT                   /locus_tag="ETAF_0227"
FT   CDS_pept        complement(273436..273708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggX"
FT                   /locus_tag="ETAF_0227"
FT                   /product="YggX"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40351"
FT                   /db_xref="GOA:A0A0H3DPA7"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPA7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40351.1"
FT                   /translation="MSRTVFCTFLNREAEGLDFQSYPGDLGKRIYDHISKEAWGQWMAK
FT                   QTMLINEKKLNMMNPDDRSLLALEMEKFLFEGHDVHIEGYTPPSQ"
FT   gene            complement(273711..274799)
FT                   /locus_tag="ETAF_0228"
FT   CDS_pept        complement(273711..274799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0228"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40352"
FT                   /db_xref="GOA:A0A0H3DQP2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQP2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40352.1"
FT                   /translation="MMQAQQFAHAVLAWYARFGRKTLPWQHPKTPYRVWLSEVMLQQTQ
FT                   VATVLPYFQRFTQRFPDVQALAAAPLDEVLHLWTGLGYYARARNLHKAAQLIVSQHHGE
FT                   FPQDFEQVAALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAIPGWPGRKEVET
FT                   RLWQLSGEVTPADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGSWADFPG
FT                   KKPKQTLPERQAYLLLLQHGETVWLQQRPASGLWGGLFCFPQYDSEAALRAQLYRLGQD
FT                   PDAAQTLTAFRHTFSHFHLDIIPVWSAYTTASACMDEGDGLWYNLAQPPSVGLAAPTER
FT                   LLQQLRKQPPASATAGDATEKE"
FT   gene            275089..275805
FT                   /locus_tag="ETAF_0229"
FT   CDS_pept        275089..275805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0229"
FT                   /product="tRNA (guanine46-N7-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40353"
FT                   /db_xref="GOA:A0A0H3DM26"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM26"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40353.1"
FT                   /translation="MNDVITAEFDENGRAIRRIRSFVRRQGRLTKGQQLALEQHWPLMG
FT                   VEFTPEALDLPALFGRQAPVVLEIGFGMGASLVAMAQQHPERDFLGIEVHSPGVGACLS
FT                   SAHEAGVNNLRVMCHDAVEVLERMIPDGSLDMVQLFFPDPWHKARHHKRRIVQPAFAER
FT                   IRGKLKIGGVFHMATDWENYAEHMLEVMNHAPGYRNLSDDNTYVPRPDSRPVTKFELRG
FT                   QRLGHGNWDLMFERVE"
FT   gene            275805..276131
FT                   /locus_tag="ETAF_0230"
FT   CDS_pept        275805..276131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40354"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40354.1"
FT                   /translation="MAKNRSRRLRKKLHIDEFQEVGFSASWRFADGTPVETVDTLLDRL
FT                   IDEVIEPNGLAFDGSGYLRWEGLICLQQIGRCTDEQRQLVKGWLESQGMLDVVVSDLFD
FT                   VWWE"
FT   gene            276369..277256
FT                   /locus_tag="ETAF_0231"
FT   CDS_pept        276369..277256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0231"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40355"
FT                   /db_xref="GOA:A0A0H3DP82"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP82"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40355.1"
FT                   /translation="MDQVRPLLGQGRVANYIPALAEVAPDRLGIAVCTVDGRMFSAGDA
FT                   GERFSIQSISKVLSLTLAMHRYSEAEIWQRVGKEPSGQPFNSLVQLELEQGKPRNPFIN
FT                   AGALVVCDMLQSRLSAPRQRMLEVVRALSGSADICYDARVARSEFEHSDRNAAIAYLMK
FT                   SFGNFDNDVITVLHNYFHYCALRMNCMELARTFVYLANRGRALALDEPVIGERQARQIN
FT                   ALMVTSGLYDGAGEFAYRVGMPGKSGVGGGVVAVVPQEMIIAVWSPQLDSCGNSLAGIA
FT                   ALELLAQRIGRSIF"
FT   gene            277267..277995
FT                   /locus_tag="ETAF_0232"
FT   CDS_pept        277267..277995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0232"
FT                   /product="Putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40356"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPB4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40356.1"
FT                   /translation="MGKWGCSLLLLLTAAQAQAAWQCQVKPQDDIIISAQQVQIVGASG
FT                   NLQISRDGAVTRDGHPLALSADVRRQAETLQRDLRRDVPWIDQGVQTRLDRARGALDNI
FT                   IVEQLGSDSNVRHRLSTLDTQLKAQMNRVLEKRSDGYAFHHQAIAQVEKEGQTLVNQTL
FT                   GGVLQDSINEMGAKGLLKAGQSENPLQAVLGNLGGLQQSIRTEWDKQDNDLRAFGQQAC
FT                   ERVQALDTQRKALLKALPAS"
FT   gene            278088..279737
FT                   /locus_tag="ETAF_0233"
FT   CDS_pept        278088..279737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0233"
FT                   /product="periplasmic oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40357"
FT                   /db_xref="GOA:A0A0H3DQP8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQP8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40357.1"
FT                   /translation="MSSTLVMEGNDMKIKYNLFFGFGVFMFSLGAPLAAEVPPGVSLAA
FT                   AQTLTRNNGSEPASLDPHRSESDVEFNILRDFFEGLLTLDGEGHLRPGLAARWQHSEAG
FT                   RVWTFSLRPDLRWSNGEALTAQDLVFSWRRLIDPATASPYATFLVNMGIKNAAAIQEGA
FT                   LPPSALGVAAPDARTLRVTLDQPLSTFLPMMVHPTLVPLNPRVLARYGDKWTQPGHFVG
FT                   NGAYTLKQWVINERLVGERNPHYWDDAHTVIHQVVYLPIVSETAGVNRYRAGELDMTPL
FT                   PSALFASLKQSLGEQVQIFPKLGTYYYHFNTRRAPFDDVRVRQALNLGLDKEIIAQKVL
FT                   GQGQRPAWLFGSDDIGGMALRAPDYARWPRETRLARAKALLAEAGFGPGNPLRFTLLYN
FT                   TSEGHQRIAIAAASMWKKNLGVEATLNNQEWKSMLDTMRSGHFDVVRNAWVADYDDPAA
FT                   MLNTFRSGDSNNTPQYSNPRFDAVLAQASASQDPAARQRLFQQAEALLAEDVPTIPLYH
FT                   YVSVRLVKPYVGGYQPGNMDYLYSKDMYIRAH"
FT   gene            complement(279783..280913)
FT                   /locus_tag="ETAF_0234"
FT   CDS_pept        complement(279783..280913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0234"
FT                   /product="Coproporphyrinogen III oxidase,
FT                   oxygen-independent"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40358"
FT                   /db_xref="GOA:A0A0H3DM31"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM31"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40358.1"
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPQQAYVDHLLA
FT                   DLDQELPRVAGRPLSTLFIGGGTPSLLSGEALQRLLDGVRARLPLAADAEITLEANPGT
FT                   VEAERFSAYQRAGVNRISIGVQSFSADKLQRLGRIHGPQEAIAAARLATALGLRSFNLD
FT                   LMHGLPQQSQEEALDDLRQAIALNPPHLSWYQLTIEPNTLFGSRPPRLPDDDALWEIFE
FT                   QGDRLLRASGYQQYETSAYALPGRQCQHNLNYWRFGDYLGIGCSAHGKLTFADGRIERR
FT                   AKTRHPRGYMQGNYLDQRQQVAMAERPFEFFMNRFRLLEPAPRADFSAYTGVDEATIRP
FT                   QLEAALAQGYISETPSHWQVTPHGKLFLNSLLELFL"
FT   gene            complement(280906..281499)
FT                   /gene="rdgB"
FT                   /locus_tag="ETAF_0235"
FT   CDS_pept        complement(280906..281499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="ETAF_0235"
FT                   /product="Nucleoside 5-triphosphatase RdgB"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40359"
FT                   /db_xref="GOA:A0A0H3DMH6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40359.1"
FT                   /translation="MQHVVLATGNAGKVRELASLLTDFGLDIVAQSSLGIEGAEETGLT
FT                   FIENAILKARHAARLSGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDRANLEKLLH
FT                   ALRDVPAGQRQARFHCVLVYLRHADDPTPLVCHGVWEGEIADAPSGDGGFGYDPIFFVP
FT                   ALGCTAAQLSREQKRAISHRGQALQQLLDRMRHA"
FT   gene            complement(281581..281871)
FT                   /locus_tag="ETAF_0236"
FT   CDS_pept        complement(281581..281871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40360"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP85"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40360.1"
FT                   /translation="MSAVSREGDDWILRLYIQPKASRDLIIGLHGDELKVAITAPPVDG
FT                   QANAHLLKFIAKQFRVAKSRITLEKGELGRHKQLRISQPQQIPDAVAAALE"
FT   gene            complement(281868..282422)
FT                   /locus_tag="ETAF_0237"
FT   CDS_pept        complement(281868..282422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0237"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40361"
FT                   /db_xref="GOA:A0A0H3DPC0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPC0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40361.1"
FT                   /translation="MLTLTFLVKTLLDLYVMVLLLRIWMQWARSDFYNPLSQFIVKLTQ
FT                   PVVAPLRRILPPLGPIDSASLLLAFILMTVKYPLLLLIQSGSLSLSPYNLLFGLISVVK
FT                   SAGYLVFWVIIIRSIMSWISQGRSPMDYVLYQLTEPMMAPIRRIIPAMGGLDFSAMVVI
FT                   LVLYLLNYLGIDLFGQLWFLL"
FT   gene            complement(282528..283238)
FT                   /locus_tag="ETAF_0238"
FT   CDS_pept        complement(282528..283238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40362"
FT                   /db_xref="GOA:A0A0H3DQQ3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQQ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40362.1"
FT                   /translation="MNTTIKHNLDAVRQHLVRAAEQCGRDPRDITLLAVSKTKPIEDID
FT                   AAIAAGQRAFGENYVQEGVSKIQHYRQQPQGDALEWHFIGPLQSNKSRPVAEHFDWIHT
FT                   VDRVKIAQRLNEQRPAELEPLNVLIQVNISDEQSKSGITLEQIDALADAISQLPRLRLR
FT                   GLMAIPAPEDDPARQLAVCTRMAQALSALQRRYPQLDTLSLGMTHDMEAAITAGSTLVR
FT                   IGTAIFGARDYGTA"
FT   gene            complement(283409..283831)
FT                   /locus_tag="ETAF_0239"
FT   CDS_pept        complement(283409..283831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0239"
FT                   /product="Putative Holliday junction resolvase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40363"
FT                   /db_xref="GOA:A0A0H3DM35"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM35"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40363.1"
FT                   /translation="MNPRTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGAPDWQQ
FT                   IEKVLREWQPDLVVVGLPLNMDGSEQPLTQMARKFANRLHGRFGVQIALQDERLSTVEA
FT                   RAHLFAGGGYRALEKGRVDAASAALILESWFEHQTY"
FT   gene            complement(283831..284394)
FT                   /gene="yqgE"
FT                   /locus_tag="ETAF_0240"
FT   CDS_pept        complement(283831..284394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgE"
FT                   /locus_tag="ETAF_0240"
FT                   /product="YggE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40364"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40364.1"
FT                   /translation="MKLAHHFLIAMPAMQDSRFKRTVIYVCEHNEDGAMGMIINKPLEQ
FT                   LTLSSLLEKLDITPSPRDAAIRLDKPVLAGGPLAEDRGFVLHSPTDTFGSSADIGPGCM
FT                   LTTSRDVLETLGTDRQPQEILVTLGYCSWSKGQLEQELLDNAWLTVEADSQILFHTPLA
FT                   DRWICAAKKLGVDIRNMPCNAGHA"
FT   gene            complement(284622..285572)
FT                   /locus_tag="ETAF_0241"
FT   CDS_pept        complement(284622..285572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0241"
FT                   /product="Glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40365"
FT                   /db_xref="GOA:A0A0H3DP92"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP92"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40365.1"
FT                   /translation="MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGYQLHYMEMDSLYL
FT                   QQGEARAQTRLLSVSDDKASWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILER
FT                   AEARGTLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDVILKPLD
FT                   GMGGASIFRIQQDDPNLSVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVIDGEPVPYC
FT                   LARIPKSGETRGNLAAGGRGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTE
FT                   INVTSPTCAREIEAAFPVSITGMLMDAIEARLAAR"
FT   gene            complement(285605..286336)
FT                   /locus_tag="ETAF_0242"
FT   CDS_pept        complement(285605..286336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0242"
FT                   /product="Ribosomal RNA small subunit methyltransferase E"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40366"
FT                   /db_xref="GOA:A0A0H3DPC7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPC7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40366.1"
FT                   /translation="MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDG
FT                   SNRVFDAEIISADKKSVRVRLNHVQEADRESPLHLHLGQVMSRGEKMEFTIQKSIELGV
FT                   SVITPLISERCGVRLDAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPAMDLEAWCAEE
FT                   DDCLRLNLHPRASASINTLPQPLTRVRLLIGPEGGLSAAEIAMTADYRFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            complement(286440..287153)
FT                   /locus_tag="ETAF_0243"
FT   CDS_pept        complement(286440..287153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0243"
FT                   /product="Endonuclease I precursor"
FT                   /EC_number="3.1.21.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40367"
FT                   /db_xref="GOA:A0A0H3DQQ9"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQQ9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40367.1"
FT                   /translation="MSPKSFIALSTLLGSLLLTSGAQAETIHNFSQAKAAAVKINRDAP
FT                   GTFYCGCRIDWQGKKGTPDLASCGYQVRKNAHRAERIEWEHVMPAWQFGHQLQCWQEGG
FT                   RKNCAKNPNYVRIETDLHNLQPAIGEVNGDRNNFAFSQWRGGEGQYGQCTMKVDFKNKQ
FT                   AEPPERARGAIARTYFYMRDRYHIRLSPQQTRLFEVWDRQYPVSDWECQREARVAAVQG
FT                   NHNPYVQQACAARKP"
FT   gene            complement(287268..287795)
FT                   /gene="sprT"
FT                   /locus_tag="ETAF_0244"
FT   CDS_pept        complement(287268..287795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sprT"
FT                   /locus_tag="ETAF_0244"
FT                   /product="SprT"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40368"
FT                   /db_xref="GOA:A0A0H3DM40"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM40"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40368.1"
FT                   /translation="MLAAMNTPRLPIALQQAVMHTLRRCLSLAEQRLNQPLPLPQIDYR
FT                   QRGTVAGTAWPQQWQIRLNPVLLQENGQAFIDSVIPHELAHLLVYRRFGRVAPHGREWR
FT                   WMMAEILGVEPQRTHRFSVDSVRGRTFTYRCACQQHQLTLRRHNRVQRGESSYRCRQCG
FT                   AALSFTPDATPA"
FT   gene            288157..289476
FT                   /gene="cadB1"
FT                   /locus_tag="ETAF_0245"
FT   CDS_pept        288157..289476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadB1"
FT                   /locus_tag="ETAF_0245"
FT                   /product="Lysine/cadaverine antiporter membrane protein
FT                   CadB1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40369"
FT                   /db_xref="GOA:A0A0H3DMI0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40369.1"
FT                   /translation="MASVKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAVWGWLI
FT                   ALVGAVSLAYVYARLATKNPQEGGPVAYAGEVGAAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPVLNSPVPAGIACIAIVWIFTFVNMLGGAWVSRLTTLGLVLVLIPVIGTGI
FT                   AGWFWFEPTTYMANWNTSGGTDYHAIIKSILLCLWAFIGVESASVSTGMVKDPQRNVPL
FT                   ATMMGTFLAGIVYIAATQAIAGMYPAHQMAASGAPFAISASTMVGSWAGPVVSAFTAFA
FT                   CLTSLGSWMMLVGQAGARAAHDGNFPKIYGELDKNGLPKKGLFLAALKMTVLMVLITVM
FT                   NASGGKASDLFGELTGIAVLLTMLPYFYSCIDLIRFDGANIKNVLSLLASILGCVFCFI
FT                   ALMGANSIELSGTFIVSLIILMFYSRKLGSAQDKGSAPRT"
FT   gene            289550..291700
FT                   /locus_tag="ETAF_0246"
FT   CDS_pept        289550..291700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0246"
FT                   /product="Lysine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40370"
FT                   /db_xref="GOA:A0A0H3DP97"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP97"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40370.1"
FT                   /translation="MNIIAIMNDMSAYFKEEPLRELQQELEKAGFRIAYPHDRNDLLKL
FT                   IENNARLCGVIFDWDKYNLALCEEISALNKMLPIYAFANTYSTLDVSMSDLRLNVRFFE
FT                   YTLGSAQDIALKIRQSTDQYIDAIMPPLTKALFKYVHEEKYTFCTPGHMGGTAFEKSPV
FT                   GTLFYDFYGENTLRSDISISVAELGSLLDHSGPHREAEEYIARTFNADRSYIVTNGTST
FT                   ANKIVGMYSSPAGASILIDRNCHKSLTHLMMMSSVVPLYLRPTRNAYGILGGIPRQEFT
FT                   REAIEEKVRNTPNATWPVHAVVTNSTYDGLFYNTDYIKQTLDVKSIHFDSAWVPYTNFH
FT                   PIYQGKAGMSGERVPGKVIYETQSTHKLLAAFSQASMIHVKGIINEETFNEAYMMHTST
FT                   SPHYGIVASAEMSAAMMKGNTGKRLIANSIERAIRFRKEIKRLRTESEGWFFDVWQPDN
FT                   IDEVACWPLNSRNDWHGFKNIDDDHMYLDPIKVTLLTPGMKADGTMDSWGIPASIVSKY
FT                   LDEHGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRVYDLNLRVKNVLPSLYQE
FT                   APEFYENMRIQELAQGIHTLTSESRLPDLMYSAFDVLPTLVLTPHDAFQEEVRGNIESC
FT                   PLQQMIGRVSANMILPYPPGVPLIMPGEMITEASKPVLDFLQLLCDIGAHYPGFETDIH
FT                   GVQCNGKGEYEVVVLKNHGAQG"
FT   gene            complement(291774..292934)
FT                   /locus_tag="ETAF_0247"
FT   CDS_pept        complement(291774..292934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0247"
FT                   /product="glutathionylspermidine synthase-like protein"
FT                   /EC_number="6.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40371"
FT                   /db_xref="GOA:A0A0H3DPD4"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPD4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40371.1"
FT                   /translation="MKRIAISERPDWRAKASEFGFQFHTMYGEPYWCEDAYYQFSMAQV
FT                   EALEQTTAELHQMCLQVVEKVVDSEALLSRFQIPKHTWDFVRASWRSGQPSLYSRLDLA
FT                   YDGQGPAKLLENNADTPTSLYESAFFQWIWLEDQVRAGKLPAAADQFNSLQEQLIARFA
FT                   ELKANHGFQLLHMACCQDSDEDRGTVQYLQDCAAEAGLATEFLYMDEIGLGEKGQFTDP
FT                   QDQVISNLFKLYPWEFMLREIFSTKLEDAGVRWLEPAWKSILSNKALLPMLWEMFPNHP
FT                   NLLPAYFADGSQPPLDRYVVKPLFSREGANIRIVENGQEIERVDGPYGEEGMIVQQYHP
FT                   LPQFGDSYTLIGSWLVNDSPAGIGLREDRSRITQDLSRYYPHIILD"
FT   gene            complement(292938..293615)
FT                   /locus_tag="ETAF_0248"
FT   CDS_pept        complement(292938..293615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0248"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40372"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQR6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40372.1"
FT                   /translation="MKRTKHINRSAFRKRWQMAPLALAVSAVFLLAGCEKSDETVSLYQ
FT                   NADDCSKANPSMSAQCKTSYDDALKEAAKTAPKYATREDCIAEFGEGQCTQTPAQAGMA
FT                   PTTGNTNAEAAQSGGSFWMPLMAGYMMGRLMGGGFNQQPLFTPRGAASPANGQFVDASG
FT                   KSYGPATAGGRTMNVPKTAMAPKPATTTTVTRGGFGETVAKQNSLQRSSASGTGTGSRS
FT                   MGG"
FT   gene            complement(293785..294522)
FT                   /locus_tag="ETAF_0249"
FT   CDS_pept        complement(293785..294522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0249"
FT                   /product="L-fucose operon activator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40373"
FT                   /db_xref="GOA:A0A0H3DM46"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM46"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40373.1"
FT                   /translation="MKHDRHQAIVQLVAEHGTLSTEALAQRLDVSRETIRRDLNTLQKQ
FT                   GKIVRRHGRATGLGGETQDSGDPFNARLKSHLSGKAEIARQALEWIDSGMTLALDASST
FT                   CYYLAKQLPDVEITVFTNSLRICQALAKRQRIQLISSGGLLQRKYACYVNPAILSQLKA
FT                   LEIDLFIFSCEGIDGRGGLWESNAYNADFKALLLKRAAQSLLLIDKSKFNRAGEIQIGT
FT                   LDDVAQVISDMHDDDASLPDGGV"
FT   gene            complement(294577..294999)
FT                   /locus_tag="ETAF_0250"
FT   CDS_pept        complement(294577..294999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0250"
FT                   /product="L-fucose mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40374"
FT                   /db_xref="GOA:A0A0H3DMI5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="InterPro:IPR023751"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40374.1"
FT                   /translation="MLKNISPLISPQLLKTLAEMGHGDEIIFADAHFPAHAMGPQVIRA
FT                   DGLSVSDLLAAIIPLFELDSYAPPLVMMAAVEGDTLDPAVEARYLTALFADAPAQPVTR
FT                   IDRFAFYQRAQQAFAIVITGERAKYGNILLKKGVTP"
FT   gene            complement(294993..296456)
FT                   /locus_tag="ETAF_0251"
FT   CDS_pept        complement(294993..296456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0251"
FT                   /product="L-fuculokinase"
FT                   /EC_number="2.7.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40375"
FT                   /db_xref="GOA:A0A0H3DPA3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013450"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPA3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40375.1"
FT                   /translation="MTHDVVLVLDCGATNVRAIAVDAHGNVVAQAAQANASQAGAEDAR
FT                   WHVWSLEAILQRFADCCRQIAPQLANARIHALTVTTFGVDGALVDRHGELLYPVISWKC
FT                   PRTTAEMEGIERYISAETLQTLSGIGQFSFNTLYKLLWFKHHHPELLEKAHAWLFISSL
FT                   INQRLTGEFTTDRTMAGTSQLLDVRNELFSDTILRSTGLRSDLFPRMVAAGEHIGHLLP
FT                   TMAQFLGLPTGIPVIAAGHDTQFALFGSGAGLEQPVLSSGTWEILMVRTPQVNTALLPQ
FT                   HRGSTCELDSCQGLFNPGLQWLASGVLEWIRQLYWPDAARQEAYRSMIAEAAAVAPGCD
FT                   GLRMNSQLLLSDGRAGWQGVTLNSGRGHFYRSALESLGWQLRHNLHTLQTLGGFQAQSL
FT                   LLVGGGSRNALWNQIKADILGIPVRVLANAETTVLGAALFAWSGAGYYASADRAREAVT
FT                   FTYHDYIPGEQRAQYQALQPTAPIRSHTC"
FT   gene            complement(296505..298286)
FT                   /locus_tag="ETAF_0252"
FT   CDS_pept        complement(296505..298286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0252"
FT                   /product="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40376"
FT                   /db_xref="GOA:A0A0H3DPD9"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPD9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40376.1"
FT                   /translation="MNKQHSLPKVGIRPAIDGRRMGVRESLEAQTMEMAQATARLISEQ
FT                   LRHPCGAPVECVIADTCIAGMAEAAACEEKFSRSNVGLTITVTPCWCYGSETIDMDPLR
FT                   PKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDSGDDSIPADVQQKLLRF
FT                   TRAGLAVAGIKGKSYLSLGGVSMGIAGSIVDHDFFESWLGMKVQAVDMTELRRRIDNQI
FT                   YDQDELALALEWADAHFRYGPDLNAEQYRRSPEENRRVLRESLLMAICIRDMMQGNPKL
FT                   AERGWEEEALGYNAVAAGFQGQRHWTDQYPNGDTAEALLNSAFDWHGVRRPLVVATEND
FT                   SLNGVAMLFGHMLTGTAQIFADVRTYWSPQAVERVTGQRLEGLAEHGIIHLINSGSAAL
FT                   DGTCRQQDAEGHPTIKPHWQISQQEADACLAATEWCPAIHEYFRGGGFSSRFLTRGGVP
FT                   FTMSRVNLIKGVGPVLQIAEGWSVELPEEMHDILDNRTNATWPTTWFVPRLTGNGPFKD
FT                   VYSVMANWGANHGVLTIGHVGADLITLASMLRIPVCMHNVTDDAIYRPSAWAAHGMDSE
FT                   GQDYRACQNYGPLYKRA"
FT   gene            complement(298375..299679)
FT                   /locus_tag="ETAF_0253"
FT   CDS_pept        complement(298375..299679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0253"
FT                   /product="Fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40377"
FT                   /db_xref="GOA:A0A0H3DQS0"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQS0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40377.1"
FT                   /translation="MSDITSKSTSAGNIASAAQRIAVVPKNILIPFVLLTSCFALWGLA
FT                   NNMTDVLIAQFRKVFTLTDMQSGLVQTAFYGAYFCLALPAALFIKRFSYKAGVLLGLGL
FT                   FCSGALLFYPASQIMAYGPFLLALFILAGGLSILETSANPYIIAMGPQETATRRLNLAQ
FT                   SFNPIGSITGVLIGKFYILAQLNPATDAERTVMDPDALASIQSAELSAVMGPYVVVALV
FT                   IIMVWLAIAFTRMPVAHDSSSAESTLKQSFSRLLSKGYFVRGVVGQFFYVGAQIGCWSY
FT                   TIRYVMAEMGGNEAEASTYLLLSIVLFSAFRFVCTALMKFVSPAILLGLLASLASASLL
FT                   LVMFVGGIAGVYGLVAVSACMSLMFPTIFGLSVHGLGKDTQFGGSCLIMAILGGAVLTA
FT                   LMGQISDMAGIRMAFLIPLLGFVYLIHFGFKGHRA"
FT   gene            300698..301345
FT                   /locus_tag="ETAF_0254"
FT   CDS_pept        300698..301345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0254"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40378"
FT                   /db_xref="GOA:A0A0H3DM51"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004782"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM51"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40378.1"
FT                   /translation="MERETLARAIIDTCLEMTRLGLNQGTAGNVSVRYRDGMLITPTGI
FT                   PYEQLRCDQIVYVDGEGQHEEGKLPSSEWRFHLAAYQARPDANAVVHNHAIHCTAVSIL
FT                   NRPIPAIHYMIAAAGGNTIPCAPYATFGTRTLSDYVTEALKYRRATLLQHHGLIACGEN
FT                   LQKALWLAHEVEVLAQLYLATLAIVDPVPVLSDEEIAVVLEKFKTYGLRIEE"
FT   gene            301358..302506
FT                   /locus_tag="ETAF_0255"
FT   CDS_pept        301358..302506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0255"
FT                   /product="Lactaldehyde reductase"
FT                   /EC_number="1.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40379"
FT                   /db_xref="GOA:A0A0H3DMJ0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40379.1"
FT                   /translation="MAHRMILNETAWFGRGAIAELPAEIQRRGYRKALIVTDATLVACG
FT                   AVARVTKHLDSAGLAYALFDGVVPNPTIRVVQQGLAVFRDSGADYLIAIGGGSPQDTCK
FT                   AIGIISNNPAFEDVRSLEGLSPTTRPSVPILAVPTTAGTAAEVTINYVITDEEQRRKFV
FT                   CVDPHDIPQAAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHLKAIE
FT                   MIGGALRASVNGDAEAGATMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANA
FT                   ILLPHVMRYNAGACGEKFRDIARALGVACDDLSLDQAAAAAIAAVEALNRDVGIPPSLR
FT                   EVGVCEEDIVRLAEAALADVCTGGNPRSATLRDIEQLYRQAY"
FT   gene            complement(302569..303138)
FT                   /locus_tag="ETAF_0256"
FT   CDS_pept        complement(302569..303138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0256"
FT                   /product="putative HdeD-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40380"
FT                   /db_xref="GOA:A0A0H3DPA9"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPA9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40380.1"
FT                   /translation="MIYFDRNRLLQLDPRFLKQQRVSLLILSLLLLLGGLFCLFRPLAS
FT                   GNALSAVVGILLLLSGVGLIIGMIANRANNLWPMIGGILMGAAYLVMGFIFIRSPEVGL
FT                   FTVAVLVATLFALGGIARLMAGVKLKGAHGGWLQVIIGLLDLLIAWMLISAGPQGSILL
FT                   VTMIVGIEMLFSSFSLFQVAQLLKQR"
FT   gene            303636..304457
FT                   /locus_tag="ETAF_0257"
FT   CDS_pept        303636..304457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40381"
FT                   /db_xref="GOA:A0A0H3DPE4"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPE4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40381.1"
FT                   /translation="MVSCLAVMCYLWHEDFNVNLTLGPFSLLGVAIAIFLGFRNNASYA
FT                   RFIEARVLWGSLLITTRSLMRQAISLMPHPGGEHRRFAMLLTAFSYALKHHLRHEPMAM
FT                   ELTRLLPSQDKAAVLGSCSPCNRLLQLMGQWLGEQRRRGYLSDIDFQTIDTNLNQLSVI
FT                   LGGCERISNTPIPFAYSLIVHRTVYVFCALLPFALVSDLHYMTPLVSVFISYTFIALDA
FT                   LAEELEDPFGIEANDLPLNAMAHTIEANLRDMINDHTHLARICPDSHCRLD"
FT   gene            complement(304526..305209)
FT                   /locus_tag="ETAF_0258"
FT   CDS_pept        complement(304526..305209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40382"
FT                   /db_xref="GOA:A0A0H3DQS6"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQS6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40382.1"
FT                   /translation="MSTAGPLTAQHYACLYAWLAGLFAHEADEAQLARLRSPDTQAWLD
FT                   LLCQQAPLRPALQHLQAALAALETRPDARLELAADFAGLFLLSQKRAALPYASCYQGET
FT                   PRFRQAICVEMQSLLRQAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPEHQESERM
FT                   QLRRTTLNLLLGWLPAFSARCVRYDPFGFYGALSQLLLALVQQDADLNAVERVSPAATP
FT                   GPIAG"
FT   gene            complement(305206..307755)
FT                   /locus_tag="ETAF_0259"
FT   CDS_pept        complement(305206..307755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0259"
FT                   /product="Trimethylamine-N-oxide reductase"
FT                   /EC_number="1.6.6.9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40383"
FT                   /db_xref="GOA:A0A0H3DM56"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011887"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM56"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40383.1"
FT                   /translation="MNHNESVRISRRRFLSQLGGLTALGMFGPSLLVSRDAQAQAGTAA
FT                   AGGVQEGILTGSHWGAIRATVVDGRFVAAKPFEKDSYPSKMVAGLPDHVHNTARIRYPM
FT                   VRIDWMRKRHLSDTRQRGDNRFVRVSWDEALDLFYQELERIQTTYGPSALLSGSGWQST
FT                   GMFHNAAGMMGRALALHGNSVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLKNS
FT                   KTIILWGSDLLKNQQANWWCPDHDVYQYYAQLKEKVANGEIRVVSIDTVVSSTHDYLGR
FT                   DKVQHIAVNPQTDVPLQLALAHTLYSEKLYDAHFLDNYTVGFDQFLPYLLGTQDGQPKD
FT                   AEWAAKLTGIDAETIRALARQMAAGRTQIIAGWCVQRMQHGEQWSWMIVVLAAMLGQIG
FT                   LPGGGFGFGWHYNGAGTPSRKGIILSGFSGATTIPPLHNSSDYRGASSTIPIARFIDAM
FT                   LEPGKKIDWNGKQVTLPALKMCVFAGTNPFHRHQQINRMIAGWQTLETVVAIDNQWTST
FT                   CRFADIVLPATTQFERNDLDQYGNHSNRGILAMKQLVPPQFEARSDFDIFRELCRRFNR
FT                   EQAFTEGLDEMGWIKRIYQEGAQQGKGRGIHLPTFDAFWNGSGYIEFDDPQLFVRHQAF
FT                   RDDPDLEPLGTPSGLIEIYSKSIADMHYGDCQGHPMWFEKAERSHGGPGSARFPLHLQS
FT                   VHPDFRLHSQLCESPTLRAHYSVGGREPVFISPQDADARGIRNGDIVRVFNDRGQVLAG
FT                   AVVSDRYVPGVIRIHEGAWYDPDRGGVAGALCKYGNPNVLTLDIGSSRLAQATSAHTAI
FT                   VEVEKYRGPLDPVTAFNGPQEMVAQCQYVPLQTEETP"
FT   gene            complement(307770..308927)
FT                   /gene="torC"
FT                   /locus_tag="ETAF_0260"
FT   CDS_pept        complement(307770..308927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torC"
FT                   /locus_tag="ETAF_0260"
FT                   /product="Functional role page for Cytochrome c-type
FT                   protein TorC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40384"
FT                   /db_xref="GOA:A0A0H3DMJ6"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40384.1"
FT                   /translation="MKNLWNRLNRPSARWSVLALLALGIVIGLALIVLPHVGIKLTSST
FT                   EFCVSCHSMQPVYQEYKQSVHFKNASGVRAECHDCHIPPDVPGMVKRKLEASNDIYQTF
FT                   IAHSIDTPEKFEAKRAELAEREWKRMKENNSATCRSCHNYDAMDHAKQHPEAAKQMAIA
FT                   AKDNQSCIDCHKGIAHQLPDMSSGFRKQFAELRQTASDDGNTLYTLDMKPIYAAKGDKE
FT                   PAGSLLPASEVTVLKRDGDWLQVQIEGWTETNGRQRVLSLLPGKRIFVSSIRDQVQQNA
FT                   KTLEKTTVAATGVEWSKLQTTAWVQKGDLVNNIKPIWAYADALYNGTCNQCHGAPEKAH
FT                   FDANGWIGTLNGMIGFTSLDKREERTLLKYLQMNASDTGGADQKH"
FT   gene            309059..309754
FT                   /gene="torR"
FT                   /locus_tag="ETAF_0261"
FT   CDS_pept        309059..309754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torR"
FT                   /locus_tag="ETAF_0261"
FT                   /product="Functional role page for TorCAD operon
FT                   transcriptional regulatory protein TorR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40385"
FT                   /db_xref="GOA:A0A0H3DPB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPB5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40385.1"
FT                   /translation="MAMTHHIVIVEDEPVTQARLRDYFVQEGYQVSVTASGAGLRELML
FT                   LQPVDVILLDINLPDENGLMLTRALRERSTVGIILVTGRCDRIDRIVGLEMGADDYVTK
FT                   PLELRELVVRVKNLLWRIDLARQAQPAADNCYLFAGYCLNVSRHTLTLDDEPIRLTRAE
FT                   YEMLLAFVTNPGAILSRERLLRMLSSHRVDSPDVRTVDVLIRRLRAKLRPDLFVTQHGE
FT                   GYFLAAEVA"
FT   gene            complement(309762..310796)
FT                   /locus_tag="ETAF_0262"
FT   CDS_pept        complement(309762..310796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0262"
FT                   /product="Periplasmic protein torT precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40386"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPE9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40386.1"
FT                   /translation="MYRRHTLFLCLLWLSTATAHADAPLLRWPSDRQSVQLRQPPLHAV
FT                   KRWKLCALYPSLKDAYWLSINDGMIRAADRLGVTLKVFEAGGYRQQATQREQMALCRDW
FT                   GADAILIGSSTARFPALATLAAGIPLIEVVNALHDPAIRTRIGVPWFQMGYQPGRYLAQ
FT                   RLGQRPLKVLLMPGPRDAGGSREMSDGFKAALSGSRLQIVDVAYGDNDIEVQRNLLQDM
FT                   LERHPDIDVVAGTAIAAEVAMGEGRNRATPLTIVSFYLSHQVYRGLKRGRILAAASDQM
FT                   VWQGELAVEQALRTLQGERVPDNVSPPILVLTQRNVSSALVRRSLSPLGFRPVYLYQPA
FT                   PKAE"
FT   gene            310876..313668
FT                   /gene="torS"
FT                   /locus_tag="ETAF_0263"
FT   CDS_pept        310876..313668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torS"
FT                   /locus_tag="ETAF_0263"
FT                   /product="Sensor protein TorS"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40387"
FT                   /db_xref="GOA:A0A0H3DQT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037952"
FT                   /db_xref="InterPro:IPR038188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQT1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40387.1"
FT                   /translation="MGTPSLTRRLWLAFALMAALTLGSVLVGWFSLHYVGRVEQANTQA
FT                   LLPTMNMARQLSEAGAYELFSAQSLSNADSEREWLAQGQMLTAQSLKISRLLDELRRQG
FT                   FDIDTIAQQETEITRSLGEQGALVGQRLQLRMRARALSAQVAAAAEQIAELAKGQASNA
FT                   ATAAGATQAGIYDLIEQRRAAAAEQALDRLIDIDLEYLNQMSELRLSALRVQQMIMALE
FT                   SDSGRLALSEQEERLAQALRILQRRQQRVEDPRIRAQIAQALGQVAQYRTLVDLYRQDN
FT                   DIYARLQALSQNNLDLFTRFSAEISRQVSDIELRNAAALEHLQQARRLGLTWLTLLGGA
FT                   GLLALCLILWRVVYRSLSQPLAHQTAALQRLLDGDFDSPFPDRAGVRELDTIGRLMEAF
FT                   RTSVRALRHQRQHLADLVQMRTAELQALVVEHRQARAEAENADRAKSAFLAAMSHEIRT
FT                   PLHGILGTAQLLAEQPISPQSRGYVQAINDSGESLLAVLNDVLDYSAIEAGSSSVVLND
FT                   EPFSPRQLLDSLLRLAEGRLRERPLRLAHDYADALPAWLQGDPRRIRQIVMNLLNNALR
FT                   FTERGVICVSCGCDETHWWIAVQDSGCGIDPAQQAAIFQPFVQLSARRGGTGLGLAICR
FT                   GLAQAMAGSLELSSTPGKGSRFCLRLPLRRAALPPPEAPAQAWSLVGRRLLLIEDNPLS
FT                   QRISAEMLQSAGVQVHIAGSAAEAQALLARDTAFDAALVDFDLPDSDGPTLARQMAEAY
FT                   PQLKRIGFSAHVLDEAQHRRIRPLFCGMIQKPVPRAELCRLIAHALADGEHSTVRPTRI
FT                   VRQIAAPLDDEQLAEDVATFGQPCLTEWLALFRQHSLPLLAEIAAARAAGDADQVKGLA
FT                   HRLKSSCASLGMRGVADACLALERAPLTAAALDEPIREGLAALEAWLAKVSESDDGKIT
FT                   "
FT   gene            313768..313908
FT                   /locus_tag="ETAF_0264"
FT   CDS_pept        313768..313908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40388"
FT                   /db_xref="GOA:A0A0H3DM61"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM61"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40388.1"
FT                   /translation="MWQLKRQAPALHKKTRRINLGWAIALLLLGGSMALAAVIYLIISA
FT                   L"
FT   gene            complement(314256..314331)
FT                   /gene="trnF"
FT                   /locus_tag="ETAF_3232"
FT   tRNA            complement(314256..314331)
FT                   /gene="trnF"
FT                   /locus_tag="ETAF_3232"
FT                   /product="tRNA-Phe"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            314930..315532
FT                   /locus_tag="ETAF_0265"
FT   CDS_pept        314930..315532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40389"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40389.1"
FT                   /translation="MFSTFTWAADAAPTAPASAAAAAAGLSAQQVQDVAKVAQQGFTAM
FT                   RDMQYARVALFRGYPDVATKLTDQSAGLLADDSTDWKSFIKSDKKAPLAGDNYVIINAS
FT                   IALSEDFVATPEKQKAIAKANEKLSKGDRKGALEELRLAGVGITETQYLMPLKQTRQAV
FT                   AHAQSLLKAGKYYEANLALKGAEEGIITDSVTLVDGK"
FT   gene            complement(315640..316215)
FT                   /locus_tag="ETAF_0266"
FT   CDS_pept        complement(315640..316215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0266"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40390"
FT                   /db_xref="GOA:A0A0H3DPC1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPC1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40390.1"
FT                   /translation="MQREHILTQALRRLEQHGLADATLPALIDSETLPLDQARRYWPDS
FT                   EALLYDCLRFHGQQIDTWRRQLLLNDTLSHDDKILARYPVLAEHVEQGRFPGCLFISAC
FT                   IQYPAADHPIHQLASRQKQASFDFTLHLLQESEIGDASLVAHQMELVQEGCLNRLLVSR
FT                   RREDVDIALHLAQDILHIAHCRRHDALS"
FT   gene            complement(316248..317966)
FT                   /gene="dsbD"
FT                   /locus_tag="ETAF_0267"
FT   CDS_pept        complement(316248..317966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="ETAF_0267"
FT                   /product="Cytochrome c-type biogenesis protein DsbD,
FT                   protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40391"
FT                   /db_xref="GOA:A0A0H3DPF3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPF3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40391.1"
FT                   /translation="MAQRIFALIALFITTLLPAQASLFGEQPRFVPVNQAFAFDFQQRG
FT                   EHLTLRWQIQPGYYLYRQQIRITPHQAQLGPWQLPPGIPHHDEFQGETAIFRDGLSLTL
FT                   PLLSAAAGGEISVTYQGCAAAGFCYPPETRRIPLEAITATAGALPSPGAATANTEHAPT
FT                   LPFPALWALLIGIGIAFTPCVLPMYPLISALILGQKQRHGWGHTALLALVYVQGMAITY
FT                   TVLGMVVAAAGLRFQAAFQHPYVLIGLSLLFILLALSMFGAFTLQLPASLQTRLTLWSN
FT                   RQRSGSLLGVFVMGALAGLICSPCTTAPLSAILLYIAQSGNLWVGGGTLYLYALGMGIP
FT                   LIAVTLFGNRLLPRSGPWMQHVKEGFGFVILALPVFLLERILGEAWGMRLWSLLGIAFF
FT                   LWGFSLSLHARRRGTRLWQILLLGAALICARPLQDWVFDGAPRASTGVNETLAFQPIDS
FT                   PQQLAQALAQAKARRQPVMLDFYADWCTACKEFEKYTFSNDAVRSQLAGTLLLQANVTA
FT                   NTEQHAQLLQQLNVLGLPSILFFTPDGQPLDNARVTGFMDAERFLAHLRQLPQAQ"
FT   gene            complement(317942..318310)
FT                   /gene="cutA"
FT                   /locus_tag="ETAF_0268"
FT   CDS_pept        complement(317942..318310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="ETAF_0268"
FT                   /product="Periplasmic divalent cation tolerance protein
FT                   CutA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40392"
FT                   /db_xref="GOA:A0A0H3DQT6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQT6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40392.1"
FT                   /translation="MSQTVTPFTAAAAVPVDHSDAVVVLCTAPDEACAQELAAALLGEK
FT                   LAACVTLIPGATSLYYWEGKLEQEYEVQMIIKSERRHQQALLAYLKHQHPYQTPELLVI
FT                   PVQAGDQDYLSWLNASLR"
FT   gene            complement(318447..319748)
FT                   /gene="dcuA"
FT                   /locus_tag="ETAF_0269"
FT   CDS_pept        complement(318447..319748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="ETAF_0269"
FT                   /product="C4-dicarboxylate transporter DcuA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40393"
FT                   /db_xref="GOA:A0A0H3DM67"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM67"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40393.1"
FT                   /translation="MLVLELVIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVAPGKI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVHQTEKVLRKNPKYITILAPIVTYLLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGIS
FT                   YLHLLMVVLPSTFLAVLVMSLIVSWCFDSKLSNDPVYRKRLEEGLITLRGDKQIEIKKG
FT                   AQTSVWLFLLGVVAVVAYAIINSPSLGLVAKPLMNTTNAILIIMLSVATLTTIICRVDT
FT                   DNVLNSSTFKAGMSACICILGVAWLGDTFVSANIDWIKETAGTVIQNHPWLLAVIFFFA
FT                   SALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGKLVFNHPFFIPGTLGVALSVCFGFLLGSVML"
FT   gene            complement(319864..321300)
FT                   /locus_tag="ETAF_0270"
FT   CDS_pept        complement(319864..321300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0270"
FT                   /product="Aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40394"
FT                   /db_xref="GOA:A0A0H3DMK7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40394.1"
FT                   /translation="MSNNIRIEEDLLGTREVPADAYYGVHTLRAMENFYISNDKISDIP
FT                   EFVRGMVMVKKAAALANRELQTIPRKIADTIILACDEVLNNGKCMDQFPVDVFQGGAGT
FT                   SVNMNTNEVLANIGLELLGHKKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASIMKL
FT                   IDAIKNLREGVDRKADEFKNILKMGRTQLQDAVPMTLGQEFHAFSVLLNEEVKNLQRTA
FT                   ELLLEVNLGATAIGTGLNTPEGYQKLAVQKLAEVSGLPCVPAEDLIEATSDCGSYVMVH
FT                   GALKRTAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQLC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESISLLTNGCYNLREKCIDGITANKE
FT                   TCEKFVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAQLDDIFS
FT                   VENLMHPAYKAKRYTDESEK"
FT   gene            321665..322141
FT                   /gene="fxsA"
FT                   /locus_tag="ETAF_0271"
FT   CDS_pept        321665..322141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="ETAF_0271"
FT                   /product="FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40395"
FT                   /db_xref="GOA:A0A0H3DPC6"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPC6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40395.1"
FT                   /translation="MRWLPFILIFFYVYIEISIFIKVAAVLGVALTLLLVILTSCLGAS
FT                   LVRNQGMKTLMQMQQKLAMGESPAAEMIKSVSLVMAGLLLLLPGFFTDFLGLLLMLPPV
FT                   QKRLALKLLPYFRIYRSGGPGDGGGPGGGPGGGGHTFDGEFERKDDDRQRLDNK"
FT   gene            322358..322651
FT                   /locus_tag="ETAF_0272"
FT   CDS_pept        322358..322651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0272"
FT                   /product="Heat shock protein 60 family co-chaperone GroES"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40396"
FT                   /db_xref="GOA:A0A0H3DPG0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPG0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40396.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVIAVGH
FT                   GRILENGDVKPLDVKVGDTVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            322711..324354
FT                   /locus_tag="ETAF_0273"
FT   CDS_pept        322711..324354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0273"
FT                   /product="Heat shock protein 60 family chaperone GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40397"
FT                   /db_xref="GOA:A0A0H3DQU0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQU0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40397.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANADDTVGQLIA
FT                   EAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGMELEKATLEDLGQAKRVVINKDTTIIIDGVGEES
FT                   AIQGRVTQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAAKLVDLKGINEEQNVGIKVALRAMEAPLRQIVANA
FT                   GEEPSVVTNNVKAGEGNYGYNAATEEYGDMIDMGILDPTKVTRSALQYASSVAGLMITT
FT                   ECMVTDLPKEEKADLGAAGMGGMGGMGGMM"
FT   gene            complement(324651..332738)
FT                   /locus_tag="ETAF_0274"
FT   CDS_pept        complement(324651..332738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0274"
FT                   /product="Large repetitive protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40398"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM73"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40398.1"
FT                   /translation="MTTDSKSATLNNNPTANNHIDNVKAFTVSGFDLVITFADGRVSTV
FT                   KDGLTDLVLGNIKLSDTTGSEITQSQVISSINTIQLGLDTVYLADKIEDKDKSTESETP
FT                   AQFSELPGVDEPAIEKIQQENLQKKISEYDELLKKQEDALREIVKEKDKVEQQKEIIDK
FT                   KVKSTLSTNLKPHEMDVQEAPPKPPIPPAPLSSSSSSASENASGKQNDVEAKPALSDLP
FT                   LFISGALDEKSDSGKIGDGLTNLTTPTFIGNATPGATATLTINGTPYPLTVDSEGKWAL
FT                   QIQPGLPDGAYDVTLNIVDGNGKTATTTIKITIDSQIDELTAMLDPDSDSGVANDAITN
FT                   NSKPILLGTAEPGAIIKVVIGSLTLTTITDAEGNWSVSPSSNLPDGSYDYIVTATDEAG
FT                   NSTTTQNTLTIDTTAPGIVFSLSAATDSGIAGDFTTNITQPVLTGSTEPGATIIVRLWG
FT                   NAYEIIADPQGNWELTINPALGDGNHEFTVQITDIAGNVSSQSGNLTIDTQAPTITASL
FT                   SSDSDSGSSQTDNITNNAHPVLTGYTKPLAVITITFAGEHYSVKADENGHWSWAIPENL
FT                   SLADGTHPYQLTVSDTAGNKLSTPYQGEFTLDTSPPEPPEPPTATLSDESNSGSLDDMI
FT                   TNVATPTLVGQSEPLAIIHVTIDGKTYQTQANETGEWHLLLDTLSDGTHTITVSAEDQA
FT                   GNISKPSGEMTLVIDTRTPEVTVTLAEGDDSGSSQSDGITAVNQPTFHGSATPNTTLLF
FT                   TINNHAYRIEVGADGQWRLPIDEPLADDSYHYTITVENAAGSTTTIDGTLVIDTTPPPA
FT                   DAGLDEASDSGRDPQDGITNVVKPTLTGHSEPGARVEITFNDTLYSQTSDADGMWSISL
FT                   KDSLSDGTYTYTVKTTDSAGNTSTAEHHFTIDTLSHVDARLDFTSAIPGDNDSTTDQIR
FT                   PKLSGKAEPGSLVTVEFNGHSYSASVDELGNWQLTLPSDAVPGTNSYTVTAEDLAGNIS
FT                   TVTGQFTYIPSGNQPPKVSAQLDPDSDSGIQGDSITNVKKPTIVGQATPGVTILLTIAG
FT                   NSYTTIAAADGSWSIDISQPLNEGHNGYTVVATDPNSGLSSTINNNIFIDSLAPGATVV
FT                   LTDASDSYIKGDMITSDRRPQFTGKTEPGATVSLIIDGVTFTTTADQNGNWLLGPSHTL
FT                   PNGTLGYTVIMTDIAGNQNTTQGNITIDSSTPRMNNAALNEIDDTGVQDRYWTNLLTPT
FT                   IKGWAEPGVKLTISINGNIYDITDISSDGTWRFQLPHGIALDNGLEQEIKYWVTATDSA
FT                   GNSAGTVDAIFIAKRKLTITDGLSEETDSDTKGDKLTSVTNPTLQGTISGGAASDNLHG
FT                   TITIGGKTYPLTITDGGTHWSFSLPADAALSFGVHEYTLTLVDKFGTETTHTATITRTM
FT                   LSGNLDFNDDSGIAGDNITNNTAPALSGKATIGSTLRIEFAGREYDIPVNANGIWTFPL
FT                   PGAPLAEGEYTYKLTESAGQNTTTFNGTFTVDLTPPEVSGGLSTQDQAPNDPSASTNPN
FT                   PTLQGHVEPHREVTVLIDGKRFTTTADANGFWSITLDSNLQPGQSYEYTITSTDSAGNT
FT                   GQYTGTISNGHVQPPLVSFGTHEDYLGGESDKVNEVFYNTSSPPLIGHGTPGDTITLSA
FT                   LTEHGQAYTATVNADGTWKIDLPPELFPSGIPALGATHWSLTVTDSYGIQNTYVINMIP
FT                   DVTPPSLTGELDPLSDSGIAGDGITNVDRPTLKGTTEPGLKVTITLAGQSYTVNADDSG
FT                   QWQFTVPRALADGTYDYQITTVDKAGNSATISGSVTIDSASLVLNGGLDSQADPNVVDG
FT                   WTNNHHQTLKGITEPGAVIAIVLNGISYTPVVSATGEWTLDLPDLPNGHYAYTITATNT
FT                   AGTTAAINGQFTIDDLPPTTTVRLSAASDSGVSGDAITNVDKPTFIGQTKPGATVTLHI
FT                   DGHDYTTVADHAGNWQITVTTPLGEGEHDYRVSVTDRSENSSTPVEGALTIKTEALIGQ
FT                   VTGGLDRDSDSGTLEDSITNNATPNFSGSAPAGVTVIVTIDGKTYRTVADQSGHWKLAV
FT                   TTPLSEGDHPYQIVIKDVAGNQSAPLTGSLTLDRACHLQVQGLASESDSGTVGDGITNT
FT                   TTPTLIGLSDAHATITLTIAGNLYTTTADASGQWRIPLTHPLGEGNHDYHVVATDSAGN
FT                   TSSSTAQVTIDTQAPSAPGGGLASESDSGTVGDGITNNTTPTLIGLSSAHATITLTIAG
FT                   NLYTTTADASGQWRIPLTRPLDEGSHDYHVVATDNAGNTSSSTAQVTIDTQAPSAPGGG
FT                   LSSTSDSGTVGDNITTVTTPMFNGTTEPNATIALTLNNQTYRFSAADDGTWRFTLPESA
FT                   ALSDGTYHYTLQASDKAGNVSAQTQGSITIDTQAPAAPDGGALVDPDGDNIIAVATPVF
FT                   NGTTEPNAMIMLTLNQKTYLIPSDNRGAWYFTLPESASLSDGTYHYTLQASDVAGNTSA
FT                   LTTHTLTIDTRPPEPLQGALVPDADGGALSEGITQQNTPTFSGSAEAHAEISLSIDHKE
FT                   YVTTADDAGKWQLTVDHPLTDATYDYTITAKDAAGNASQLHHQLTVDTFPPTQPNAHAE
FT                   ANTLDDSVTLKGTVDAQESVQITVTLNGHDYQASIDGENWQVALPSQEVKPGENPYTIT
FT                   ATDAAGNTATASGTFTQASTSDTPPHTDYQAQDMAALSAIVTDHINVEAEHYEL"
FT   gene            333405..334505
FT                   /locus_tag="ETAF_0275"
FT   CDS_pept        333405..334505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40399"
FT                   /db_xref="GOA:A0A0H3DML1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40399.1"
FT                   /translation="MYWLGLLFYILSGLSYVAFPAVKNMVNQALLLAPQISYACAVLFI
FT                   YPLAIFLCHLIFRIKSKKYYLLLATQTKLAASIAVSLGLIGTFIGLTDMILAISSSLGG
FT                   DGNLATKMNAMISSISTALGAMSYAFLTSIVGVSISVLLLISLSFWAFYYKSEKEDDSK
FT                   PERERSLELQELLKRISVIESVNVNIANKLIAIPENTQLTEMLAKNSADMVMHLGKIEE
FT                   GLQTIGHSIKKVGEENIEKSSHMLEILSGIEGNGISTGNKLERCIERLSEFNIQMNVQR
FT                   IMFKEHFENVCDSGISNAKSINEMLAAQATQTNLFKEHFEFVQKMSHANHEQLKNIIDS
FT                   QANYINEQGRFKNKLKDVLKVIANEN"
FT   gene            334495..335718
FT                   /locus_tag="ETAF_0276"
FT   CDS_pept        334495..335718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40400"
FT                   /db_xref="GOA:A0A0H3DPD2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPD2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40400.1"
FT                   /translation="MKIKSLAIILCAIIASPFAQAKQATENYVDFINSVYDQSDMIHIK
FT                   ILELESELLRSKQTNFYYSPKVSAESKYKTDNSRGEIFDSKVMVNSLIYSSSLPERFKE
FT                   KDSRIRSAELGLLKEKENLYKSTMENLVGIKYYSDLDLKAQKLEREAISLYNQIEGRYL
FT                   SGIAKASDVEQAKLLIQRIKTESEGINKEIELLKANIELSTGIQYPAQGVYLPDTILNK
FT                   INSYKADEKKIYNNLDYQLIGEQAESAKFNAQQQDNLMQLSLVAEERYNNRRRVDNDSY
FT                   AGIQVSVNVFDLDRKVAKQTGMKSYEVLKRRMDFKYKESMAKIRTLQLTSNSNQKEIKG
FT                   MEDQLNTTSIIIANQKQEYNISQSSYYEMLNTQYDYFSLERRITDMKISETINKISLLQ
FT                   VTGNLLSL"
FT   gene            335721..336956
FT                   /gene="hlyD"
FT                   /locus_tag="ETAF_0277"
FT   CDS_pept        335721..336956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyD"
FT                   /locus_tag="ETAF_0277"
FT                   /product="Type I secretion membrane fusion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPG4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40401.1"
FT                   /translation="MSDSIISRKLMILLGVMLVLVFYICIAKIDIVTPGTGVITGAADK
FT                   LVIVSPDSGFINKFDLKTGSLVKQGDILFSYTNLEVFHQEKTLNELVLFADTRIHNLEE
FT                   DQRLLKMILDGNVSKEKGFSSQNTSIPVQELSAFKLLNEYFSLKNEEDNLKLREQKMLE
FT                   EKDDLNHRVLLLKRKGGLLRSAKAPEIEIINNQSEVSQIISQITSGDISLLSLQNDMKA
FT                   ASNRFRSSVLEQLNNNSDQLQVLRRERLENIGRLELLRSKIIANSVVSPINGVVLSIER
FT                   NFDKGSYVENSQPVMTIKKNNENKVIDAKILSKYRPFIYADASVKIVINSPGYKNNING
FT                   HIAKISADSFSDDEARGGERYYKVEIKPDDKAVVPPELEGVQVNVYALSKKITLLNYMT
FT                   ALVGDNITFNVW"
FT   gene            337365..339332
FT                   /locus_tag="ETAF_0278"
FT   CDS_pept        337365..339332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0278"
FT                   /product="ABC Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40402"
FT                   /db_xref="GOA:A0A0H3DQU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQU6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40402.1"
FT                   /translation="MKNNFFDIMRKYCFIEGERFNTKNKSTEMQDVIININEYIVNYFF
FT                   EFTVTSVSYQNNMSLPKTFVVEWGESNYIILQRESNRLINLTSSITIANDDLINKRVFF
FT                   LSKELKKIDDNDAFSAIKKMTPRASYFSLGLIFFALITPLYSNLFNTRLIYSDSYNSIF
FT                   FVTGVFILFVILELLLKSIVYAKTAQQVKTNNITCNAFYLYLLKLSNCRNAAVKIRTID
FT                   SSATALWESYPLIPVDFSLALLFLVCLFSMMSIYAFPLFIYYIILTFLCVYVRFSAYKK
FT                   TLQTNTSSYEKMSTLISLEEKRKELKFLRGNFCEKLLMDKTTKDEYTKMEMNIDNHHWA
FT                   ELIKSNSFVSMVVMFICSYFAVVNGALTTASIIAIMIINSRLSGALVGGINKMYLSKLH
FT                   AFHIKSSLGELLKDRDQCISHNGIAISHIENFSVSHLTIPFLDSALVNGLSLSAVPGDI
FT                   IGITGASGTGKSSLIKALSNSFNDYSGTIKLNNVDIKNVSADYINNCISYHSTNSRFIK
FT                   GTLRENFMVYGIVNDQDIIDILSLCCKKLTLSRENIDEKYVDELNLSNGERQKVLLCMA
FT                   LFKKPEVIFLDESTSFLSSADAITFLEEIKSCYAHAIVFFATHDIALKNMFTQIVTLPY
FT                   GEVMSHNDSVINIPMLKIKR"
FT   gene            complement(340544..346549)
FT                   /locus_tag="ETAF_0279"
FT   CDS_pept        complement(340544..346549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0279"
FT                   /product="putative invasin"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40403"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM78"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40403.1"
FT                   /translation="MYEQYFGDAVGLFGKDNLQRNPYAFTVGVNYTPFPLLTLGVDQRL
FT                   GKNSEHDTQFNVQLNYRIGDDWRAQVDPSAVPHSRLISESRYNLVERNNNIVLEYQKQN
FT                   IMHLSLPSDTLSGQPGSEHMISAILQTKYGLQDIVWQDAEFISAGGKLQRQDKTHFNLT
FT                   LPSYRYSATARRSGSHATAQAEIAANTYHLSATAFDTKGNQSNTINLTVTVEPPTVFQG
FT                   KFEVQHDNAVANGSDAISVDYILTDESGGRVANKTILMTTNNGAKPSNAEINTDQHGVA
FT                   RLNVTNTAAGATLITATVNGVSQTQSVNFIADSAHPDANKSILLASPKSIVANGKDATA
FT                   LTLQLKDAYGNPISGQSVTFISSESSGITVSSTTDSGNGNYSATLSGTRAGPLQITVAI
FT                   DGKPLLGRSAPVTLTADSSQPDAAKSTLTATPDHIVANGTDAATLTLTLKDINDNPIDG
FT                   QKVAFISSERDGVAISHTTDHGNGSYSATLNGTRAGTTQVTVTVDGKPLAVSAAAVTLS
FT                   ADGSRPDATRSLLEAKPSQIVANGTEAAALMLTLKDVNGNLISGQRIAFISSENTGITV
FT                   SSATDEGNGRYTATLRGTRAGITQVSVTIDGTPLAVHAARVTLTADSSNPNADKSILEA
FT                   NPSRIVANGVDAATLTLTLKDINDNLISGQSVAFISSEKNGVHISNTTDEGNGRYRATL
FT                   SGTRAGITQVTVAVDGNPLAVSAATVTLTADSSKPDAALSTLEAKPNQIVANGTEAAAL
FT                   ALMLKDVNGNPISGQRIAFISSENTGIVISGATDEGNGRYSATLKGTRAGATQITVTVD
FT                   GKPLAVSAATVTLTADSSKPDATLSTLAVTPNQIVANGADSAALALILKDINGNPISGQ
FT                   SVAFISSEKNGVRISQTTDEDNGRYSATLSGTRAGMTQVTVTVDGKPLAVSAVTVTLHA
FT                   DSSKPDASLSSFAVNPHEIVANGSDAATLTLLLKDINDNPLAAQNLAFISSETNGVSIT
FT                   TTADEGNGRYSATLTGTRAVSTQITVKVNGVTLGVAAETVRLKADSSNPDAGQSALVVD
FT                   PSRIVANGKDNATLTLTLKDVNGNLLAGQTVAFSGDLGIVVGRTVDHGDGTYSAVLTAG
FT                   ITAGSARILTTVNGNELRLNAPSLTLTADSSQPDATKSTLAAKPDQIVANGTEAAALTL
FT                   TLKDINGNPISGQNVKFVSSEKSGISVGNTSDEGNGRYRAALSGTRAGMTQVTVTIDGN
FT                   PLAVNAVTVTLTADSSKPDAALSTLTAKPEQIVANGIEASTLTLALKDIHDNPISGQRV
FT                   AFISSENTGITVSSTTDDGSGNYSATLSGTHAVSTQITVTVNGVALAIDAKTVNLTADS
FT                   SNPDAAKSSLKATPKTIVANGSDASTLTLTLKDVNGNLISGQTVAFISSEHDGITVSGT
FT                   TDNGNGDYSATLQGTRAIGTQITVTVNGQPLAVSAATVTLTADSSHPDSARSTLVAAPT
FT                   QIVTDSTQASTLTLMLMLKDINDNPISGQDVAFISSEKDGIHLTATAEKGNGSYSATLT
FT                   GTRAGTTEITVTVGGKALAVHAATVTLIADSSKPDATLSTLEANPYNLEATTGASGRAT
FT                   LTLTLKDVHGNPIAGQEVVLSTDLGSISDGGRTTGHADGTYTATIYAGTAAGIAHVTTQ
FT                   LNGSAFPLNLEVPINGDSSAPDPSKSSFEATPNLIVANGVETSALKLTLRDAHLNPISS
FT                   QDVKFISSKTNGITISSTTPLNDGTYHATLAGTEAFTTTITVTVNGNPMNASLHTTVTL
FT                   NGNKDHLDSAQSTLALDNATAEANSPIALTLTLKDTHGNPVSGQRVKFISSAPEYSTFG
FT                   AVRDDGNGVYTATVSNIIPGSIDISVEVNGTALATLTEKATFTAMNVVISDTKTQNNQL
FT                   SVNPGTEGSRPTATNLYLLRNSDNKVLAARYGVNSSEWGAFDIGNGLSDSDEYSVLASN
FT                   GAGAYRWAIYKYQLKRNYAEALVGWNTLLDNTARHYDVGTRLWNNTTSVDYPVPTMASL
FT                   DCSIVKTCL"
FT   gene            348882..349007
FT                   /locus_tag="ETAF_0280"
FT   CDS_pept        348882..349007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40404.1"
FT                   /translation="MKASLILPGYLNHSLTENHLNICCNLIFLYAFHHIHGQVSL"
FT   gene            349692..350039
FT                   /gene="yjeI"
FT                   /locus_tag="ETAF_0281"
FT   CDS_pept        349692..350039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeI"
FT                   /locus_tag="ETAF_0281"
FT                   /product="putative membrane protein YjeL"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40405"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPD7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40405.1"
FT                   /translation="MRIKGLLGLAAVMLLAGCSTMTQLSSAGQQVKFTDTKPGTECQLL
FT                   GEAVGTQSNWLSGQGGETSSMRAAANDLRNKAAAMGGNVVYGAVSPSESFWSSFAPLDS
FT                   KMSGQVYKCPN"
FT   gene            complement(350123..350818)
FT                   /gene="ykgG"
FT                   /locus_tag="ETAF_0282"
FT   CDS_pept        complement(350123..350818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ETAF_0282"
FT                   /product="Putative L-lactate dehydrogenase YkgG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40406"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPG9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40406.1"
FT                   /translation="MNNRDEFLATIARQLGREVRHTPQPRPQPINDYAQTRLTELSPQQ
FT                   RCDAFIDVASNVMLAHCERCSEAEAAQAALRLCQRYGQTPTLVSGDQRLAQLGITETLV
FT                   RECPATVWDPALGAENLRMAEQAKVGVVYAEYGLTESGGVVLFSSALRGRALSLLPESS
FT                   VFVLRKSTILPRVAQLASLLHQRAQRGERMPSCINLIGGPSSTADIELIKVVGVHGPVN
FT                   AAYLIVEDC"
FT   gene            complement(350818..352239)
FT                   /gene="ykgF"
FT                   /locus_tag="ETAF_0283"
FT   CDS_pept        complement(350818..352239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ETAF_0283"
FT                   /product="Putative L-lactate dehydrogenase, Iron-sulfur
FT                   cluster-binding subunit YkgF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40407"
FT                   /db_xref="GOA:A0A0H3DQV1"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQV1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40407.1"
FT                   /translation="MSLKTSDVKFKDRIRLQLDDAVMRKAVANAQERIGANRQKMVDEL
FT                   GHWDEWRERAEQIRDHVLDNLDAYLYQLAEKVTENGGKVYFAKTKEDATRYILQVAQAK
FT                   NAKKVVKAKSMVTEEIGMNHALQQAGIQVVETDLGEYILQLDQDPPSHVVVPAIHKDRT
FT                   QIRRVLHETLGYDGPETPEAMTLFIRQKIRQDFLSADIGVTGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPPTHIAVMGMERIAPTFEEVDVLITMLARSAVGARLTGYNTWLTGPREAD
FT                   NLDGPQEFHLVIVDNGRSSILGSPFRAVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYANFKDLPYACSLCTACDSVCPVNIPLSKLILRHRQAMVEAGLPPKAE
FT                   QRATRLFTYANSHPGLWKVGMIAGARAASWFIKGGKAPINAGALAEWTAARDLPQADGE
FT                   SFRSWFKQHKAQGNK"
FT   gene            complement(352250..352969)
FT                   /locus_tag="ETAF_0284"
FT   CDS_pept        complement(352250..352969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0284"
FT                   /product="conserved hypothetical protein with cysteine-rich
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40408"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM84"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40408.1"
FT                   /translation="MNVNFFVTCLGDALKSRMARDSVLLLEQLGCTVHFPEKQGCCGQP
FT                   AINGGYVKDAIPGMKTLIRALEENDDPIISPAGSCTYAVKSYPSYLSDEPEWALRAERV
FT                   ANRMVDLTSFIVNTLGVQDVGARLPGRAVYHPSCSLLRKMKVREEPLTLLSHVRGLELL
FT                   PFPAAETCCGFGGTFSIKMAEISGEMVKEKVSHMMEVQPEYLIGADISCLINIGGRLQR
FT                   EGLPVKVMHIAEVLMSR"
FT   gene            complement(353019..354572)
FT                   /locus_tag="ETAF_0285"
FT   CDS_pept        complement(353019..354572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0285"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40409"
FT                   /db_xref="GOA:A0A0H3DMM0"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40409.1"
FT                   /translation="MPAYLPFFLGILPLAVMIILILKLKTPIHLAVLITLALTLAVTGL
FT                   YWHTPLQTLGSALIYGALKGLWPIVIVILGAIYSYNLMLKTGSMDILRDVLAAVSDDKR
FT                   IQVLLIAWCFGGFLEAAAGYGTAVAIPIGILIALGFNPLKAAIASLVANTVPTAFGAVG
FT                   IPVSILAEQVNLPVTALSGTIISQLALFNILLPFVIVAIIGGGVKALRGVFTLTLLCGI
FT                   STLIPQYLVAIKLGAELPAFAGSLVSLIVVTLMAKARRGETAAEYRIDGAHLKGNVRYS
FT                   APQLLRACAIYLLIFIFILLCSPLFPAIRSTVAQVASVLPFPLANGQVLKLKIDWIATP
FT                   GVLIIIATLIGGVIQGAALRQMLQVFVATVKQLKNSIIAISAIVAMATVMDVSGLIATL
FT                   AQTLVNVTGGGYLFIAPIIGALGTFVTGSDTNSNVLFGKLQTMAAEKLHVDPLWLAAAN
FT                   TSGATGGKMISPQSIAIAVSATRMDGQGSAIMSGTLKYCCAYIVILGLKVGLVYYLFMS
FT                   "
FT   gene            complement(354811..355839)
FT                   /locus_tag="ETAF_0286"
FT   CDS_pept        complement(354811..355839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40410"
FT                   /db_xref="GOA:A0A0H3DPE2"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPE2"
FT                   /protein_id="ADM40410.1"
FT                   /translation="MAHIVTQKGQPREDWLQQLADVVTDPADLLAQLGLSDHPQWLAGC
FT                   EARRLFPLRVPRAFISRIRRGDPNDPLLRQVMSDAAEFIETPGFSTDPLEEQHSVVPGL
FT                   LHKYQNRALLLVKGGCAVNCRYCFRRHFPYQENQGTRANWQRAVAYLHEHPELDEIIFS
FT                   GGDPLMAKDHELDWLFTQLEQLPHLRRLRIHSRLPVVIPARVTDALCQRMADSRLQMVL
FT                   VTHINHANEIDEALSEAMGRLKQAGVTLLNQSVLLRGVNDSADTLAALSNALFDAGILP
FT                   YYLHVLDKVQGGAHFMVPDDEARRLMHGLLAQVSGYLVPRLTREIGGEPSKTQLDLHLR
FT                   QQ"
FT   gene            355927..356448
FT                   /locus_tag="ETAF_0287"
FT   CDS_pept        355927..356448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0287"
FT                   /product="Translation elongation factor P / Translation
FT                   initiation factor 5A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40411"
FT                   /db_xref="GOA:A0A0H3DPH5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPH5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40411.1"
FT                   /translation="MMDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGKLIEKTFKSTD
FT                   SAEGADVMDVNLTYLYNDGEFWHFMNNETFEQLAADAKAVGDNAKWLLDQAECVVTLWN
FT                   GQPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPATLTTGAVVKVPLFVQIGEVIKVDT
FT                   RSGEYVSRVK"
FT   gene            356657..356959
FT                   /gene="sugE"
FT                   /locus_tag="ETAF_0288"
FT   CDS_pept        356657..356959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="ETAF_0288"
FT                   /product="Quaternary ammonium compound-resistance protein
FT                   SugE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40412"
FT                   /db_xref="GOA:A0A0H3DQV6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQV6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40412.1"
FT                   /translation="MLIAGLLEVVWAISLKYSHGFTRLWPSVVTLLAMAASVLLLAHAM
FT                   KTLPAGTAYAVWTGIGAVGAAIMGIILLGESASPLRLLSLGLILCGILGLKFSHT"
FT   gene            complement(357028..357387)
FT                   /locus_tag="ETAF_0289"
FT   CDS_pept        complement(357028..357387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0289"
FT                   /product="Fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40413"
FT                   /db_xref="GOA:A0A0H3DM90"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM90"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40413.1"
FT                   /translation="MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGM
FT                   FPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPAASWVFYGL
FT                   AAILSVVALIGIFTL"
FT   gene            complement(357401..357799)
FT                   /locus_tag="ETAF_0290"
FT   CDS_pept        complement(357401..357799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0290"
FT                   /product="Fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40414"
FT                   /db_xref="GOA:A0A0H3DMM5"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40414.1"
FT                   /translation="MTTSTKRKPYVRGMSSNWWQKLGFYKFYMLRESSALENVWFSIVL
FT                   IYGVFSLKDGAAGWESFVAFLQNPLVLVLNIISLLLAVLHTKTWFELAPKAANIVVNDE
FT                   KMGPAPIIKALWVVTIVATVVVLGLALL"
FT   gene            complement(357816..358550)
FT                   /locus_tag="ETAF_0291"
FT   CDS_pept        complement(357816..358550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0291"
FT                   /product="Succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40415"
FT                   /db_xref="GOA:A0A0H3DPE6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPE6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40415.1"
FT                   /translation="MAEMKNLKMEVMRYNPEQDAEPRFVTYEVPYDDTTSLLDALLYVK
FT                   DNLAPDLSFRWSCRMAICGSCGMMVDNVPKLACKTFLRDHPNGMRVEALANFPVERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEDGTNKQTPAEMEKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPVLNTQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   gene            complement(358543..360219)
FT                   /locus_tag="ETAF_0292"
FT   CDS_pept        complement(358543..360219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0292"
FT                   /product="Succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40416"
FT                   /db_xref="GOA:A0A0H3DPI2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPI2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40416.1"
FT                   /translation="MRSHTVAAEGGSAAVTQAHDSFDFHFHDTVAGGDWLCEQDVVDHF
FT                   VHNCPREMTQLELWGCPWSRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSL
FT                   KYPQIQRFDEHFVLDILVDDGQARGVVAINMMEGTMVQIRANAVILATGGAGRVYRYNT
FT                   NGGIVTGDGMGMAFKHGIPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRY
FT                   LQDYGLGPETPLGEPKNKYMELGPRDKVSQAFWHEWRAGRTISTPRGDVVYLDLRHLGA
FT                   KKLHERLPFICELAKAYVGVDPVNEPIPVRPTAHYTMGGIETDQSCETRIKGLFAVGEC
FT                   SSVGLHGANRLGSNSLAELVVFGRVAGESALQHLQNVTPANGTALDAQVKDIEGNLKAL
FT                   VNQEGNENWATLRDEMGTSMEEGCGIYRTTDLMQKTVDKLAELKERFKRVKITDTSSVF
FT                   NTELLYAIELEHGLNVAECMAHSAINRRESRGAHQRLDEGCTERDDVNFLKHTLTYFNE
FT                   SGAPRIEYSDVKITKLPPAKRVYGAEAEAQEAKKKEEKANG"
FT   gene            360811..361788
FT                   /gene="yjeA"
FT                   /locus_tag="ETAF_0293"
FT   CDS_pept        360811..361788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="ETAF_0293"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40417"
FT                   /db_xref="GOA:A0A0H3DQW1"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQW1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40417.1"
FT                   /translation="MSDTASWQPSAPVANLLKRASILSTIRRFFSDRGVLEVDTPSMSQ
FT                   ATVTDVHLVPFQTHFVGPGVAQGMTLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECESAETLSYQQAFIRHLDVDPLS
FT                   ADKTQLREAAAKLDLSNVADNEEDRDTLLQLLFAFGVEPHIGKERPAFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYRGVELANGFHELTDAAEQRLRFEQDNRKRAAAGLPQQPIDE
FT                   HLLAALEHGMPDSSGVALGVDRLIMLALSAERLSEVIAFSVDRA"
FT   gene            complement(361844..365167)
FT                   /locus_tag="ETAF_0294"
FT   CDS_pept        complement(361844..365167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0294"
FT                   /product="Potassium efflux system KefA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40418"
FT                   /db_xref="GOA:A0A0H3DM97"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM97"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40418.1"
FT                   /translation="MRQILQRILLSGLLLLLLPGLAQATLNERQLALDLKQAEAAKSAP
FT                   AQAETVDALQSALGWIDEAKASAQRTQQYRRAISDFPRLTRELRQQLSDESQPPAPAAL
FT                   PPASDAEQRMLQISSQLLEVARQLQQEQDRARDISDSLSQVAQKQAATRKALSEAERRL
FT                   QALTVTETALSQAQSAQLQAEVAARKAQVDELELEQLSANNRQELIRLQSEVLSRRHER
FT                   LDLQLQGLRNSLNSQRQRDAEEALERTRRLVEQSDNLPRSIVEQLTINQTLSRDLNHQA
FT                   QRLDDIAGRQRTIAGQTQQVRLALNTLREQAQWLSVSPALGETLRDRLARLPEMPKPQQ
FT                   LDSDMARLRVQRLRYEALLDKLAPASDYRQNDGEPLSGAQQRLLAPQLATQRELLNSLL
FT                   SGCDSQILELTKLKVANTQLIEALTEVREATHRYLFWAADIDPVGLGYLLTTLRALDRL
FT                   LSLDTLSQLSQATMMMLTDRTTLLPLCAALLLVGFSVYSRRYYSAFLARAAGRVGKVNQ
FT                   DHISLTLRTLLWSILVALPLPVLWAAVGYGLSNAWPYPVAVAIGEGVSAALPVLWAFMI
FT                   SAAFSRDSGLFIVHFGWGERQVRRAMRYYRMSIWLIVPLLMAVVTFNNLADRSFTATLG
FT                   RACFIMLCLALLLLTTSLRRAGIPLYLNRAGSGENLLNHLLWGGLLCAPAAAILAALLG
FT                   YLGAAQVLLARLETSVAIWFCLLMVYSVIRRWMLIQRRRIAFERAKQRRAERLEKRSRH
FT                   DEDGLHPAGVEGSQEVDESVVDLDAISERSLRLVRSILTMIALVSLIWLWSELHSAFAF
FT                   LENIRLWDVTASGVGGETLQPITLGAVLIAILVILVTIQLVKNLPALLELGLLQHLELS
FT                   PGTGYAITTITKYLLMIVGGLIGFSLLGIEWSKLQWLVAALTVGLGFGLGEIFGNFISG
FT                   LIILFEKPIRIGDTVTIRDLTGTITRINTRATTISDWDRKEIIVPNKAFIMEQFINWSL
FT                   SDPITRVVLTVPAEASANSQRVTELLLQAAGQCSLVLATPAPEVYLVDIQQGIQIFELR
FT                   IYASEMAHRMPLRHELHQLILAAYRQHDLVLPFPPIQIGSDSLRQVRGGQRRGFSAGGV
FT                   "
FT   gene            complement(365224..366141)
FT                   /locus_tag="ETAF_0295"
FT   CDS_pept        complement(365224..366141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0295"
FT                   /product="Phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40419"
FT                   /db_xref="GOA:A0A0H3DMM9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40419.1"
FT                   /translation="MDKEANVLDSIKIRLQYLLPKQGLTRLAGWAADKQAGWLTQSAIK
FT                   GFARYYGINMQEALYPDPAHYKTFNDFFVRPLRDGVRPLAEFDDGVVLPADGAISQLGP
FT                   IDADRILQAKGHDYTLEALLAGQYPLADTFRGGQFVTTYLSPRDYHRVHMPCDGQLREM
FT                   IYVPGDLFSVNPLTAANVPNLFARNERLICIFDTAFGPLAQILVGATIVGSIETVWGGC
FT                   VNSERAGIIRRWTYPAEGEHAVALKKGQEMGRFKLGSTVINLFAPGRIQFDRALSAGSI
FT                   TRMGRELGHAPAAAQESAADPESA"
FT   gene            complement(366248..367252)
FT                   /gene="engC"
FT                   /locus_tag="ETAF_0296"
FT   CDS_pept        complement(366248..367252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engC"
FT                   /locus_tag="ETAF_0296"
FT                   /product="Ribosome small subunit-stimulated GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40420"
FT                   /db_xref="GOA:A0A0H3DPF2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPF2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40420.1"
FT                   /translation="MHANHQRRLQQTDNSAEMDDSLFGDAQDGIVVSRFGKHADVEAAD
FT                   GTQQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIVEAVHPRSSVLTRPDYYDGVKPIAA
FT                   NIDQIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDDEGREFVEQAMAIY
FT                   RHIGYRVVLVSSHSGEGMAQLQALLTQRISIFAGQSGVGKSSLLNALLPALESQIEVGA
FT                   VSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQITQGFIEFRDYLGSC
FT                   KFRDCKHGNDPGCALREAVARDDIAETRFDNYHRILEGMAQVKLRKNFGNGDS"
FT   gene            367441..367986
FT                   /locus_tag="ETAF_0297"
FT   CDS_pept        367441..367986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0297"
FT                   /product="Oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40421"
FT                   /db_xref="GOA:A0A0H3DPI8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPI8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40421.1"
FT                   /translation="MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPV
FT                   IALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKKNTHQALDD
FT                   IRESVAELAYYRTHFIQL"
FT   gene            368168..368243
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3233"
FT   tRNA            368168..368243
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3233"
FT                   /product="tRNA-Gly"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            368291..368366
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3234"
FT   tRNA            368291..368366
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3234"
FT                   /product="tRNA-Gly"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            368418..368493
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3235"
FT   tRNA            368418..368493
FT                   /gene="trnG"
FT                   /locus_tag="ETAF_3235"
FT                   /product="tRNA-Gly"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(368784..369923)
FT                   /locus_tag="ETAF_0298"
FT   CDS_pept        complement(368784..369923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0298"
FT                   /product="Iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40422"
FT                   /db_xref="GOA:A0A0H3DQW5"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQW5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40422.1"
FT                   /translation="MTHPLDLHQLAQHIKQWGLSLGFQQVGISDTDLRAEEAPLQAWLD
FT                   SGYHGEMEWMARHGMMRARPDELLPGTLRVISVRMNYLPPSAAFASTLKDPTLGYISRY
FT                   ALGRDYHKVLRARLKKLGEMIQAYCGELHFRPFVDSAPLLERPLAAKAGLGWTGKHSLL
FT                   LNPQAGSWFFLGELLIDLPLPVDTPQTAQCGRCVACITTCPTDAIVAPYKVDARRCISY
FT                   LTIELEGPIPEALRPLLGNRIYGCDDCQMICPWNRLAPLSEEADFLPRAALHAPALTTL
FT                   FAWDESTFLRMTEGSPIRRIGYQRWLRNLSVALGNAPYDAHIVTLLQQRLGISALLDEH
FT                   IHWALAQQRQKRAAQAVEVISSQQRRLIRAVDKGLPRDA"
FT   gene            369925..371418
FT                   /gene="yjeF"
FT                   /locus_tag="ETAF_0299"
FT   CDS_pept        369925..371418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeF"
FT                   /locus_tag="ETAF_0299"
FT                   /product="YjeF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40423"
FT                   /db_xref="GOA:A0A0H3DMA2"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMA2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40423.1"
FT                   /translation="MGHSCNRNADSLSHYVAPADWVRNAEARAAAAQGITLATLMQRAG
FT                   LAAFNRGRQCYPTSRRWLILCGHGNNGGDGYVIARLARASGLQVTLMAVAGHSPLPPEA
FT                   QQARAQWLQCGGSEIAASLPLPAAEVIVDALLGIGLSAAPRAPYDGLITAINAHPAPVL
FT                   SVDLPSGLNADTGAAAGAVVRADHTQSFICLKPGLLTGLARAVVGQLHCDPLGLTPWLA
FT                   QQDWPLQRLDGHCLPRWLAPRSPLAHKGDNGRLLLIGGDSGMGGAIRLAGQAALRSGAG
FT                   LVRVLTRAEHVAPLLAAAPELMVKALSPDTLKEALSWAEVVVVGPGLGQGEWGQRALAA
FT                   LASVRKPMLWDADALNLLSGAPSVCEWRVMTPHPGEAARLLGCGIADVENDRPAAVRAL
FT                   QRRYGGVALLKGAGTLIADDARCAIADIGNPGMASGGMGDILSGIIGGLLAQKLTLYDA
FT                   ACAGAVLHGVAADAAARRDGERGMLASDLLPEIRRWANP"
FT   gene            371449..371913
FT                   /locus_tag="ETAF_0300"
FT   CDS_pept        371449..371913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0300"
FT                   /product="ATPase YjeE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40424"
FT                   /db_xref="GOA:A0A0H3DMN3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40424.1"
FT                   /translation="MTSIVLQLPDEAATIALGGALARACQRATVIYLYGDLGAGKTTFS
FT                   RGFLQAMGHQGTVKSPTYTLVEPYLLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDAL
FT                   LLVEWPQQGMGFLPEPDITLHLTYTGGGRQAVIEAHSVHGQSVLAALNGQ"
FT   gene            371936..373585
FT                   /locus_tag="ETAF_0301"
FT   CDS_pept        371936..373585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0301"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40425"
FT                   /db_xref="GOA:A0A0H3DPF7"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPF7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40425.1"
FT                   /translation="MQRFLRITLPLALGWCLATMAGAAQLTNIQVSNGDRQAVVTLTFN
FT                   APPELSHRIERNPDRVLVEIADSKRITGGLPMQFSGENMLSRIRDGGEQRAGKVLLVLD
FT                   TTQRPRVSVARSGNRAVLTLRAESRAAVAPASPPASTGKNPFHSRPRQAAAPALAPAAA
FT                   PLPSVPVSAVKKSGRYDGSKIVVAIDAGHGGQDPGAIGQDGLREKEVTLAIARRLRGLM
FT                   DDDPMFQPVLTRSGDYFISVMGRSDVARRQKANLLISIHADAAPNRSANGASVWVLSNR
FT                   RANSEMAGWLEQHEKQSELLGGAGDVLANSNQDKYLSQTVLDLQFGHSQRVGYDVAVQV
FT                   LRQMQSVVRLHKRHPEHASLGVLRSPDIPSLLVETGFISNSEGERQLGNGQHQERIARA
FT                   IYLGVRSYFLAHPLQSGPKVENRPQPASAAGNVAAAAAVAPSASEIHVVKRGETLLGIA
FT                   NRYGSTLSGMMRLNNLKKEGVWVGQRLKVPSAGGSAQPAAASAPRIHLVKRGDTLTRIA
FT                   AHYGVSMDALRQANKMKSDEVQLGQRLRIPSR"
FT   gene            373603..375522
FT                   /gene="mutL"
FT                   /locus_tag="ETAF_0302"
FT   CDS_pept        373603..375522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="ETAF_0302"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40426"
FT                   /db_xref="GOA:A0A0H3DPJ4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPJ4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40426.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGSGIGKAELALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTMTSRPEGQAEAWQAYAEGREMAVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRT
FT                   EKTEFAHIDEVVRRIALARFDITLTLQHNGKTVRQYRAVREGDARERRLGAICGTAFVQ
FT                   HALALAWRHDDLAIHGWVAAPQAIRQIGELQYCYVNGRMMRDRLITHAIRQAYQDRLSD
FT                   ELPPAYVLYLEIDPRQVDVNVHPAKHEVRFHQARLVHDFIYQAVVDVLQQAQVASAQDD
FT                   PTLATPGAALDEGPRGVENRASAGENRFNRPASSPIASAPRPAHAAAPRMPAGDIFRRR
FT                   EGELYQRLLAASPTPAGETDSAFVAAPSAPLPAAEPPAVAVSTAAERAAPGDSLGRVLT
FT                   LCADGVALTECRRGVALVSLSYARRCLLRAQLQPSDEGLKAQPLLVPLRLTLEAAERQA
FT                   LQAQQPLLQQMGIRLQPERQHAQLHAVPLPLRQQNLPRLIPQMLRYLATAPACDAASLA
FT                   DWLAVHWHSADEAPWTVAQAVQLLADLERLCPQLVQSPPRALLQPLNLQPGVERLRQEE
FT                   QLNE"
FT   gene            375515..376468
FT                   /gene="miaA"
FT                   /locus_tag="ETAF_0303"
FT   CDS_pept        375515..376468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="ETAF_0303"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40427"
FT                   /db_xref="GOA:A0A0H3DQW8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQW8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40427.1"
FT                   /translation="MSNDKQMQKLPPAIFIMGPTASGKTALAMALRERFPVEIISVDSA
FT                   LIYRGMDIGTAKPSAEELARAPHRLIDIRSPTQSYSAADFRADALREMAQISAQGRIPL
FT                   LVGGTMLYYKALLEGLSPLPPADAAVRARIEQQAREQGWEALHRELARIDPVAAARIHP
FT                   NDPQRLSRALEVFFVSGNTLTELTRVSGEALPYAVSQFAIAPSSRELLHQRIALRFQQM
FT                   LEAGFEQEARRLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLAK
FT                   RQMTWLRGWESVQWLDSDKPAEALDCVAQVVSASLD"
FT   gene            376631..376939
FT                   /locus_tag="ETAF_0304"
FT   CDS_pept        376631..376939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0304"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40428"
FT                   /db_xref="GOA:A0A0H3DMA7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMA7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40428.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSGNAGTGSAGSSYHHGGQAASQPTQGSDDAE"
FT   gene            377038..378318
FT                   /gene="hflX"
FT                   /locus_tag="ETAF_0305"
FT   CDS_pept        377038..378318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="ETAF_0305"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40429"
FT                   /db_xref="GOA:A0A0H3DMN7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40429.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQEKDSEDLSEFESLVSSAGVQALRVI
FT                   TGSRKAPHPKYFVGEGKAQEIAQAVAETQASVVLFDHPLSPAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRIHLIIGRLEKVEKQREQGRRARVRAEIPTVSLVGYTNAGKSTLFNTLTSATV
FT                   YAADQLFATLDPTLRRVEVNDVGPTVLADTVGFIRHLPHDLVAAFKATLLETRQASLLL
FT                   HVVDASDTRVDENIDAVNTVLADIGADEIPVLLVMNKIDMLQDFVPRIDRDEENRPLRV
FT                   WVSAQQASGMDLLFQALSERLGGEIASYTLRLPPAAGRLRSRFYQLQAIEKEWIEEDGS
FT                   IGLQVRMPVVDWRRLCKQQQELINFIV"
FT   gene            378377..379621
FT                   /gene="hflK"
FT                   /locus_tag="ETAF_0306"
FT   CDS_pept        378377..379621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="ETAF_0306"
FT                   /product="HflK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40430"
FT                   /db_xref="GOA:A0A0H3DPG2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPG2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40430.1"
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDL
FT                   FRKVSKKLGGLGGGKSGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAER
FT                   GVVTRFGKFSHLVQPGLNWKPTFIDDVIPVNVESVRELAASGVMLTSDENVVRVEMNVQ
FT                   YRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEI
FT                   IRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQ
FT                   AQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKV
FT                   LVDDKSNNLMVLPLDQIMRSGDKGASQAGDSKDTSLIRLNPPQASAGSSTDSSVMDQRR
FT                   VNAQRNDTTRLGRDY"
FT   gene            379621..380625
FT                   /gene="hflC"
FT                   /locus_tag="ETAF_0307"
FT   CDS_pept        379621..380625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="ETAF_0307"
FT                   /product="HflC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40431"
FT                   /db_xref="GOA:A0A0H3DPK0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPK0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40431.1"
FT                   /translation="MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKP
FT                   LVYAPGLHLKIPFIESVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDA
FT                   AAPTEADDAIASAAARVARETNGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIY
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAGAEREGRIIRGEGDAEAAKLF
FT                   ANAFSKDPDFFAFIRSLKAYENSFKGGQDVMVLRPDSDFFKYMRSPDGGKSAK"
FT   gene            complement(381042..381551)
FT                   /locus_tag="ETAF_0308"
FT   CDS_pept        complement(381042..381551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0308"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40432"
FT                   /db_xref="GOA:A0A0H3DQX3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQX3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40432.1"
FT                   /translation="MRSGNCKRSTRNQKGVPMGDEKSLAHTRWNCKYHIVFAPKYRRQA
FT                   FYGEKRRAIGSILRKLCEWKNVRILEAECCADHIHMLVEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDMKFKYRNREFWCRGYYVDTVGKNTAKIQEYIKHQLVEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(381457..381639)
FT                   /locus_tag="ETAF_0309"
FT   CDS_pept        complement(381457..381639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40433.1"
FT                   /translation="MENPQLGWGFRKAFSFEPVIKTPFDLLKRLAVWQLQAFNKKSKGG
FT                   PNGGREELSAHPMEL"
FT   gene            complement(381699..382811)
FT                   /locus_tag="ETAF_0310"
FT   CDS_pept        complement(381699..382811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40434"
FT                   /db_xref="GOA:A0A0H3DMP2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40434.1"
FT                   /translation="MKPGRNHFFDILRVVSVLFVITSHYSYMFDSSTVLTFPREYLTAG
FT                   IGRLGVSFFFMISGALAYLSLRKYAAPEYYLRRVYSVLIPYNIAYFGMALLLLALGVFF
FT                   TYPGNPLVEVGPNGTRSVLDMLPSVLGFDHYLHGVYEIKTVYFTGEWFIGCIILLYVIS
FT                   PLIYRAIVRYPMWTMLATVAITLMAYDTRVTNPYWSAQVRISDFTFGMLFIHLQAQFTR
FT                   YVRPLALIGALLIVAGVSWAHISHQPVREVLFPLAPVSLLFAVAFFFIVQGAYQLLHPW
FT                   LSRPRVSQILLSLASRAYIIMLLQHVIVIFLSVNMDMSVLNATQAIALYLIVLVTIERL
FT                   SVLFKPLAVKTERLLMNKTLRRSAGHMPAA"
FT   gene            383021..383203
FT                   /gene="yjeT"
FT                   /locus_tag="ETAF_0311"
FT   CDS_pept        383021..383203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeT"
FT                   /locus_tag="ETAF_0311"
FT                   /product="Putative inner membrane protein YjeT"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40435"
FT                   /db_xref="GOA:A0A0H3DPG8"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPG8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40435.1"
FT                   /translation="MALALVLVVEGLGPMLFPQAWRRMIATMAQLPDGLLRRYGGGLVV
FT                   AGLVIYYMLRSRLGG"
FT   gene            383302..384600
FT                   /locus_tag="ETAF_0312"
FT   CDS_pept        383302..384600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0312"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40436"
FT                   /db_xref="GOA:A0A0H3DPK7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPK7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40436.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVVSIIANGVVLAPDALLREMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLK
FT                   EIMEYHNFQLVNYYHVDAVDYQRVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGVGPRCVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDSVGEFLCEKGNEFGATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLD
FT                   EVKICVGYRLPDGREVDVTPLAAEGWEGIEPIYEVLPGWKESTFGVKQRDGLPQAALNY
FT                   IKRIEEVTGVPVDIISTGPDREETIVLRHPFDA"
FT   gene            384954..385328
FT                   /gene="nsrR"
FT                   /locus_tag="ETAF_0313"
FT   CDS_pept        384954..385328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsrR"
FT                   /locus_tag="ETAF_0313"
FT                   /product="Nitrite-sensitive transcriptional repressor NsrR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40437"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQX8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40437.1"
FT                   /translation="MAALPEGQMTSITQVTEVYGVSRNHMVKIINQLSRAGFVTAVRGK
FT                   HGGIRLGRPASEIRIGDVVRELEPLTLVNCSQAFCHITPACRLKQVLHRATDAFLAELD
FT                   QCTLADLIEHNPPLYKLLLV"
FT   gene            385368..387818
FT                   /locus_tag="ETAF_0314"
FT   CDS_pept        385368..387818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0314"
FT                   /product="3'-to-5' exoribonuclease RNase R"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40438"
FT                   /db_xref="GOA:A0A0H3DMB6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40438.1"
FT                   /translation="MSQDPYLEREAEKYASPIPSREFILMHLAKRKTPASREELAQELA
FT                   LSSEEDLEALRRRLRAMERDGQLIFTRRQCYALPERLDLIKGTVIGHRDGFGFLRSEGQ
FT                   KDDLYLSPEQMKMCMHGDVILAQVTGTDRRGRKEVRVVRVVEPRTGLIVGRYFTDAGTG
FT                   FVVPDDGRLSFDILIPSDAIAGARMGYVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGM
FT                   AVDIALRSHDIPHSWPEQVERQVADLSEDVPEAAKVGRIDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPNTALDHEARSRGNSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTIAASGRLSSYKFYEAVMSSHARLTYTKVAHILAGDPDLRAQ
FT                   YHALVKPLEELHALYKALDHAREERGGISFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANISAARFMEKNHEPALFRIHDKPSEDHVMALRSVLAELGLSLGGGTQPEPK
FT                   DYALLMDKVADRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALQAYAHFTSPIRRYPDL
FT                   SLHRGIKYLLAREHGHAERWTPSGGWHYHTEDMLQLGEHCSMTERRADEATRDVSDWLK
FT                   CDFMQDHVGQTYGGIITSVTGFGFFVRLDDLFIDGLVHVSTLDNDYYRFDQIGQRLIGE
FT                   SSGQVYRLGDKVEVKVDAVHLDERKIDFALISTARGVRGAGKTARNKARQANGGAENKP
FT                   SRSARRGGKMPANFAPDSVQRRGDEAAPAQKGKGKGKGKKPSAQTRKIAASTKAKRARK
FT                   KTTD"
FT   gene            387909..388652
FT                   /locus_tag="ETAF_0315"
FT   CDS_pept        387909..388652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0315"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase
FT                   rlmB"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40439"
FT                   /db_xref="GOA:A0A0H3DMP8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40439.1"
FT                   /translation="MSEIIYGIHAVKALLEQDPQRFLDVFVMKGREDRRLLPLLQQLEE
FT                   CGIRVQVAQRQWLDEKVEGAVHQGIVARVKPGRQYQENDLPDLLAGLDHPPFLLILDGV
FT                   TDPHNLGACLRSADAAGVDAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTMR
FT                   LLQQESIWIVGTAGEADHSLYQSRMTGAMALVMGAEGDGMRRLTREHCDELISIPMAGS
FT                   VSSLNVSVATGICLFEAVRQRSAKA"
FT   gene            complement(388680..388955)
FT                   /locus_tag="ETAF_0316"
FT   CDS_pept        complement(388680..388955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40440"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPH4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40440.1"
FT                   /translation="MSRSPLLTSLLFSIGLIGTSAQSAEYARADLVTDLSRMGMISLRG
FT                   IVGNPQDVERRIAHQADQRGARYYRILHMWESDGQQGWQATAALYR"
FT   gene            complement(389132..389443)
FT                   /locus_tag="ETAF_0317"
FT   CDS_pept        complement(389132..389443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0317"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40441"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPL1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40441.1"
FT                   /translation="MKTCKLTLTLLLTLLLGACSVMDGKPMPPPPPIAGHAQELRRNQT
FT                   EGLSKMWNISASVYGSPMNVQEVIQQRADAAGARYYYIVMLQETGVPGQWYSVATLYR"
FT   gene            389612..390361
FT                   /locus_tag="ETAF_0318"
FT   CDS_pept        389612..390361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40442"
FT                   /db_xref="GOA:A0A0H3DQY3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQY3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40442.1"
FT                   /translation="MVEMFEQTVGGIPLLHAVPAGQRDSALPTIFFYHGFTSSKEMYSY
FT                   FGYAFAAAGFRVLLPEADMHGSRYDGDERRRLAHFWDILKSNIDELPSLYDHFLRAGLI
FT                   LDGRVGVAGASLGGMTALGAKARYPWLRATASFMGSGFYLSLSQRLFPRQHQPTEDERA
FT                   WVRQRVSALADYDVSGCLAQLADRPLLIWHGLADDLVPAAESQRLAQALASQHLMDNVS
FT                   VVTEPGIAHKITASALDCGTAFFSRCL"
FT   gene            complement(390400..390669)
FT                   /locus_tag="ETAF_0319"
FT   CDS_pept        complement(390400..390669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40443"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40443.1"
FT                   /translation="MKPAFAFITLCLLCGSAAAATEISASQGNAMPASEFAVISVNHDV
FT                   INVQDAMSDIRAQADADGAAYYQIIAIHEPLSHGQIHVSAVLYH"
FT   gene            390971..391366
FT                   /locus_tag="ETAF_0320"
FT   CDS_pept        390971..391366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0320"
FT                   /product="SSU ribosomal protein S6p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40444"
FT                   /db_xref="GOA:A0A0H3DMQ4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40444.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERREDFANETSEETEAGDSEE"
FT   gene            391375..391692
FT                   /locus_tag="ETAF_0321"
FT   CDS_pept        391375..391692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0321"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40445"
FT                   /db_xref="GOA:A0A0H3DPI0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPI0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40445.1"
FT                   /translation="MTVNRLVLAGTVCKAPIRKVSPSGIPHCQFVLEHRSQQQEAGFSR
FT                   QAWCRMPVIVSGAGLEAMTHRLTVGSALRVHGFVSCHMGRNGLNKLVLHAEQIELIDSG
FT                   D"
FT   gene            391697..391924
FT                   /locus_tag="ETAF_0322"
FT   CDS_pept        391697..391924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0322"
FT                   /product="SSU ribosomal protein S18p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40446"
FT                   /db_xref="GOA:A0A0H3DPL7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPL7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40446.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   gene            391967..392416
FT                   /locus_tag="ETAF_0323"
FT   CDS_pept        391967..392416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0323"
FT                   /product="LSU ribosomal protein L9p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40447"
FT                   /db_xref="GOA:A0A0H3DQY6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQY6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40447.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPTGKAVPATKKNVE
FT                   FFEARRADLEAKLAETLSVAEARAVKINELATVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVAVAKSEVRLPNGVLRTLGDHEVHFQVHSDVFAQLNVVVVAE"
FT   gene            392632..393000
FT                   /locus_tag="ETAF_0324"
FT   CDS_pept        392632..393000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40448"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40448.1"
FT                   /translation="MASIALQRVYDVRAPFSPHTFLTDRLWPRGIAKARLDGVNWLKEV
FT                   APSTALRQAFHHAHLDWPTFVARYRDELAANPQAWQPLVQLLRQGESLTLLYGSRDSQC
FT                   NQAVALRDWLLAQLSAGE"
FT   gene            complement(392984..393433)
FT                   /locus_tag="ETAF_0325"
FT   CDS_pept        complement(392984..393433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40449"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40449.1"
FT                   /translation="MAPLPALHRRWLTVACAVLLLALLWPSDDAAPPRPSPALQTTASP
FT                   MQATLQPQREAPTPSDANDWQAYPILPGQTLAQLLREHNLDVTDAFAMARVEGDDRPLS
FT                   NLKAGQHVMIRRGPQGQMLALKLETTDDRQIAFRRESDGSFIRLR"
FT   gene            393877..394497
FT                   /gene="fklB"
FT                   /locus_tag="ETAF_0326"
FT   CDS_pept        393877..394497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="ETAF_0326"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   FklB"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40450"
FT                   /db_xref="GOA:A0A0H3DPI6"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPI6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40450.1"
FT                   /translation="MSTPAFDSIEAQASYGIGLQVGQQLNESGLQGLQPEALLAGLRDA
FT                   MEGNAPAVPVETVHRALREIHERADAVRREQQKALAEAGERFLAENAQQDDVTVTESGL
FT                   QFKVLKQGEGAIPSRQDKVRVHYTGRLVDGTVFDSSEQRGEPAEFPVGGVIAGWIEALS
FT                   MMPVGSRWQLYIPHQLAYGERGAGAAIAPYSALVFDVELLDIL"
FT   gene            complement(394552..395217)
FT                   /gene="norA"
FT                   /locus_tag="ETAF_0327"
FT   CDS_pept        complement(394552..395217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norA"
FT                   /locus_tag="ETAF_0327"
FT                   /product="Nitric oxide-dependent regulator NorA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40451"
FT                   /db_xref="GOA:A0A0H3DPM3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPM3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40451.1"
FT                   /translation="MTYRDRPLGELAISIPRATRLFRHHALDFCCGGKQTLQRAAARQS
FT                   LDLAMLESQLAELDSAPQPHRDWQQAPLAELTAFIVTRYHQRHREQLPELVLMAQKVER
FT                   VHTDKVGCPRGLAKQLDSLRQELDGHMMKEERILFPLIEQGEGARCQGPISVMEHEHRD
FT                   AGERLEVIRFLTDNMTPPAGACTTWRALYAGISELINDLMEHISLENNLLFPRALNDT"
FT   gene            395460..396200
FT                   /locus_tag="ETAF_0328"
FT   CDS_pept        395460..396200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0328"
FT                   /product="3(2),5-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40452"
FT                   /db_xref="GOA:A0A0H3DQZ0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQZ0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40452.1"
FT                   /translation="MLEQICQLARDAGAAIMTVYQGDQPLALAYKGDQSPVTAADLAAH
FT                   EIIKAGLLRITPAIPLLSEEAPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIAL
FT                   IEQGVPTLGVVYVPTSGVLYCACDGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAEL
FT                   TDYLQQLGEHQTMMVGSSLKFCLVAEGIAQLYPRFGPTHIWDTAAGHAIAFAAGAQVRD
FT                   WQGKTLSYIPAESLLNPGFRVSLY"
FT   gene            396514..396720
FT                   /locus_tag="ETAF_0329"
FT   CDS_pept        396514..396720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40453"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40453.1"
FT                   /translation="MKIFQRYNPLLVAKYVKTLFRGRLYIQGVGAFEFDMGRILLPKVR
FT                   DKRHLSVMSEINRQVLRLQAEMA"
FT   gene            complement(396769..398115)
FT                   /locus_tag="ETAF_0330"
FT   CDS_pept        complement(396769..398115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0330"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40454"
FT                   /db_xref="GOA:A0A0H3DMR4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40454.1"
FT                   /translation="MLNSILLIILLIAISAFFSISEISLAASRKIKLKTMADEGDINAA
FT                   RVMALQDQPGYFFTVVQIGLNAVAILGGIVGDAAFSPAFRLLFDRFMPLEVSQQASFIC
FT                   SFVLVTGCFILFADLTPKRIGMIAPEAVAVRIVNPMRFCLLLFRPLVWFFNGLANLIFH
FT                   LFKIPMVRKDDITPDDIYAVVEAGALAGVLRKQEHEIIENVFELESRTVPSSMTPRESI
FT                   VYFDLGETEDSIKEKVSTHPHSKFLVCDGAIDHVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRNVLIVPDTLTLSEALESFKNAGEDFAVILNEYALVVGVITLNDVMTTLMGDLVGQG
FT                   QEEQIIARDENSWLVEGVTPIDDVMRVLDIEEFPQSSNYETIGGFMMYMLRKIPKRTDA
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLAERLPPMSPDADGDAEASQQADK"
FT   gene            398009..398131
FT                   /locus_tag="ETAF_0331"
FT   CDS_pept        398009..398131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPJ2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40455.1"
FT                   /translation="MVFSFIFREAARDISEIEKKALIAISKIISNILFNIIYPY"
FT   gene            complement(398389..399027)
FT                   /gene="msrA"
FT                   /locus_tag="ETAF_0332"
FT   CDS_pept        complement(398389..399027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="ETAF_0332"
FT                   /product="Peptide methionine sulfoxide reductase MsrA"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40456"
FT                   /db_xref="GOA:A0A0H3DPM8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPM8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40456.1"
FT                   /translation="MHHHNDSTPAPLTPAQALPGRTQAMSLSGIHALNGHDMYALPAGM
FT                   EEALFAMGCFWGVERLFWQQPGIYSTAAGYSGGLTPNPTYREVCSGQTGHAETVRVVFD
FT                   PALIRYDDLLRLFWQHHDPAQGMRQGNDIGTQYRSALFPVTPQQMQAAQASQARFAQAM
FT                   RQAGDLRPISTEICAAGPFYYAEEEHQQYLHKHPHGYCGLGGIGVCLPD"
FT   gene            399308..401044
FT                   /locus_tag="ETAF_0333"
FT   CDS_pept        399308..401044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0333"
FT                   /product="YtfM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40457"
FT                   /db_xref="GOA:A0A0H3DQZ4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQZ4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40457.1"
FT                   /translation="MPRLRRIGLLCLLLAAPLAHAAQVRLVVEGLSGQLQQNVRATLST
FT                   IDEDEISNDGRFRVRAADAIRQGLRALGYFQPTIEFEYRPGSTFSRPQLIANVTPGEPV
FT                   RIAGLNVRIRGAAKDDPAYQALLAKSLPPIGSVLDQGDYDNLKNALNSLALQRGYFGAT
FT                   MPVHQLGVIEDQHKAFWDIEFDSGPRYRFGDVRFSGSQIQTAYLQNLRPFKSGEYYSAD
FT                   DLAKFSGNLSATNWFNSVVVSPDFKALGADQTLPLQAVVTPRSQNMVDLGGGYATDVGP
FT                   RMKVSWKRPWMNSYGHSLDTSLNLSMPEQTADFSYKIPLLKAPLEQYYLVQGGFQRTDL
FT                   NDTQSDSTTLNLARYWELSSGWQRGINMRWSLDHFTQGNLTETAMLLYPGVSVNRTRSR
FT                   GGLMPTWGDTQRYSVDVSNRYWGSSVDFAVFQAQNVWIRTLAERHRFVVRGNLGWIETN
FT                   DFNKVPPSLRFFAGGDRSIRGYKYKSISPKGSDGKLTGASRLVTGSLEYQYNLSGKWWG
FT                   GVFIDSGEAVNDFTKSDFHTGTGVGVIWVSPVGPIRLNLGVPVGREDKHDVQIYIGLGP
FT                   EL"
FT   gene            401041..404808
FT                   /gene="ytfN"
FT                   /locus_tag="ETAF_0334"
FT   CDS_pept        401041..404808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfN"
FT                   /locus_tag="ETAF_0334"
FT                   /product="hypothetical protein YtfN"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40458"
FT                   /db_xref="GOA:A0A0H3DMD6"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40458.1"
FT                   /translation="MRWYNIRRYALMLLLGLFLLLALLLGGMMTQSGLHLALNAAARWV
FT                   PGLEIGRVEGGWRDLTLRDVGYRMPGVDVAVGQFHLSLDISCLKRSELCLNVLSAQRVR
FT                   VNVDTQALPPSEPQATPSAPLGRLSTPYPLVLRLLRLNDVQVTVDGTAITLDALRSGAE
FT                   WRGSQLRLQPSDIQGLRVSLPPSPAASSSAESAVPTVPSTPLGETLTALFSRPLLPAAM
FT                   RLDLPLDLQVSRISARQVQIRAATDLDITSLELRAALDQQRLALHTLKVQAQQGSLSAR
FT                   GSATFSGRWPLDLQLNASVNQAPLKGEKLRLALKGAMYDTLALDANLSGPLRATLKGDT
FT                   RLADAGLPLSLSLDSPSLRWPLGGTPDYQVNNMALRLTGSAHDYRLQLRGAFSGQGLPD
FT                   AALDLAGKGNERQFTLSQLQLATLGGKADMQALVDWSKAISWRSSLTLTGIDTGRQWPA
FT                   WPSSLNGKIETRGSLYGGSWQLQVPQLKLTGRIKQNALDVGGQLRGNQAGQWQIPQLHI
FT                   ALGRNRIEVNGDLAQKQWSLDARIDAPRLDGTLPGLAGTARGTLKLRGDRQAPQLLADL
FT                   QARGLRWQALTIQRVALLGDIRSDQQIQGSLDLRVDSLKQGDIDISQLTLRAAGNERKH
FT                   RLQLVMQGTPLAGRLTLNGSLAQDRARWSGTLTDTDFTTPVGEWRLTRPIALDYGVDKQ
FT                   QMAIGPHCWENPNARLCVPQTIEVGESGNVSVVLERFDLAMLQPFLGPDTQLHGRFSGR
FT                   AQARWQAGEGLPQARITLSGDGVKLAQQVQGNTLPVALSTVTLEASLAQGQARLNWLIG
FT                   IEGNGQLRGDVRVANLQGARNLSGNVDIQRLSLALLNPALMKGEKAQGMLNASLRLGGT
FT                   TLHPQLYGRLALDGVDIDGQFMPFDVTDANLAINFDGMSSVLQGVIKTSQGQLNLSGNA
FT                   DWRNMNAWRARIAASGTRLRVTVPPMVRLDVSPNIVFDASPSQLALSGRVDIPWARITV
FT                   QDLPESAVGVSSDEVMLNNAHQPIRPVSASIPLHTDLTIAIGNNVRLSAFGLKAALKGE
FT                   LKVSQNQNGLGLNGQIMIPQGRFAAYGQDLLIRQGELVFAGPPGNPLLNIEAIRNPEST
FT                   ANDVTVGVRVTGLAEQPKLEVFSDPAMSQQEALSYLLRGQGLDSSGADSNAMTSMLIGL
FT                   GVAQSGKLVGKIGETFGVSNLTLDSQGVGDSSQVVVSGYVLPGLQVKYGVGIFDSLATL
FT                   TLRYRLMPNLYLEAVSGVNQALDLLYQFEF"
FT   gene            404865..405155
FT                   /locus_tag="ETAF_0335"
FT   CDS_pept        404865..405155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40459"
FT                   /db_xref="GOA:A0A0H3DMS1"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40459.1"
FT                   /translation="MTNATWLGDYVLEGYDLYDLGHYPAVVPGEGRVYCEVYRITSSIL
FT                   AELDELKSNSKDYRRELIKTPYGCAWIYIYLNGVEGLPRIASGDWLKREED"
FT   gene            complement(405204..405734)
FT                   /locus_tag="ETAF_0336"
FT   CDS_pept        complement(405204..405734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0336"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40460"
FT                   /db_xref="GOA:A0A0H3DPJ8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPJ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40460.1"
FT                   /translation="MSLINVPAGKDMPEDIYVVIEIPANADPIKYEIDKDTGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLTKEYDHIQDVNDLPELLRAQIAHFFEHYKDLEKGKWVKVEGWADAAAAK
FT                   AEIIASFERAKNK"
FT   gene            complement(405839..406843)
FT                   /locus_tag="ETAF_0337"
FT   CDS_pept        complement(405839..406843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0337"
FT                   /product="Fructose-1,6-bisphosphatase, type I"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40461"
FT                   /db_xref="GOA:A0A0H3DPN5"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPN5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40461.1"
FT                   /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDIIGASGAENIQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDDIVIFEGDRANN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPLGTPVTRKDFLQPGNRQVAAGYVVY
FT                   GSSTMLVYTTGNGVHAFTYDPSLGVFCLSHERLRFPHSGNMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDSATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   SFLAEQAGGKATDGFRRILDIVPDALHQRCPFFVGSCAMVEDAERFMHQFPDA"
FT   gene            407010..408386
FT                   /locus_tag="ETAF_0338"
FT   CDS_pept        407010..408386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0338"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40462"
FT                   /db_xref="GOA:A0A0H3DR00"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR00"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40462.1"
FT                   /translation="MRIHILGVCGTFMGGLALLARQLGHDVTGSDANVYPPMSTLLQQQ
FT                   GITLLEGYDPAHLEPQPDLVIIGNAMARGNPCVEAILERNIPYVSGPQWLHDEVLRHRW
FT                   VIAVAGTHGKTTTAGMVNWILESCGYEPGFVIGGVPGNFSVSARLGKSPFFVIEADEYD
FT                   CAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLRAIQRQFHHLVRLVPGQGRIILPAG
FT                   DANLKQVMAMGCWSEQELCGDEAAWSATRLSTDASRFSVSLDGECVGEVEWALVGEHNM
FT                   HNGLMAIAAARHVGVPPAEACRALGSFINARRRLELRGQAYGVSVYDDFAHHPTAILAT
FT                   LAALRGKVGGTARILAVLEPRSNTMKMGVCKNELAPALGRADEVFLYQPQHIPWQVAEV
FT                   AEACVQPAHWSADLGTLVEMIVKNAQPGDHILVMSNGGFGDIHDRLLQALAQKSAAHQA
FT                   "
FT   gene            complement(408498..408662)
FT                   /locus_tag="ETAF_0339"
FT   CDS_pept        complement(408498..408662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40463"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40463.1"
FT                   /translation="MQPMGVITVSGLDGSIADIDQQLATKAQSQGASAFRIIEERIDGN
FT                   YHATALIYR"
FT   gene            complement(409118..409588)
FT                   /gene="argR"
FT                   /locus_tag="ETAF_0340"
FT   CDS_pept        complement(409118..409588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="ETAF_0340"
FT                   /product="Arginine pathway regulatory protein ArgR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40464"
FT                   /db_xref="GOA:A0A0H3DMS7"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40464.1"
FT                   /translation="MRNTTKQEDLTKAFKALLKEEKFSSQGEIVQALQELGFDNINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDHNDAIVVIHTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFTTPAKGFAVEQLYAAILALFEQEL"
FT   gene            410052..410990
FT                   /locus_tag="ETAF_0341"
FT   CDS_pept        410052..410990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0341"
FT                   /product="Malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40465"
FT                   /db_xref="GOA:A0A0H3DPK3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPK3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40465.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVTVRGFGGEDASPALEGADIVLISAGVARKPGMDRSDLFNINAGIIRNLIGQ
FT                   VARTSPNACIGIITNPVNTMVPIAAEVLKKAGVYNPNKLFGVTTLDIIRSNTFVGELKH
FT                   LDPTTLDIPVIGGHSGVTILPLLSQIPGVSLSEQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLAMGQAAARFALSLVRAMQGDENVVECGYVESDGEYARFFAQPLLLGKEGLVQRLNI
FT                   GTLSAFEQHALESMLEVLRKDIALGEDFINK"
FT   gene            complement(411096..411380)
FT                   /locus_tag="ETAF_0342"
FT   CDS_pept        complement(411096..411380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40466"
FT                   /db_xref="GOA:A0A0H3DPP1"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPP1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40466.1"
FT                   /translation="MKKTLPEDWHPAEIIAALHKRRLTLTQVSRNAGLSSSTLANALTR
FT                   PWPKGEWLIAEALSIHPSEIWPSRYYDPVTHELLDRKRLIRDAAAIKKI"
FT   gene            complement(411577..412548)
FT                   /locus_tag="ETAF_0343"
FT   CDS_pept        complement(411577..412548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0343"
FT                   /product="Octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40467"
FT                   /db_xref="GOA:A0A0H3DR06"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR06"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40467.1"
FT                   /translation="MNLEQITELTAQDMADVNARILHQLNSDVALINQLGYYIISGGGK
FT                   RIRPMIAVLAARALGYQGDRHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENY
FT                   MQVIYSKTARLFEAAAQCSAILAGADTAQEQALQDYGRYLGTAFQLIDDLLDYDADGKT
FT                   LGKNTGDDLNEGKPTLPLLHAMHHGSAERSAMIRQAIEQGNGRHLLEPVLETMQQAGSL
FT                   DYTRSRAEEEADKAIAALAPLPDSPHKQALIGLANLAVNRSF"
FT   gene            412808..413119
FT                   /locus_tag="ETAF_0344"
FT   CDS_pept        412808..413119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0344"
FT                   /product="LSU ribosomal protein L21p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40468"
FT                   /db_xref="GOA:A0A0H3DME6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40468.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQILMVANGE
FT                   DIKIGVPFVAGGKVKAEVVAHGRGEKVKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
FT   gene            413138..413395
FT                   /locus_tag="ETAF_0345"
FT   CDS_pept        413138..413395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0345"
FT                   /product="LSU ribosomal protein L27p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40469"
FT                   /db_xref="GOA:A0A0H3DMT2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40469.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIVAE"
FT   gene            413483..414418
FT                   /locus_tag="ETAF_0346"
FT   CDS_pept        413483..414418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0346"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40470"
FT                   /db_xref="GOA:A0A0H3DPK9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPK9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40470.1"
FT                   /translation="MESKQSAALGISLALTTAIFWGALPIAMKQVLPDMAPETIVWYRF
FT                   SMAALGLGSVLCLRGQLPPLRVFRQRRWLLLLSVATAGLLGNFILFSTSLQYLSPTTSQ
FT                   VIGQLSPVGLMFASVLVLKERMRPAQVIGAALLIGGLLLFFNTSLAEIFTRLTDYTLGV
FT                   LLGMAAAGVWVCYGIAQKVLLRRLASQQILCLLYALCAICLWPLAQPGQIYQLSGWQLL
FT                   CLLFCGVNTLVGYGALAEAMVRWQVAKVGAIVTLTPLFTLMFSDVLALAWPETFMTPSL
FT                   NTVGYIGAFVVVAGAMFSAIGHRWWPRQRA"
FT   gene            414467..415645
FT                   /locus_tag="ETAF_0347"
FT   CDS_pept        414467..415645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0347"
FT                   /product="GTP-binding protein Obg"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40471"
FT                   /db_xref="GOA:A0A0H3DPP6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPP6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40471.1"
FT                   /translation="MKFVDEAVIHIEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDVTIKVPVGTRITDVDTGEV
FT                   LGDMTRHQQKLMVGKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRDLSLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEKSFVVADIPGLIEGAS
FT                   EGAGLGIRFLRHLERCRVLLHLIDLAPIDESDPVENARVIIGELEKYSEKLAQKPRWLV
FT                   FNKTDLLAPEEAKARAQAIADALGWEGEHYLISAANREGVNALCWDVMNFLEAHPREAE
FT                   VEEEKEKAKKAEFMWDDYHREQLEQAEAEWEEEEDDDWDEDDDEGVEIIYQR"
FT   gene            complement(415691..416764)
FT                   /locus_tag="ETAF_0348"
FT   CDS_pept        complement(415691..416764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0348"
FT                   /product="Sensor protein basS/pmrB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40472"
FT                   /db_xref="GOA:A0A0H3DR12"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR12"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40472.1"
FT                   /translation="MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLSA
FT                   KVRTEQVDKEIREAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNL
FT                   TPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELME
FT                   QSGVPEATTLVQRIDQLMHTVEQLLMLSRVGQNFASGHYLQLELISEVVLAQRSELCEM
FT                   LALRGQHLRLETPSQLAMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSADEHGC
FT                   ILQVIDSGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPG
FT                   PGLNACCRLPLTPQDFG"
FT   gene            complement(416761..417423)
FT                   /locus_tag="ETAF_0349"
FT   CDS_pept        complement(416761..417423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0349"
FT                   /product="Transcriptional regulatory protein basR/pmrA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40473"
FT                   /db_xref="GOA:A0A0H3DMF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40473.1"
FT                   /translation="MKILIVEDDTLIQQGLAQAMARENYACDCAGNAASASALLQSGHY
FT                   SLIILDLGLPGMDGASALRQWRREGIDAPVLILTARDTVSDRVGGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRMQGLCNNALQVDDIHLDLSSQQVSCGGLPLEITPKEFAILTRLMM
FT                   RAGQTISREVLQQDLYSWQDELSSNSLEVHIHNLRRKLGKNRIKTLRGVGYRLEKTP"
FT   gene            complement(417433..418800)
FT                   /locus_tag="ETAF_0350"
FT   CDS_pept        complement(417433..418800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0350"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40474"
FT                   /db_xref="GOA:A0A0H3DMT8"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40474.1"
FT                   /translation="MQDYAQYLPEGTNLALMVQKVGSTTPTIDYHGQQMALPASTQKVI
FT                   TALAALLQLGPDFRFNTTFETRGQISAGALNGDLIVRFDGDPTLRRQNIRNMVAALKKQ
FT                   GVTRISGDILIDTSVFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSISLYSAPKAG
FT                   DRAFIRVASYYPVHMFSEVKTLARGSAEAPYCELDVVPGELNRYTLTGCLTQRADPLPL
FT                   AFAVQDGAAYAGAIVKDELQQANIDIAGHLRRETQVTPQGTILAQTQSAPLHDLLRVML
FT                   KKSDNMIADTVFRTIGHSYFNVPGTWRAGSDAVRQILRKKAGVNLGNSVVVDGSGLSRH
FT                   NLISPATMMEVLQYIAQNDSQLNFISMLPLAGYDGTLQYRGGLHEAGVDGKVSAKTGSL
FT                   QGVYNLAGFITTASGQRMAFVQYLSGYAVPPQDQRTRRQPLVRFESRLYRDIYRNN"
FT   gene            419115..419591
FT                   /gene="greA"
FT                   /locus_tag="ETAF_0351"
FT   CDS_pept        419115..419591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="ETAF_0351"
FT                   /product="Transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40475"
FT                   /db_xref="GOA:A0A0H3DPL3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPL3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40475.1"
FT                   /translation="MNQIPMTLRGAEKLREELDFLKGTRRPQIIAAIAEAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDVTKMPNNGRVIFGSTVSVENLDTEDQQT
FT                   YRIVGDDEADFKHNLISVNSPIARGLIGKEEGDVVTIKTPGGEVEYEILKVEYL"
FT   gene            complement(419734..420027)
FT                   /locus_tag="ETAF_0352"
FT   CDS_pept        complement(419734..420027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0352"
FT                   /product="RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40476"
FT                   /db_xref="GOA:A0A0H3DPQ1"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPQ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40476.1"
FT                   /translation="MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHE
FT                   LIKVKIAAEERETKTLIANAIVRETGACNVQLIGNILVIYRPSEERKISLPR"
FT   gene            420158..420784
FT                   /gene="ftsJ"
FT                   /locus_tag="ETAF_0353"
FT   CDS_pept        420158..420784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="ETAF_0353"
FT                   /product="Cell division protein FtsJ / Ribosomal RNA large
FT                   subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40477"
FT                   /db_xref="GOA:A0A0H3DR17"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR17"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40477.1"
FT                   /translation="MGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGSD
FT                   KIFRPGMTVVDLGAAPGGWSQYVVTQIGDKGRIIACDLLPMDPIVGVDFLQGDFRDELV
FT                   LGALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRSMYLVELALEMAKDVLAPGGSFVVK
FT                   VFQGEGFDEYLGQIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
FT   gene            420841..422781
FT                   /gene="ftsH"
FT                   /locus_tag="ETAF_0354"
FT   CDS_pept        420841..422781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="ETAF_0354"
FT                   /product="Cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40478"
FT                   /db_xref="GOA:A0A0H3DMF3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40478.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNSRRVDYSTFLTEVNQDQ
FT                   VREVSIDGRAINVTKKDGNRYTTYIPINDPKLLDSLLTKNVKVIGEPPEEPSLLTSIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEE
FT                   VGELVEYLRDPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   ATDIDASVIARGTPGFSGADLANLVNEAALFAARNNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPQGDSISYS
FT                   RQKLESMISVAYGGRLAEELIYGTEHVSTGASQDIKQATTIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEVFLGRSVAKTKHMSDETARIIDQEVKALIERNYQRARQLLADNMDIMHAMKD
FT                   ALMKYETIDAPQVDDLMARREVRPPAGWLDEQANRQAQAQQPAAQPAAAEQAADSDAAR
FT                   SDDDRHNDGEK"
FT   gene            422873..423706
FT                   /locus_tag="ETAF_0355"
FT   CDS_pept        422873..423706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0355"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40479"
FT                   /db_xref="GOA:A0A0H3DMU4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40479.1"
FT                   /translation="MLLRSRELTLNLNYPQVMGILNVTPDSFSDGGRHNALDAALRHAE
FT                   SMIVAGATIIDVGGESTRPGAAEVSEAEELARVVPVVEALTQRFEVWVSVDTSKAAVIR
FT                   ACSAAGADMINDVRSLSEPGALAAAAESGLPVCLMHMQGEPKGMQHSPHYSDVVAEVDA
FT                   YLSAQIARCVAAGIARERLLLDPGFGFGKNLTHNYRLLANLAHFHHHGLPLLVGMSRKS
FT                   MVGQLLNVPPAQRVAGSVACAVIAAMQGAQIIRVHDVRETVDAMRVVEATLSAKE"
FT   gene            423714..425051
FT                   /locus_tag="ETAF_0356"
FT   CDS_pept        423714..425051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0356"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40480"
FT                   /db_xref="GOA:A0A0H3DPL9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPL9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40480.1"
FT                   /translation="MSERKYFGTDGIRGKVGSSPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSIDGTKLPDEVEAAIEAELDKPLTCVESAELGKASRIVDAAGRYIEFCK
FT                   STFPNALSLSGLKIVADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDV
FT                   RALQARVVAENADLGMAFDGDGDRLIMVDHRGDKVDGDQILYIVAREALRQGKLHGGVV
FT                   GTLMSNMGLELALKQLGIPFARAKVGDRYVLETMQEKGWRMGAENSGHVIILDQTTTGD
FT                   GIVAGLQVLAAMARNHMSLADLCSGMTLLPQVLINVRFAGQCDPLQDAAVQQACAEVER
FT                   QLAGRGRVLLRKSGTEPLIRVMVEGEDLQQVTDLANVIADAVKAAS"
FT   gene            425238..425573
FT                   /gene="secG"
FT                   /locus_tag="ETAF_0357"
FT   CDS_pept        425238..425573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="ETAF_0357"
FT                   /product="Preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40481"
FT                   /db_xref="GOA:A0A0H3DPQ7"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPQ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40481.1"
FT                   /translation="MYEALLVIFLLVSVALIALIMLQQGKGADMGASFGAGASATLFGS
FT                   SGTGNFMTRTTGILATLFFVLSLVLGNLSGHQSKQGSEWDNLGQPVKTEQPATPAAPAT
FT                   PSSDIPN"
FT   gene            425627..425713
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3236"
FT   tRNA            425627..425713
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3236"
FT                   /product="tRNA-Leu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            425770..425846
FT                   /gene="trnM"
FT                   /locus_tag="ETAF_3237"
FT   tRNA            425770..425846
FT                   /gene="trnM"
FT                   /locus_tag="ETAF_3237"
FT                   /product="tRNA-Met"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            426092..426514
FT                   /locus_tag="ETAF_0358"
FT   CDS_pept        426092..426514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40482"
FT                   /db_xref="GOA:A0A0H3DR25"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR25"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40482.1"
FT                   /translation="MITAPVEALGFELVGIEFIRGRHSTLRIYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVAYYLEVSSPGMDRPLFTAEHYTHFLNEEVTLVLRMAMQNRRKWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNVQKANLVPHF"
FT   gene            426536..428023
FT                   /gene="nusA"
FT                   /locus_tag="ETAF_0359"
FT   CDS_pept        426536..428023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="ETAF_0359"
FT                   /product="Transcription termination protein NusA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40483"
FT                   /db_xref="GOA:A0A0H3DMF7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40483.1"
FT                   /translation="MNKEILAVVEAVSNEKALPREKIFEALETALATATKKKYEQEIDV
FT                   RVAIDRKSGDFDTFRRWLIVDEVTQPTREITLDAARFEDPALDLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDAFREHEGEIVTGVVKKVNRDSISLDLGNNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYAVRPEARGAQLFVTRSRPEMLIELFRIEVPEIGEEVIE
FT                   IKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDIAVEASNLAQAIGRNGQNVRLASQLSGWELNVMT
FT                   AEDLQAKHQAEAHAAIDTFTKHLDIDEEFATLLVEEGFSTLEELAYVPERELLSIDGLD
FT                   EETVEALRTRAKNALTTLALAQEESLGDNKPADDLLNLPGMERSVAFKLAARGVCTLED
FT                   LAEQGVDDLTDIEGLNNEQAGELIMAARNICWFGDSE"
FT   gene            428048..430753
FT                   /locus_tag="ETAF_0360"
FT   CDS_pept        428048..430753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0360"
FT                   /product="Translation initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40484"
FT                   /db_xref="GOA:A0A0H3DMV0"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40484.1"
FT                   /translation="MAEVTVKSLAAEIQTSVERLVQQLADAGINKSPDDSVSPQEREAL
FT                   LAHLNREHGGSSGKLTLQRKTRSTLSVPGTGGKSKSVQIEVRKKRTYVKSDAAAQQAEA
FT                   EALAKREAEEQAKREAEEQTQREMAEQAKREAAEQAKRQQEEQAKREAAEKAKREAAEK
FT                   EKVTNQHIDEKTKAAQAEKAKREAEAAELKRKAEEEARRKLEEDARKVAEEARRMAEAN
FT                   EGKWTENASEEDNSDYHVTTSHHAREAEDENDRQVEGDRRARGRGGKAAKQKKGSKLSE
FT                   SKADREEARAVNRGGKGGKRKPSSLQQGFTKPAQAVNRDVVIGETITVAELANKMAVKG
FT                   SQVIKSMMKMGAMATINQVIDQETAQMVAEEMGHKVILRRENELEEAVLNDRDTGAAAE
FT                   PRAPVVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVQTDNGMITFLDTPG
FT                   HAAFTAMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAGVPLVVAVNKIDKPEAD
FT                   PDRVKNELSQYGVMPEDWGGEAQFVHVSAKAGTGIDDLLDAILLQAEVLELKAVRNGMA
FT                   SGVVIESFLDKGRGPVATVLVREGTLHKGDIVLCGFEYGRVRAMRDELGREITEAGPSI
FT                   PVEILGMSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKAKLENMFSNMVE
FT                   GEVSELNIVLKADVQGSVEAIADSLRKLSTDEVKVKIVGSGVGGITETDATLAAASNAI
FT                   LLGFNVRADASARRVVEAENLDLRYYSVIYDLIDEVKQAMSGMLAPEYKQEIIGLAEVR
FT                   DVFKSPKFGAIAGCMVTEGVVKRHSPIRVLRENVVIYEGELESLRRFKDDVNEVRNGME
FT                   CGIGVKNYNDVRPGDVIEVFETIEVKRSID"
FT   gene            430850..431248
FT                   /locus_tag="ETAF_0361"
FT   CDS_pept        430850..431248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0361"
FT                   /product="Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40485"
FT                   /db_xref="GOA:A0A0H3DPM6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPM6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40485.1"
FT                   /translation="MAREFSRTQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRD
FT                   LAYTKVFVTFLNDGEPETVKAGLKALQDASGFIRMLLGKAMRLRVVPELTFAYDASLVE
FT                   GMRMSNLVSNVVKDDEARRTAADRDEEA"
FT   gene            431248..432210
FT                   /locus_tag="ETAF_0362"
FT   CDS_pept        431248..432210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0362"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40486"
FT                   /db_xref="GOA:A0A0H3DPR2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPR2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40486.1"
FT                   /translation="MSRPRRRGRDINGVLLLDKGQGMSSNDVLQKVKRIYNANKAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDADKRYRVIARLGQRTDTSDADGQVVCERPLSFS
FT                   EAELAQALEGFRGPGRQVPSMYSALKYQGRPLYEYARQGIDVPRESREITVFELRFIRW
FT                   EGDELELEIHCSKGTYIRTIIDDLGEVLGCGAHVIYLRRLQVSGYPSERMVTLEQLQAL
FT                   LAQAQQQERDPRLLLDPLLLPMDTAAAHLPEVNLSEIVAGYVQLGQPVQTPDLPQSGMV
FT                   RISVGAAHRFIGVGEVDDQGRLAPRRMVVESRLSEDDPT"
FT   gene            432359..432628
FT                   /locus_tag="ETAF_0363"
FT   CDS_pept        432359..432628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0363"
FT                   /product="SSU ribosomal protein S15p (S13e)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40487"
FT                   /db_xref="GOA:A0A0H3DR30"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR30"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40487.1"
FT                   /translation="MSLSVEAKAKIVAEFGRDANDSGSTEVQVALLTAQINHLQGHFAE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYSSLIERLGLRR"
FT   gene            432884..435007
FT                   /locus_tag="ETAF_0364"
FT   CDS_pept        432884..435007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0364"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40488"
FT                   /db_xref="GOA:A0A0H3DMG0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40488.1"
FT                   /translation="MLTPTVRKFQYGQHTVTLETGMMARQATAAVMVTMDDTAVFVTVV
FT                   GAKKAREGQDFFPLTVNYQERAYAAGRFPGGFFRREGRPGEGETLTARLIDRPIRPLFP
FT                   EGFLNEVQVVATVVSVNPQVSPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVL
FT                   NPTMDELKQSRLDLVVAGTDNAVLMVESEADLLSEDQMLGAVVFGHDQQQVVIENIKAL
FT                   AAEVGKPRWEWHAPEVNVALQHRVAEMAEARLGEAYHITEKQARYAKVDEIKESVIVDL
FT                   LAEDDALDAGEISDILGALEKAVVRGRVLRGEPRIDGREKDMIRALDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTERDAQNIDELTGERTDRFLLHYNFPPYSVGETGMMGSPKRR
FT                   EIGHGRLAKRGVLAVMPSQDAFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEQDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMDIKIEGITRE
FT                   IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPEKIKDVIGKGGSVI
FT                   RALTEETGTTIEIEDDGTVKIAATDGDKAKHAIRRIEEITAEIEVGRIYQGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVAVKVLEVDRQGRVRLSIKEANA
FT                   SAAAGQDAPADAE"
FT   gene            435127..436011
FT                   /locus_tag="ETAF_0365"
FT   CDS_pept        435127..436011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0365"
FT                   /product="Lipoprotein nlpI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40489"
FT                   /db_xref="GOA:A0A0H3DMV4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40489.1"
FT                   /translation="MKPILRWCYVATAILLAGCSNADWRQNEVLAIPLQPSLQQEVMLA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYSYARLNRGIALYYGGRYSLAQDDLQAFYQDDPND
FT                   PFRSLWLYLAERELNQEQALTALSQRYNKANRSQWGWNIVEFYLGKISEKTLMERLQAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGEKSSASALFKLTVANNVHNFVENRYALLELARL
FT                   GQEQDDIPESDQQ"
FT   gene            436185..438050
FT                   /locus_tag="ETAF_0366"
FT   CDS_pept        436185..438050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0366"
FT                   /product="Cold-shock DEAD-box protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40490"
FT                   /db_xref="GOA:A0A0H3DPN2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPN2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40490.1"
FT                   /translation="MAEFETTFADLGLAAPIIEALNDLGYEKPSPIQAACIPHLLNGRD
FT                   VLGMAQTGSGKTAAFSLPLLNNIDPSLKAPQVLVLAPTRELAVQVAEAMADFSKHMHGI
FT                   NVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLSLTSLRGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPAEHQTALFSATMPEAIRRITRRFMNEPQEVRIQSSVTTRPDISQ
FT                   SYWTVYGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYSSAALNGDMNQ
FT                   ALREQTLERLKDGRLDILIATDVAARGLDVDRISLVVNYDIPMDAESYVHRIGRTGRAG
FT                   RAGRALLFVDNRERRLLRNIERTMKLTIPEVELPNAELLSTRRLAKFAARVQQQLESSD
FT                   LDQYRALLAKLQPEDEQDMETLAAALLKMAQGERPLILPPDPVVERRPRREFRERDERG
FT                   GDRPRRERREVGDMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIRLFGSHSTI
FT                   ELPKGMPGDLLTHFTRTRILNKPMNMQLIGDAPAREQRRERSGERGGERRSFGGRDGGR
FT                   DGDRRSFGGQRRFSDDRRGDRGFNRDSRSTRSDDNGHSRRRFNDA"
FT   gene            438183..438299
FT                   /locus_tag="ETAF_0367"
FT   CDS_pept        438183..438299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPS0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40491.1"
FT                   /translation="MRYIYKKLGSPAHFFFPMHFFSFTPSAFASIEKEARYQ"
FT   gene            438661..439968
FT                   /locus_tag="ETAF_0368"
FT   CDS_pept        438661..439968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0368"
FT                   /product="Serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40492"
FT                   /db_xref="GOA:A0A0H3DR35"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR35"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40492.1"
FT                   /translation="MALTDHPAVTRDGMSDSEWREATRFDSTDVGWVIMSIGMAIGAGI
FT                   VFLPVQVGLMGLWVFLLSSVVGYPAMYLFQRLFINTLAESPECRDYPSVISGYLGKNWG
FT                   ILLGALYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSENPFYGLALICVLVAISS
FT                   RGELLLFKLSSFMVLTKLLVVAALGIAMVGVWHLYNVGALPPLGLLVKNAVITLPFTLT
FT                   SILFIQTLSPMVISYRAHCKSREVARYKALRAMNIAFGVLFVTVFFYAVSFTLAMGHDE
FT                   AVKAYQQNISALAIAAQFIDGGAGNWVTVVSVILNIFAVMTAFFGVYLGFREATQGIVM
FT                   NLLRRMMPPERIKARWVQNGIMVFAVLLAWGAIILNAPVLSFTSICSPIFGMVGCLIPA
FT                   YLVYRVPALHKYKGVSLLVIIITGLLLCISPLLAFS"
FT   gene            440013..441329
FT                   /locus_tag="ETAF_0369"
FT   CDS_pept        440013..441329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0369"
FT                   /product="Putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40493"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40493.1"
FT                   /translation="MNTIQNACDTDALWAEFIRAVRQEVKPAVGCTEPVSLALAAAIAA
FT                   RQLAAPVDRIVCRVSPNLMKNGMGVTVPGTGMVGLPIAAALGALGGDADAGLEVIKNAS
FT                   AASVAAARALLAEGRVSVGMEQPCEQVLLSCARVYAGEAWAEVTIAGDHTRVVRIVHND
FT                   REIFRAADVANAATEAGYCLAQASLAQVYRFACDVPLERISFILDAAELNGALSREGLR
FT                   SRYGLHIGATLAQQRERGLLSHDLLSEIMIRTSAASDARMGGAVLPAMSNSGSGNQGIT
FT                   ATMPVVVVAEHMQASQEQLARALMLSHLTAIYIHSKLPTLSALCAATTAAMGAAAGIAW
FT                   LIDGRYEAVAMAIGSMIGDVSGMICDGASNSCAMKVSTSASAAFKAVLMALDDSAVSGN
FT                   EGIVAHDVDQSIANLCALASGAMRQTDTQIIEIMARKAS"
FT   gene            complement(441390..442268)
FT                   /locus_tag="ETAF_0370"
FT   CDS_pept        complement(441390..442268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0370"
FT                   /product="Putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40494"
FT                   /db_xref="GOA:A0A0H3DMW0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40494.1"
FT                   /translation="MQFALGAVLYCWPQARLEAFYRAAAASEADIVYLGETVCSKRRVI
FT                   KSSDWLALARTLADSGKQVVLSTLALLQAPSELSELRRYIENGEFLIEANDLAAVNLAA
FT                   ERHLPFVAGPALNCYNAVTLRLLLRQGMVRWCMPVELSRDWLRNIRQQCDELGILGQFE
FT                   TEVFAYGHLPLAYSARCFTARAENLPKDECDTCCIRYPQGRRVLSQEQQQVFVLNGIQT
FT                   LSGYCYNLGNQLREMQGLVDIVRLSPQGEETLEMLSRFRANQQGEAPLTLARQAECNGY
FT                   WNQLAGLTLSS"
FT   gene            complement(442280..443275)
FT                   /locus_tag="ETAF_0371"
FT   CDS_pept        complement(442280..443275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0371"
FT                   /product="Putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40495"
FT                   /db_xref="GOA:A0A0H3DPN8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPN8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40495.1"
FT                   /translation="MELLCPAGNLPALKAAVENGADAVYIGLKDDTNARHFAGLNFNEK
FT                   KLQEALEYVHQRGRKLHIAINTFAHPDGYSRWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPHIERHVSVQASVTNEEAIRFYQRHFAVARVVLPRVLSLHQVKQLARCSPVPLEVF
FT                   AFGSLCIMSEGRCYLSSYLTGESPNTVGACSPARFVRWQQTPQGMESRLNDVLIDRYAN
FT                   DENAGYPTLCKGRYLVDGVRYHTLEEPTSLNTLALLPALMEANIASVKIEGRQRSPAYV
FT                   SQVTRVWRQAIDRCRRDPEHFTPDAAWMEALDAVSEGAQTTLGAYHRRWQ"
FT   gene            443579..444100
FT                   /locus_tag="ETAF_0372"
FT   CDS_pept        443579..444100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0372"
FT                   /product="Putative lipid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40496"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPS6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40496.1"
FT                   /translation="MLEQLRARIVRQGPAFLSLPLKVTPFVLQRHVLEQLLAWQFRQAL
FT                   AEGELAFLDGRWLQVDVRDLGLRWFVTVQQGTLRVGRQQQADVSFSADANDLILIAARK
FT                   EDPDTLFFQRRLRIEGDTELGLQVKNLMDAIDPELMPAPLRLALMQLADFVEAGLREGT
FT                   PIDARAVTSC"
FT   gene            444094..444597
FT                   /locus_tag="ETAF_0373"
FT   CDS_pept        444094..444597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0373"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40497"
FT                   /db_xref="GOA:A0A0H3DR41"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR41"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40497.1"
FT                   /translation="MLIRAEIPVDAPGIDRLLRRCFPGADEAELVSCLREDGLLTLGIV
FT                   ATDDEGGVVGYAAFSPVTVDGEECQWVGLAPLAVDEAYRRQGIAERLVYEGLDTLNEFG
FT                   YAGVAVLGDPRYYQRFGFVNAAQNDLHCRWPECDTLFQVYALAPQALEQARGRIEYAEP
FT                   FNRF"
FT   gene            444978..446411
FT                   /locus_tag="ETAF_0374"
FT   CDS_pept        444978..446411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0374"
FT                   /product="Proline/sodium symporter PutP / Propionate/sodium
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40498"
FT                   /db_xref="GOA:A0A0H3DMG6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40498.1"
FT                   /translation="MILIGLLAYRATNNFSDYILGGRRLGSVVTALSAGASDMSGWLLM
FT                   GLPGAIFVAGLSESWIAIGLVLGAYLNWRIVAGRLRVHTELNNNALTLPDYFTQRFEDK
FT                   QRILRLISALIILVFFTVYCASGVVAGARLFESTFGMSYESALWAGAAATIAYTFIGGF
FT                   LAISWTDTVQATLMIFALILTPVMVVVSVGGFDDAMNAIAQRSPAYLDLFRGLDWVAIV
FT                   SLMGWGLGYFGQPHILARFMAADSHHTIRKARRISIVWMIFCLGGAVAVGFFGIAFFST
FT                   HPELALEVHENKERVFISLSKLLFNPWIAGILLSAILAAVMSTLSCQLLVSASAVTEDL
FT                   YKAFLRKHANQRELVIVSRTMVMLIALIAIGLAANPHNYVLDLVSYAWAGFGAAFGPVI
FT                   IISLLWPGMTRNGALAGMLVGAATVVVWKQYAWFHLYEIIPGFILASLAIVLVSLVGKG
FT                   PSPQMRERFAQANTIYLTK"
FT   gene            446798..447253
FT                   /locus_tag="ETAF_0375"
FT   CDS_pept        446798..447253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40499"
FT                   /db_xref="GOA:A0A0H3DMW7"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40499.1"
FT                   /translation="MSNDDTLAAIRRFLARQHVVTLAVGQGEALWCADCFYALDAPTMT
FT                   LYLLTSPTSHHGRLMSVNPRVAGTVAHQTRSVAKIQGIQFHGRVACLEGEAAAAAYALY
FT                   YRRFPLARARPSPVWGLRLMRVKMTDNTCGFGHKRHWARQGEPVGVY"
FT   gene            447361..448035
FT                   /locus_tag="ETAF_0376"
FT   CDS_pept        447361..448035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40500"
FT                   /db_xref="GOA:A0A0H3DPP2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPP2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40500.1"
FT                   /translation="MNVLLLGATGLIGRALLTRLTSEPRVTQIYAPTRTALPASAKLIN
FT                   PVGADICRAMLEWDTPCDVAFCCLGTTRKAAGSDSDFRYVDYSLVVECGAVALQHGCRH
FT                   YVVVSALGANAQSPFLYSRTKGEMEQALELQAWRRLSLLRPSLLQGERAKPRLLEQISE
FT                   PLFRLLPEKWKAIEADSVARAMLHCALYPAEYRLQILESEQVQRLGETATGGADTGADQ
FT                   RR"
FT   gene            complement(448023..448487)
FT                   /gene="nrdG"
FT                   /locus_tag="ETAF_0377"
FT   CDS_pept        complement(448023..448487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="ETAF_0377"
FT                   /product="Ribonucleotide reductase of class III activating
FT                   protein"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40501"
FT                   /db_xref="GOA:A0A0H3DPT1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPT1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40501.1"
FT                   /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHQCPGCYNKATWRLDSGV
FT                   PFTTALEDRIIADLNDTRINHQGLSLSGGDPLHPHNVATILHLVQRVRTECRGKDIWLW
FT                   TGYRLEELTAEQQAVVALINVLVDGKFVQDLKDPMLIWRGSSNQIVHYLR"
FT   gene            complement(448571..450709)
FT                   /locus_tag="ETAF_0378"
FT   CDS_pept        complement(448571..450709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0378"
FT                   /product="Ribonucleotide reductase of class III large
FT                   subunit"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40502"
FT                   /db_xref="GOA:A0A0H3DR47"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR47"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40502.1"
FT                   /translation="MKPIVIKRDGCQVPFNEQRIKEAVLRAALAADVDDADYCATVARV
FT                   VAMQMADRERVDINDIQHAVENQLMAGNYKQLARAYIEYRHDRDVAREQRGRLNQDIRG
FT                   LIEQSNAALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHLLPRDVVQAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTNGFKMGNAEIERPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVSASFAKHRQIAEQWNIPDVEGYAHARTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWESRMIQQSILKNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KFGDPNYDIKQLALECASKRMYPDILNYDQVVNVTGSFKTPMGCRSFLGVYEENGEMIH
FT                   DGRNNLGVISLNLPRIALEAQGDEAAFWKLLDRRLALARKALMTRIARLEGVKARVAPI
FT                   LYMEGACGVRLKADDAIADIFKNGRASVSLGYIGIHETINALFGTQTHVFDDAALRAKA
FT                   IAIVERLRQATDTWKQETGYAFSLYSTPSENLCDRFCRLDTAEFGLVEGVTDKGYYTNS
FT                   FHLDVEKQVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGYTGEFECTSKGFTCPKCGNHDSTKVSVIRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRIKHLNNGQIG"
FT   gene            450734..450877
FT                   /locus_tag="ETAF_0379"
FT   CDS_pept        450734..450877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40503.1"
FT                   /translation="MCIHLPVIHSTKPREIRLYARCVDALWITTIYRCSFTSETLYMGM
FT                   AI"
FT   gene            complement(451119..451406)
FT                   /gene="yqjK"
FT                   /locus_tag="ETAF_0380"
FT   CDS_pept        complement(451119..451406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjK"
FT                   /locus_tag="ETAF_0380"
FT                   /product="Inner membrane protein YqjK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40504"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40504.1"
FT                   /translation="MNRQRQSLAAEKARLLQKIAQQRVDLHTESLRAEQLCINVDRTLT
FT                   TLWRLRRTLSLAAGLAAVYAARHPSRLLSGIKRAVGLWSTLRLARRTFYP"
FT   gene            complement(451403..451807)
FT                   /gene="yqjE"
FT                   /locus_tag="ETAF_0381"
FT   CDS_pept        complement(451403..451807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjE"
FT                   /locus_tag="ETAF_0381"
FT                   /product="Inner membrane protein YqjE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40505"
FT                   /db_xref="GOA:A0A0H3DPP7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPP7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40505.1"
FT                   /translation="MAGDTSPTQDSAAGILGTARRIVTLLVGMTETRLRLAVVELEEEK
FT                   ANLIQLLLMAGVTLLFTAFGLMCLLVLLFWAVEPAYRLMALGIATALLLLLACVGAIWT
FT                   LTKARRSTFLLATRKQLEIDRQLLERREKP"
FT   gene            complement(451807..452112)
FT                   /gene="yqjD"
FT                   /locus_tag="ETAF_0382"
FT   CDS_pept        complement(451807..452112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjD"
FT                   /locus_tag="ETAF_0382"
FT                   /product="Uncharacterized membrane protein YqjD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40506"
FT                   /db_xref="GOA:A0A0H3DPT7"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPT7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40506.1"
FT                   /translation="MTNDSTAEHLRAELKSLADALEDVLNSSTDKPKAELEKLRARAHD
FT                   ALHNSRERLSQAGENVATQTREMAGRADDYVRDNPWTGVGIGAAVGVVLGVLLARR"
FT   gene            complement(452385..452747)
FT                   /gene="yqjB"
FT                   /locus_tag="ETAF_0383"
FT   CDS_pept        complement(452385..452747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjB"
FT                   /locus_tag="ETAF_0383"
FT                   /product="hypothetical protein YqjB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40507"
FT                   /db_xref="GOA:A0A0H3DR52"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR52"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40507.1"
FT                   /translation="MLGLLLFIVAALTAVILPQLGHKEVSLQIRATHSGLATPDGFFVY
FT                   QKLDENGVSITSITPDREGLVVRLAHPEQQALALQVLQRELPPGYSIADKILHRSLFHK
FT                   SERPAAALSYSAGRNS"
FT   gene            complement(452800..453480)
FT                   /gene="yqjA"
FT                   /locus_tag="ETAF_0384"
FT   CDS_pept        complement(452800..453480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjA"
FT                   /locus_tag="ETAF_0384"
FT                   /product="DedA-family inner membrane protein YqjA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40508"
FT                   /db_xref="GOA:A0A0H3DMH0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40508.1"
FT                   /translation="MDIIRELITALWHQDYETLANPSLVWTIYGILFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIARDTMDFPLTLLVLTSAASLGCWVGYLQGRWLGNTHLVQKWLS
FT                   HLPAHYHQRAHQLFHRHGLAALLIGRFLAFVRTLLPLIAGLSGLNGPRFQFFNWISGLL
FT                   WVLILSSLGYVLGKTPLFLRYEDQLMNLLMLLPLVLLVFGLCGSLLVLWRKKHAHATGK
FT                   SPRK"
FT   gene            complement(453581..454045)
FT                   /locus_tag="ETAF_0385"
FT   CDS_pept        complement(453581..454045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40509.1"
FT                   /translation="MKRVTSASLLLLLCCWAATAIGKIGAWHSQAVTTLPLSQFPCNTA
FT                   VFSENYRDPAGSHCLSRIPHNRKITALIRLHICGGSEVVRNGLIPPDVPPPETRQPYRP
FT                   QAPGNDGHYARLSRILLRTLQLPPHQNRLGGWKESNILYRGQVTYHPALA"
FT   gene            complement(454236..454625)
FT                   /locus_tag="ETAF_0386"
FT   CDS_pept        complement(454236..454625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40510"
FT                   /db_xref="GOA:A0A0H3DPQ3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPQ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40510.1"
FT                   /translation="MNYGLTLLVVACGGALGAISRFQITNWFSAWFGSGFPYATLTVNV
FT                   IGCFIMGALVSMLNSGTLIAPHWRPLIGVGFLGALTTFSTFSFDTFALFSEGFWMKAML
FT                   NVVLNLILCMAAVSAGYYLLLSRSA"
FT   gene            complement(454910..455677)
FT                   /gene="exuR"
FT                   /locus_tag="ETAF_0387"
FT   CDS_pept        complement(454910..455677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuR"
FT                   /locus_tag="ETAF_0387"
FT                   /product="Hexuronate utilization operon transcriptional
FT                   repressor ExuR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40511"
FT                   /db_xref="GOA:A0A0H3DPU2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPU2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40511.1"
FT                   /translation="MECTRLYQQLAAELKQRVEGGVYPVGDKLPAERFIAEEMDVSRTV
FT                   VREAIIMLEVEGYVEVRKGSGIHVINNQPKSLIQPDNAIEFASAGPFELLQARQLIESN
FT                   IAEFAATQVTKQDIVALMEIQERARQEDRFRDSEWDLKFHVQVALATQNSAMATIVEKM
FT                   WSQRTHNPYWLKLHEHIDDKSIESWCEDHDKILKALIRKDPYGAKIAMWQHLENTKQML
FT                   FHATTDDFEFNVDRYLFAENPVVHLDAVANGGK"
FT   gene            complement(455850..457145)
FT                   /locus_tag="ETAF_0388"
FT   CDS_pept        complement(455850..457145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0388"
FT                   /product="Hexuronate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40512"
FT                   /db_xref="GOA:A0A0H3DR58"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR58"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40512.1"
FT                   /translation="MRKIKGLRWYMIGLVTIGTVLGYLTRNAIAVAAPALEDTLHITTQ
FT                   QYSYIIATYSACYTIMQPVAGYVLDLLGTKVGYAVFAVLWALFCMGTALANSWGGLAIA
FT                   RGAVGMAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGGMIAPPLVVWAIMVHSW
FT                   EMAFIITGALSLLWAIGWLIFYKQPQDQKRLSDEERQYILSGQEAQHKGDNATRMSAWQ
FT                   ILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADLGCV
FT                   IGGYLPPLFQKYFNVNLIVSRKLVVTLGAVLMIGPGMIGLFSSPYIAIALLCIGGFAHQ
FT                   ALSGSLITLSSDVFGRNEVATANGLTGMAAWTASTLFALVVGALADTLGFSPLFAALAV
FT                   FDLLGALIIWTVLQNRTANDPQPIPRPANANA"
FT   gene            457657..459066
FT                   /locus_tag="ETAF_0389"
FT   CDS_pept        457657..459066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0389"
FT                   /product="Uronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40513"
FT                   /db_xref="GOA:A0A0H3DMH3"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40513.1"
FT                   /translation="MSPFLTEDFLLDTEFARRLYHDYAAEQPIFDYHCHLPPEQIAENY
FT                   RFKNLYDIWLKGDHYKWRAMRTNGVAERFCTGEASDREKFQAWAETVPHTIGNPLYHWT
FT                   HLELRRPFGITDTLLSAATAEDIWTRCNRMLAEDSFTARGIMGQMNVKMVGTTDDPIDD
FT                   LRHHRTIAADSSFTTKVLPSWRPDKAFNIDAALFSDYIAKLGAVADVDITRFADLCQAL
FT                   KVRMDYFAAHGCKVSDHALDVVVYGEADDATLDGILARRLSGGTPSETEVAQFKTAVLL
FT                   FLGREYQQRGWVQQYHIGALRNNNTPMFARLGADIGFDSINDAPVAQPLSRLLDAQSRN
FT                   GGLAKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVAQGEAPADIALLGSMVKNICF
FT                   DNAKSYFAIEL"
FT   gene            459173..460651
FT                   /locus_tag="ETAF_0390"
FT   CDS_pept        459173..460651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0390"
FT                   /product="Altronate oxidoreductase"
FT                   /EC_number="1.1.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40514"
FT                   /db_xref="GOA:A0A0H3DMY5"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMY5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40514.1"
FT                   /translation="MQTLNRRDFPGRQHPDKVIQFGEGNFLRAFVDWQLDLLNEHTDLD
FT                   AGIVVVRPIDSDFPPSLNCQDGLYTTIVRGLNERGEAVSTSRVIRSVNRELNVYREFDA
FT                   FLALARDPNIRFVFSNTTEAGISYAPQDRLSDAPPSSFPAKLTRLLYERFCHFDGAADK
FT                   GWVLLPCELIDYNGEALRELVLRYAEQWDLPPAFTVWLTEHTTFCATLVDRIVTGYPRD
FT                   EATSLCDALGYQDSFLDTAEYFYLFVIQGPQWLAQALRLDAYAATQGPLNIRIVEDIRP
FT                   YKERKVAILNGAHTALVPVAYLAGLDTVGQSMDDAQVAAFVEQTIAQEIIPQLDLPIEE
FT                   LNAFSAAVIARFRNPYIQHQLLSIALNGMTKFRTRILPQLLSYRARQNAVPLRLSFALA
FT                   ALIAFYRGERDGLRYPLQDDAHWLAFYAAGWEAVRAGEQTLEQLVSAVLAQSAHWGEDL
FT                   NGVPGLTQQVSRALQAIEQQGMRAALGALLASSY"
FT   gene            460670..462160
FT                   /locus_tag="ETAF_0391"
FT   CDS_pept        460670..462160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0391"
FT                   /product="Altronate hydrolase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40515"
FT                   /db_xref="GOA:A0A0H3DPQ8"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPQ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40515.1"
FT                   /translation="MQSIIKIHPQDNVAVALRDLAAGETIALDDGALTLRDAVPRGHKV
FT                   ALCHLAPQAMVIKYGLPIGHALTPIAAGDHVHAQNLRTNLSDLDSYQYQPDFAAPTAQP
FT                   ADRAISLYRRASGEVAIRNELWILPTVGCVNGMARQMLQRFLRESDGASAIDGVHLFTH
FT                   PFGCSQLGDDHQNTRTLLQNMVHHPNAGGVLVVGLGCENNQIAAFRETLGDYDPARVRF
FT                   LVCQQQDDEVEAGTEALHELYGAMRGDRREPGRLSELKFGLECGGSDGFSGISANPLLG
FT                   RFSDYVIAHGGTSVLTEVPEMFGAERILMSRCRDGETFEKTVAMVNDFKRYFIDHQQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVMDVLRYGERLHTPGLNLLSAPGNDAVA
FT                   TSALAAAGCHMVLFSTGRGTPYGGFVPTVKLATNTPLAAKKPHWIDFDAGQLLQGKPMA
FT                   LLLSEFIDLIVAIADGRQTCNEKNDFRELAIFKSGVTL"
FT   gene            462222..462743
FT                   /locus_tag="ETAF_0392"
FT   CDS_pept        462222..462743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40516"
FT                   /db_xref="GOA:A0A0H3DPU8"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPU8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40516.1"
FT                   /translation="MSGELLFAQGVGIVAFLVGITTFFNRDERRFRLQLALYSAIIGAH
FT                   FFLMGASAAGMSAELNAIRSVVATRTRNVWIMALFIALTLGLGGWELKHPVEVLPIVGT
FT                   IASTWALFRCRGLTTRCVMWCSTACWVIHNLWLGSLGGSLIEGSFLLINGYNIVRFYRM
FT                   QRRGIDPFRS"
FT   gene            complement(462853..464073)
FT                   /locus_tag="ETAF_0393"
FT   CDS_pept        complement(462853..464073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0393"
FT                   /product="Putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40517"
FT                   /db_xref="GOA:A0A0H3DR63"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR63"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40517.1"
FT                   /translation="MRFITRGSLVGQILVGLVLGIALASFSQSGAIAAGLLGTLFVSAL
FT                   KAVAPVLVFILVAASIANHRQGQKTNMRPIVLLYLLGTFAAALVAVVVSFAFPSQLALV
FT                   SHTNDITPPGGIVEVLQSLLMNVVDNPFRALANGNFIGILAWAIGLGVALRHASDTTKR
FT                   VVGDLSYGVTFIVRVVIRFAPLGIFGLVSSTLAETGFDALWGYAHLLMVLIGAMLLVAL
FT                   VLNPLIVFWKIRRNPYPLVFTCLRESGLTAFFTRSSAANIPVNMELCKKLKLNEDTYAV
FT                   SIPLGATINMAGAAITITVLTLAAAHTLGISVDLPTALLLSLVAAVCACGASGVAGGSL
FT                   LLIPLACSLFGISSDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACVAAEESTG
FT                   DSAAELG"
FT   gene            complement(464446..465414)
FT                   /gene="terC"
FT                   /locus_tag="ETAF_0394"
FT   CDS_pept        complement(464446..465414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="ETAF_0394"
FT                   /product="Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40518"
FT                   /db_xref="GOA:A0A0H3DMH7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40518.1"
FT                   /translation="MLNSVGTPWLWGSFALIILIMLAIDLLLQGRRGAQAMTMRQAAVW
FT                   SLVWVSLALLFNAGLWLYLSETLGRAAADQQALAFLTGYLIEKALAVDNVFVWLMLFSY
FT                   FSVPANMQRRVLVYGVLGAIILRTIMIFAGSWLVTQFQWILYLFGAFLLFTGIKMAMAH
FT                   DDDGDLGDRPLVRWLRRHLRMTDCIESEHFFTRRSGTLFATPLLLVLILVELSDVIFAV
FT                   DSIPAIFAVTTDPFLVLTSNLFAILGLRAMYFLLAGVAERFTLLKYGLAAILTFIGIKM
FT                   LIVDFYHIPIAFSLGIVAGILALTLLINAGVNHRRASRAPR"
FT   gene            465799..466707
FT                   /locus_tag="ETAF_0395"
FT   CDS_pept        465799..466707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40519"
FT                   /db_xref="GOA:A0A0H3DMZ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMZ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40519.1"
FT                   /translation="MAVARKTNPLAIAGLIALTLIWSYSWIAMKQVTQYIGAFDFTALR
FT                   CVCGALLLLVVLHLRGRGMRPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
FT                   TMPFWVVIMAALFLGERMRRLQYVAIAAAALGLLLVLQPWKLDLSSLQSALLAVLSGIS
FT                   WGASAIVAKRMYARYPGIDLLGLTTWQMLYAAVVMSVVAWLVPQRSVDWQPYVFWALAY
FT                   SAILATALAWSLWLFVLKNLPAGIASLSTLAVPVCGVLFSWWLLGENPGPVEGCGIVLI
FT                   ALALAVISIKRQGPQAQSTRR"
FT   gene            complement(466742..467722)
FT                   /locus_tag="ETAF_0396"
FT   CDS_pept        complement(466742..467722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0396"
FT                   /product="Possible oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40520"
FT                   /db_xref="GOA:A0A0H3DPR4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPR4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40520.1"
FT                   /translation="MIRLAIIGTNWITRRFVDAALACGQYRLSAVYSRRLEQAADFAAP
FT                   YGAVHCFDSLDALACSPEVDAVYIASPNALHCAQTLLMLRHGKHVICEKPLASTHAEAQ
FT                   RAFDCARANGVVLFEAFKTAYLPNFDVIRSALPRLGRLRKAFLNYCQYSSRYPRYLNGE
FT                   NPNTFNPAFSNGSIMDIGFYCLASGVALFGEPQRVSAEAVLLDSGVDAHGHVAMRYPGL
FT                   EVLLFHSKVSDSALPSEIQGEEGSLVIEHLSQCQRVTLIPRGGVAQEIGVVQRENTMEY
FT                   EAQAFARLIREGRVAHAGVARALSTARLLDEIRRQTGVVFPADRA"
FT   gene            complement(467778..468281)
FT                   /locus_tag="ETAF_0397"
FT   CDS_pept        complement(467778..468281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0397"
FT                   /product="Putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40521"
FT                   /db_xref="GOA:A0A0H3DPV3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPV3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40521.1"
FT                   /translation="MTHLSYLAGYPEPLLAQVRTLLAQRRLGDTLRRRYPERHTITTDR
FT                   ALYDYAHSLKNLYMRNTPPLSRVQYDSRIQVIQQALGLHSVVSRVQGNRLKAKAEIRIA
FT                   SLFRQGPEALLRMIVVHELAHLREKNHDKAFYSLCCHMEPDYHQLEFDARLYLTCLDVE
FT                   GSVY"
FT   gene            468359..469504
FT                   /gene="rlmG"
FT                   /locus_tag="ETAF_0398"
FT   CDS_pept        468359..469504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmG"
FT                   /locus_tag="ETAF_0398"
FT                   /product="23S rRNA (guanine-N-2-)-methyltransferase RmG"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40522"
FT                   /db_xref="GOA:A0A0H3DR68"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR68"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40522.1"
FT                   /translation="MSQLESSAGCPAITGLTLARFPRQSDDPSLQAWEAADEYLLQQID
FT                   LTQAQGRPTIIFNDAFGALACALHELRPYSVSDSYVSQLATRHNLQLNDLDEDAVTLLD
FT                   SLSPLPEAPALVVIKLPKMLALLEQQLHALRAVVAPDTRIIAAAKARDIHTSTLQLFES
FT                   ILGETHTSLAWKKARLIYCQVGERAVTPAPATTVWPLEGTPYTMHNHAGVFSRGSLDIG
FT                   ARFFLQHLPEGIQGEVADLGCGNGVLGLAALSSSPQARVLFADESYMAVASARLNVQHN
FT                   RPQDLARCEFWVGNGLAGREGGTLDAVLCNPPFHQQHSITDQVAWDMFVAARRCLKRNG
FT                   ALYIVGNRHLDYYPKLRRLFGNCATLGMNRKFVVLKAVKTA"
FT   gene            469687..470844
FT                   /locus_tag="ETAF_0399"
FT   CDS_pept        469687..470844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0399"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40523"
FT                   /db_xref="GOA:A0A0H3DMH9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40523.1"
FT                   /translation="MDRRTLLKSSVALLGALSLSGPGSLARAQFVAQRPAAPDADHPLA
FT                   LNFNENALGMSAQAHQAIAAALPGAFRYPDAAREALIAALASEMALTPAHLSLGNGSSE
FT                   CIRAILQAQAIAAQRQGKAVQLVVPDPTFNYAELYLQPLGVEVVKVPLDAQLGFPLAEM
FT                   QRRTRAFNGLSLVYLCNPNNPTATLTPTDALAAWITQAPPDTFFVIDEAYAEFVNDPAF
FT                   RSAVALVQAGHENLLVTRTFSKLYALAGLRVGYGVAAPSVAAQSEALMSLDNTNSAGAA
FT                   AALASLQDRAFVEHSRKTTDLSRQIVCAALDELQLAYLPSQANFIFHQVNGDAARYQAR
FT                   MKQHHILVGRPFPPLNNWNRLTLGTPQEMQLFVAQLHAFRRQGWV"
FT   gene            complement(470872..472236)
FT                   /gene="qseC"
FT                   /locus_tag="ETAF_0400"
FT   CDS_pept        complement(470872..472236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseC"
FT                   /locus_tag="ETAF_0400"
FT                   /product="Sensory histidine kinase QseC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40524"
FT                   /db_xref="GOA:A0A0H3DMZ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMZ5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40524.1"
FT                   /translation="MRHLSRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNE
FT                   LFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLRKHRGDQDKDALAFAIFNADGRMLL
FT                   NDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALS
FT                   IVGAQMVPWLVALPVMVILLLLVVSRGLAPLHRLAAALRRRRPDDATPLPREAIPSEVW
FT                   PVVASLNTLFARTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDLALRQRAL
FT                   GQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRALAELLQTAVIDMDAKAHAAGVAL
FT                   ALSVDDPKVCRRIQPLLFSLLIRNLLDNAIRYSPTGSQVTLRLTSHRLQITDNGAGVSD
FT                   AVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHGMQVQFDHAPGGGFQATLRW"
FT   gene            complement(472236..472895)
FT                   /gene="qseB"
FT                   /locus_tag="ETAF_0401"
FT   CDS_pept        complement(472236..472895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseB"
FT                   /locus_tag="ETAF_0401"
FT                   /product="Two-component system response regulator QseB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40525"
FT                   /db_xref="GOA:A0A0H3DPR8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPR8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40525.1"
FT                   /translation="MRVLLIEDDRLIGDGIKAGLSKMGFTLDWFTDGQLGMTALESAPY
FT                   DAVILDLSLPGIDGLEILRRWREAGHAEPVLILTARDALEQRVTGLQQGADDYLCKPFA
FT                   LIEVAARLQALIRRNHGQAQTLLSHGAVSLDPLSLTATLDGASLPLKPKEFALLELLLR
FT                   NAGRVLPRSLIEEKLYSWDDDVSSNAVEVHIHHLRRKLGSHFIRTVHGVGYTLGDS"
FT   gene            473106..473510
FT                   /locus_tag="ETAF_0402"
FT   CDS_pept        473106..473510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0402"
FT                   /product="ygiW protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40526"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPV8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40526.1"
FT                   /translation="MMKKSAAIFAILALCSAPVLAQTGGFSGPGATQQVQNTQQSGGFV
FT                   GGQQAVTTVAKAKDLNDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTI
FT                   TPKDKVEIQGEVDKDWNTTKIDVKRLHKMN"
FT   gene            complement(473569..476001)
FT                   /locus_tag="ETAF_0403"
FT   CDS_pept        complement(473569..476001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0403"
FT                   /product="Pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40527"
FT                   /db_xref="GOA:A0A0H3DR73"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR73"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40527.1"
FT                   /translation="MTILQLNTLSERIRAHKEALIHIVTPPICTERAVHYTEAYQRHLD
FT                   KPVPVRRALALAEHLARRTIWINHDELIVGNQASRVRAAPIFPEYTVSWIEKEIDDLAD
FT                   RPGAGFSVTEEDKAVLHRVCPWWRGQTVQDRCYGMFTDEQKALLASGIIKAEGNMTSGD
FT                   AHLAVNYPLLLDLGLDGLRERVAARRRRIDLTQLDDLHGEQFLKAVDITLEAVSQHCLR
FT                   FAALARRMVVDEPRAERRSELLTIADGCEHIAHRPPQTFWQALQLCYFIQLLLQIESNG
FT                   HSVSFGRMDQYLYPWYRRDVELEQRLSREQAIELLQSCWLKLLEVNKIRSGTHSKASAG
FT                   SPLYQNVTIGGQNLVDGTPQDAVNPLSYAILESCGRLRSTQPNLSVRYHAGISDDFLEA
FT                   CTQVIRCGFGMPAFNNDEIVIPAFIDLGVAPQDAYQYAAIGCIETAVAGKWGYRCTGMS
FT                   FINVARVMLAALEGGRDATSGDVFLPQPQALSLGNFADFEQVMAAWERQIRYYTRKSIE
FT                   IEYVVDTALEENAHDILCSALVDDCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAV
FT                   KKLVFEQGSISQQDLADALAQDFNGPQYELLRQRLLNGAPKYGNDDDSVDALLVRAYDS
FT                   YIDELSHYRNPRHGRGPVGGGYYAGTSSISANVPFGAATLATPDGRKAHTPLAEGASPA
FT                   SGTDRIGPTAVMGSVGKLPTRAILGGVLLNQKLNPATLENERDRQKLMLLLRTFFEVHK
FT                   GWHIQYNIVSRDTLLDAKAHPERYRDLVVRVAGYSAFFTALSPDTQDDIIARTEHVL"
FT   gene            complement(476006..476905)
FT                   /locus_tag="ETAF_0404"
FT   CDS_pept        complement(476006..476905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0404"
FT                   /product="Pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40528"
FT                   /db_xref="GOA:A0A0H3DMI1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40528.1"
FT                   /translation="MIFNIQRYSTHDGPGIRTVIFLKGCSLACRWCQNPESLTRTPQLL
FT                   YDERSCLTGCSLCQQAAPAVAIRTGQGLTLLRQRADADTLERLRDCCPSQALTVCGEAL
FT                   AVEEILRQAERDRPFYQRSGGGITLSGGEPFMQPTLAETLLRRCHQSGIHTAVETCLHV
FT                   PWRYIAPALPYTDLFLADLKHVDEARFREWTGGSARRVMDNLTRLAAAGATLILRVPLI
FT                   PGFNANLDDIRRIVDFAAVALTVREIHFLPYHTLGRNKYRLLGQPYLAPAQPLNDPALL
FT                   DAARDYACQRGLSVILGG"
FT   gene            477049..477711
FT                   /locus_tag="ETAF_0405"
FT   CDS_pept        477049..477711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0405"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40529"
FT                   /db_xref="GOA:A0A0H3DMZ8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMZ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40529.1"
FT                   /translation="MELYLDTADCAAVQRLARILPLAGVTTNPSILARSGLSPAQALPR
FT                   LYDALGGHGRLFAQVMANDAQGMVSEARALRAIVDNLVVKVPVTSEGLAAIKLLKQEGI
FT                   PTLGTAVYGAGQGLLAALAGADYIAPYVNRLDAQGGDGIKTVEALQRLLTLHAPQASVL
FT                   AASFKNARQALDCLLAGCGAITLPIEVAEQFISAPAVTAAVAQFEQDWQDAFGRRTL"
FT   gene            complement(477941..478016)
FT                   /gene="trnM"
FT                   /locus_tag="ETAF_3238"
FT   tRNA            complement(477941..478016)
FT                   /gene="trnM"
FT                   /locus_tag="ETAF_3238"
FT                   /product="tRNA-Met"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            478152..478664
FT                   /locus_tag="ETAF_0406"
FT   CDS_pept        478152..478664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0406"
FT                   /product="G:T/U mismatch-specific uracil/thymine
FT                   DNA-glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40530"
FT                   /db_xref="GOA:A0A0H3DPS2"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR023502"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPS2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40530.1"
FT                   /translation="MSVDILAPGLRVVFCGINPGLSSAHTGYHFANPRNRFWSVIHLAG
FT                   FTDRQLAPQEERHLLDTGCGITALVQRPTVTAAELTAAELRAGGDALQAKIARYQPRAL
FT                   AVLGKQAFTQAFGIRRPAWGRQALRIGDTMLWVLPNPSGLNRATLAALVESYRALYLAL
FT                   TPQERGA"
FT   gene            complement(478767..480602)
FT                   /locus_tag="ETAF_0407"
FT   CDS_pept        complement(478767..480602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0407"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40531"
FT                   /db_xref="GOA:A0A0H3DPW4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPW4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40531.1"
FT                   /translation="MEQNPQSQLKLLVTKGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVMEEAPDADDLMLAENIADEDAAEAAVQVLSSVESEIGRTTDPVRMYMRE
FT                   MGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEASEARLSDLIT
FT                   GFVDPNAEEDMAPTATHVGSELPEEELDDDEDEDEDEDDDSDDDNSIDPELARQKFVEL
FT                   REQYEKTRLAIKAEGRSSGKAQEEIQNLSEIFKQFRLVPKQFDYLVSNMREMMDRVRGQ
FT                   ERLIMKLCVEQSKMPKKNFITLFTGNETSITWFDAALAMGKPWGEKLKDMREDVERSLQ
FT                   KLHQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQF
FT                   LDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETI
FT                   NKLNRISRQMLQEMGREPTPEELAERMMMPEDKIRKVLKIAKEPISMETPIGDDEDSHL
FT                   GDFIEDTTLELPLDSATSESLRSATRDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGK
FT                   QFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(480838..482586)
FT                   /locus_tag="ETAF_0408"
FT   CDS_pept        complement(480838..482586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0408"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40532"
FT                   /db_xref="GOA:A0A0H3DR79"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR79"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40532.1"
FT                   /translation="MAGRIPRVFINDLLARTDIVELVDARVKLKKQGKNYHACCPFHSE
FT                   KTPSFTVNADKQFYHCFGCGAHGNAIDFLMNYDRLEFVESIEELATMAGLEVPYESGSG
FT                   PSQMERHQRQNLYQLMDSLCGYYQQSLRQPGATQAQQYLTGRGMSQAIMDRFAIGYAPQ
FT                   GWDNALKRFGRDAGGRTALNDAGMLVNNENGRSYDRFRDRIMIPIRDKRGRVIAFGGRV
FT                   LGNGTPKYLNSPETEIFHKGRQLFGLYEALQHAAQPERLLVVEGYMDVIALAQYGVNYA
FT                   VASLGTSTTAEHIQLLFRHTDSVVCCYDGDNAGREAAWRALETALPYLSDGRQLKFMFL
FT                   PEGEDPDTLIRQEGAEAFERRMNDAHPLSAFLFDSLLPQVDLSTPDGRAKLSALALPLI
FT                   GQVPGETLRLYLRQSLGQKLGILDDSQLEKLLPRRSEAVKNYQPPRLKPTTMRILIALL
FT                   VQNPALAAEVPTLDGLRQHPLPGLPLFIELVETCLAQPGLTTGQLLELYRDNKYASQLE
FT                   TLATWNHMIIEPMVLETFVDTLGSLYDAVLEQRLEQLIARARTDGLTPAEREEVRSLNE
FT                   ALAKKN"
FT   gene            complement(482774..482989)
FT                   /locus_tag="ETAF_0409"
FT   CDS_pept        complement(482774..482989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0409"
FT                   /product="SSU ribosomal protein S21p"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40533"
FT                   /db_xref="GOA:A0A0H3DMI6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40533.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            483203..484228
FT                   /locus_tag="ETAF_0410"
FT   CDS_pept        483203..484228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0410"
FT                   /product="putative endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40534"
FT                   /db_xref="GOA:A0A0H3DN01"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN01"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40534.1"
FT                   /translation="MRILGIETSCDETGIAIYDDEKGILANQLYSQIKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALREADLTPADLDGVAYTAGPGLVGALLVGATVGRSLAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPVLSKMAQQGVAGRFVFPRPMTDRPGLDLSFSGLKTFAANTI
FT                   HANGDDAQTRADIARAFEDAVVDTLAIKCRRALDQTGFTRLVMAGGVSANRALRARLAQ
FT                   MMQQRGGAVFYARPEFCTDNGAMIAYAGMVRLKSGVDADLSISVRPRWPLAELPPVAAD
FT                   R"
FT   gene            complement(484250..484912)
FT                   /gene="plsY"
FT                   /locus_tag="ETAF_0411"
FT   CDS_pept        complement(484250..484912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsY"
FT                   /locus_tag="ETAF_0411"
FT                   /product="Acyl-phosphate:glycerol-3-phosphate
FT                   O-acyltransferase PlsY"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40535"
FT                   /db_xref="GOA:A0A0H3DPS9"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPS9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40535.1"
FT                   /translation="MSATALGMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGATN
FT                   VLRIGGRLAAAAVLIFDVLKGMIPVWLAYKLEVSPFYLGLTAIAACLGHIYPVFFRFRG
FT                   GKGVATAFGAIAPIGWDLTGLMVGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILVRHHDNIQRLWRGKEGKIWKKKGAKGAQDSERQATPPRDDEPPTPR"
FT   gene            485091..485456
FT                   /locus_tag="ETAF_0412"
FT   CDS_pept        485091..485456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0412"
FT                   /product="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40536"
FT                   /db_xref="GOA:A0A0H3DPW8"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPW8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40536.1"
FT                   /translation="MDIVFIEGLTVVTTIGVFEWEQTIRQRLVFDVELGWDNRRAAQSD
FT                   DVAHCLSYAEVSEAILQHVEPNRFALVERVAEEVAALLMARFNTPWVRLRVSKPGAVAQ
FT                   AHSVGVVIERGCRTADV"
FT   gene            485505..486323
FT                   /locus_tag="ETAF_0413"
FT   CDS_pept        485505..486323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0413"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40537"
FT                   /db_xref="GOA:A0A0H3DR84"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR84"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40537.1"
FT                   /translation="MDLHTLLNAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFEGDKAK
FT                   TFEVIIQLGSILAVVVMFWRRLFGLIGIHFGRPVAREGCGQGQLKLGHIVLAMIPAVVL
FT                   GLLFHDFIKSLFTPLTVAYALVVGGLLLLAAEWLKPTQARAVGLDDITYRQAFMIGCFQ
FT                   CLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGASALELYKSLPYLSLGD
FT                   LPMFSVGFVTAFVVALIAIKTFLNVIKRISFVPFAIYRFIVAAAVYLVFC"
FT   gene            complement(486358..487602)
FT                   /locus_tag="ETAF_0414"
FT   CDS_pept        complement(486358..487602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0414"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40538"
FT                   /db_xref="GOA:A0A0H3DMJ1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40538.1"
FT                   /translation="MKTYLVGGAVRDKYLQLPTQDRDWVVVGATPQALLAQGYQQVGKD
FT                   FPVFLHPRSKEEYALARTERKAGQGYTGFSTYFAPDVTLEQDLLRRDLTINAMAEDDEG
FT                   QLIDPYGGLQDLRQRQLRHVSEAFVEDPLRVLRVARFAARFAPLGFQVAAPTLALMQRM
FT                   SQRGELAHLTPERVWLETEKALSGPAPQVYFQVLRDCGALAVLFPEIDRLFGVPAPAQW
FT                   HPEIDTGIHTLLTLAMASHLSDDVAVRFAALTHDVGKGLTNPNFWPHHHGHGPAGVRLV
FT                   REMCQRLRTPNPVRDLALLVAEYHDLIHTVERLRPATLLKLLDTIDVWRRPQRLQHMIL
FT                   CSEADARGRTGLEEQPYPQADYLRAAYHQVAQVAVREVIADGFQGAAIREELQTRRLQV
FT                   LKRWKAAQEAALNAE"
FT   gene            complement(487724..488341)
FT                   /locus_tag="ETAF_0415"
FT   CDS_pept        complement(487724..488341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0415"
FT                   /product="Arylsulfatase"
FT                   /EC_number="3.1.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40539"
FT                   /db_xref="GOA:A0A0H3DN04"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN04"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40539.1"
FT                   /translation="MHLFRRLLLPLLSLCLAFQSHAEEQRFISDALSTYVHSGPGNQYR
FT                   IVGTINAGDPVTLLGINQQSQFAQIRDAKGRSVWLPLDQLSNQPSLRTRVPALEAQLSA
FT                   LTAKLSHIDGEWQQKTAEMQSKVAGSDDAIARLQAENQQLRQQLSSAQKSLGALNSQLD
FT                   DKKRAIILQWFLYGGGVAGAGLLLGLLLPRLLPRRQKARWMN"
FT   gene            complement(488551..489816)
FT                   /locus_tag="ETAF_0416"
FT   CDS_pept        complement(488551..489816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0416"
FT                   /product="Putative low-affinity inorganic phosphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40540"
FT                   /db_xref="GOA:A0A0H3DPT6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPT6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40540.1"
FT                   /translation="MEIIANHGSLLIIVAAFFGLLMAIGIGANDVANAMGTSVGARAVT
FT                   IRQAIVIAMIFEFAGAYLAGGEVTQTIRSGIIDTSAFAGHPQTLVFGMMASLLAAGIWL
FT                   IVASLMGWPVSTTHSIIGAIIGFACVSVGPEAVEWGGVKGIVGSWIITPLISGVVAYGI
FT                   FLSAQRLIFNTENPFANARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLVSL
FT                   LVSLLVMLGGYLYLSRKSFTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANA
FT                   IGPLSAIVAIVRDPSVLAGTSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTP
FT                   SRGFAAQFATASTVVIASGTGLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWI
FT                   VTLPAGAALSIALFYLLQAVFG"
FT   gene            complement(489839..490447)
FT                   /locus_tag="ETAF_0417"
FT   CDS_pept        complement(489839..490447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0417"
FT                   /product="Phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40541"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPX3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40541.1"
FT                   /translation="MHECCSLLVPFFAATAQQQWDQAQEIREQISNLEKQADTLKREIR
FT                   LKLPRGLFLPVDRGDMLELVTQQDRLANRAKDIAGRVIGRRLQIPAVMQADFVSYLQRC
FT                   LDATALSSKVIHEMDELLETGFRGREADLVEQMVMELDHIEDDTDHQQILLRQTLLSLE
FT                   HQLNPVDIMFLYQIIEWVGGLADKALRVGSRLELMLARS"
FT   gene            complement(490562..490822)
FT                   /locus_tag="ETAF_0418"
FT   CDS_pept        complement(490562..490822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR89"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40542.1"
FT                   /translation="MATQSLARRLIIDIAQCLGGRMLKRPTGQARGQCVYSGREGDEFQ
FT                   FNFHGHFFCHIKVLPRCSALLGKKCKNGVQCRAHQLPCAPF"
FT   gene            490811..491974
FT                   /locus_tag="ETAF_0419"
FT   CDS_pept        490811..491974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0419"
FT                   /product="Adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40543"
FT                   /db_xref="GOA:A0A0H3DMJ7"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40543.1"
FT                   /translation="MRRHDMGLRIRGCDGAYEMTLKTAGSDVGGLHQRPEYNVALDAPQ
FT                   LDLRRFPAQAWPEGCDVDALQTALQPLFSTDFQRERWEVTYRESQIEVALDRGDIRAAG
FT                   ESEGLHEIELELLRGERDDLFAFAEQLLTLEGIRMGAMSKAARGYRLAAGNAALRRRAF
FT                   PLLRPAARASVEQGMSAALAQILAHWQYHEEAWLRGDAASRGGIQEALTALRQSLTLFG
FT                   GIVPRKASATLRAGLSALEEQIQQPTCVAQTLCYGRESLTTQWALTRWLAESGWRAYLD
FT                   AAGSAKLSGSFKRFADIMLGRCGAELKALFAQVRHPQEYQDKLPRLQHQILAIRLLGGA
FT                   YGEAAVEDYLAPWQTLAQAIVHPAAVTAEAACAQALHQPAFWRNGAH"
FT   gene            492054..494891
FT                   /locus_tag="ETAF_0420"
FT   CDS_pept        492054..494891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0420"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40544"
FT                   /db_xref="GOA:A0A0H3DN07"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN07"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40544.1"
FT                   /translation="MSETRALPALLHSQGARQAARLRDATSAALPALALSDFVADSLAA
FT                   YPAWWQQLQQLPPQVQEWQQYAGWLAERLAQVQDESTLMQALRLFRRHMLTRIAWMQAR
FT                   AQADCQQTLLQLSALAETLVIGARDWLYHRACQEWGVPCNAAGEAQPLLILGMGKLGGG
FT                   ELNFSSDIDLIFVYPQSGATRGGRRELDNAQFFTRLGQRLIKALDQPTEDGFVYRVDMR
FT                   LRPFGDSGPLVLSFSALEDYYQEQGRDWERYAMVKARLLGEGQDRYGQELYRLLRPFVF
FT                   RRYIDFSVIQSLRNMKGMIAREVRRRGLKENIKLGAGGIREIEFITQVFQLIRGGRERS
FT                   LQQRALLPALAAIGELGLLTAAQVAALRDAYLFLRRLENLLQAIDDQQTQTLPSDDLNR
FT                   ARLAYGMGLADWAALSRALQEHMAAVRAIFNALIGDDDQDEEERGDDAALRFAPLWQER
FT                   LDESELAALMPQLDPAQRLRLQQTLEAFHRDVDKRTIGPRGREVLATLMPTLLAQVCVR
FT                   DDALVLQQRLMPLLLNIVTRTTYLELLMEFPAALHQLIRLCAASPMLAEQLARYPLLLD
FT                   ELLDPVTLYRPVDQGAYRDELRQYLLRIPDDEEQRLEALRQFKHAQQLRIAASDIAGAL
FT                   PVMKVSDHLTYLAEAVIEAVVQQAWEQMVARYGQPTHLVDHGQRGFAVIGYGKLGGWEL
FT                   GYGSDLDLVFLLDCPAEVMTDGPRCIDGRQFYLRLAQRIMHLFSARTASGILYEVDARL
FT                   RPSGAAGMLVSTLTAFGDYQRSEAWTWEHQALVRARPVYGDVQMHRQFDAIRREILCRE
FT                   RDAATLRCEVAEMREKMRTHQGSRDAAQFDIKADRGGIVDIEFIAQYLVLRYGAEQPDL
FT                   TRWSDNVRIFELMAQYAVMPQAEADALTHAYVTLRNTLHHLALQAQPGVVESTRFADAR
FT                   ARVCESWQRWLGTAR"
FT   gene            complement(494902..495831)
FT                   /locus_tag="ETAF_0421"
FT   CDS_pept        complement(494902..495831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0421"
FT                   /product="Lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40545"
FT                   /db_xref="GOA:A0A0H3DPU1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPU1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40545.1"
FT                   /translation="MSDNHVYPQFQRSMLHPRYWLTWLGIGIFYLVMLLPYPWLYRLGK
FT                   MLGKTAMRFMKKRVEVTRRNLALCFPQMPAAQREAWVRQNFESVGMALVETGMAWFWPD
FT                   WRIRRWCRVEGEENLRQAKQTGKGILLIGMHFLTLELGARIFGMHNPGVGVYRPNDNPV
FT                   LDWLQTWGRLRSNKYMLDRRDVKGMIRALKEGEIVWYAPDHDYGPRSSVFVPLFAVAQA
FT                   ATTTGTYILARMGQPTLLPFIPLRNADGSGYTLRIQPMLQDVPLDDQTTTAAYMNRVVE
FT                   REIMLAPTQYMWLHRRFKTCPPGVASRY"
FT   gene            495938..497371
FT                   /locus_tag="ETAF_0422"
FT   CDS_pept        495938..497371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0422"
FT                   /product="ADP-heptose synthase /
FT                   D-glycero-beta-D-manno-heptose 7-phosphate kinase"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40546"
FT                   /db_xref="GOA:A0A0H3DPX6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPX6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40546.1"
FT                   /translation="MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVET
FT                   IEERPGGAANVAMNIASLGANARLVGLTGVDDAARALSARLDEVHVECDFVAIPTQPTI
FT                   TKLRVLSRNQQLIRLDFEEGFGGVDPEPILARIRQALPQLGAMILSDYAKGALASVQAM
FT                   IRLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMDR
FT                   FDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLATSIAAGTSLE
FT                   EACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTRRLKGPERPVNPLTQRMLV
FT                   LAALESVDWVIPFEEDTPQRIIAEILPDLLVKGGDYRPEEIAGGKEVIAAGGDVRVLNF
FT                   EDGCSTTNIINTIRQGQND"
FT   gene            497433..498650
FT                   /locus_tag="ETAF_0423"
FT   CDS_pept        497433..498650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0423"
FT                   /product="Putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40547"
FT                   /db_xref="GOA:A0A0H3DR93"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR93"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40547.1"
FT                   /translation="MQGVGMLSTSLLGTGVFAVPALAAQVAGDDSLWAWPLLIVLVFPI
FT                   AIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPASLQIAAGFWQAL
FT                   FGWQGAPLLAVELITLLAVWLLGTRGAGSSANLQTLIALLVVLLIAAVWWRGGISPTQI
FT                   PWPVPSQLSLSPLTGALAVMFWCFVGLEAFAHLASEFRHPQRDFPRALLLGLLLAGAVY
FT                   WACSVAVLHFHAFGDGRAAAASLPGIVVQLFGRHALWIACVIGYLACFASLNVYIQSFA
FT                   RLVWSQAQRRPQSRLAQLSARQAPVNALTSVMLCCLLCSLLIYLSGLSLDALIVYANGV
FT                   FIMIYLLCMLAGCRLLRGHARLMALTGSVLCLLLLAMVGVKSLYALGMLLVLYLLLPRR
FT                   AASHGG"
FT   gene            complement(498671..498937)
FT                   /gene="yqiC"
FT                   /locus_tag="ETAF_0424"
FT   CDS_pept        complement(498671..498937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiC"
FT                   /locus_tag="ETAF_0424"
FT                   /product="hypothetical protein YqiC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40548"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40548.1"
FT                   /translation="MIDPKKIEQIARQVHQSMPKGLREFGDDMEKRVRQILQQQLSRLD
FT                   LVNREDFEIQTQVLLRTREKLALLEQRVAALEARLNDAEDGQA"
FT   gene            499294..500082
FT                   /locus_tag="ETAF_0425"
FT   CDS_pept        499294..500082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0425"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40549"
FT                   /db_xref="GOA:A0A0H3DN09"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN09"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40549.1"
FT                   /translation="MGESNDICRDSPARVILAAPLRVPLLKFALVLVIHTIIDEVFTMN
FT                   QILLSDFGTPMERVERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRH
FT                   GSGIVCLCITEARRQQLDLPMMVSNNTSHYGTAFTVTIEAAEGVTTGVSAQDRLTTVRA
FT                   AIADGAKPSDLHRPGHVFPLRARPGGVLARRGHTEATIDLVSLAGFRPAGVLCELTNDD
FT                   GTMARAPQVMAFARQHGMPVVTIEDLVAYRQAHEPQEQAC"
FT   gene            complement(500149..500916)
FT                   /gene="zupT"
FT                   /locus_tag="ETAF_0426"
FT   CDS_pept        complement(500149..500916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zupT"
FT                   /locus_tag="ETAF_0426"
FT                   /product="Zinc transporter ZupT"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40550"
FT                   /db_xref="GOA:A0A0H3DPU7"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPU7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40550.1"
FT                   /translation="MSIPLLLTLLAGGATAVGALLAIIGQRPSNRVLAFSLGFAAGIML
FT                   LISLMEMLPAALNTPKMPPLLGYAMFILGLVGYFLLDRLLPHQHAHDMVPLGNRTPRSL
FT                   KRTALLLTLGISLHNFPEGIATYVTASADLELGMGIALAVAIHNIPEGLAVAGPVYAAS
FT                   GSRLRALWWASLSGVAEILGGLLAFTLLGPTVSPVGMAAIMALVAGIMVALSVDELMPL
FT                   AREIDPHSNPSRGVLCGMTVMGLSLALLQATPL"
FT   gene            501134..501919
FT                   /locus_tag="ETAF_0427"
FT   CDS_pept        501134..501919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40551"
FT                   /db_xref="GOA:A0A0H3DPX9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPX9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40551.1"
FT                   /translation="MSEATMPALFLAHGSPMNAIEDNPFSALWQRLGRELPRPKAIVVI
FT                   SAHWCTQGLWATAMAQPRTLHDFGGFPPALSALRYPAPGSPALARELQSLLAPQYTLSL
FT                   DEGGWGLDHGAWSLLVHLYPQADIPVIQLSLDPRQPAAYHYQLGQALAPLRQRGVLMLG
FT                   SGNVVHNLRTLRWEAEAEPYPWARRFEDVVRQGLRERGEDAALLRFADNPDATLANPTP
FT                   EHFLPLLPVLGCWDGAEPLRVFEQGIVMGSLSMLSLQVG"
FT   gene            complement(502097..502183)
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3239"
FT   tRNA            complement(502097..502183)
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3239"
FT                   /product="tRNA-Leu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(502217..502303)
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3240"
FT   tRNA            complement(502217..502303)
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3240"
FT                   /product="tRNA-Leu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(502339..502425)
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3241"
FT   tRNA            complement(502339..502425)
FT                   /gene="trnL"
FT                   /locus_tag="ETAF_3241"
FT                   /product="tRNA-Leu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(502602..503738)
FT                   /locus_tag="ETAF_0428"
FT   CDS_pept        complement(502602..503738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0428"
FT                   /product="Ribosomal RNA small subunit methyltransferase C"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40552"
FT                   /db_xref="GOA:A0A0H3DR97"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DR97"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40552.1"
FT                   /translation="MQRIATAAMNGAFQNAGESSIITGQPIEEFCAMSAFTPASEVVLR
FT                   HGEEFEPRRVLFAGDLQDTLPAQFNAVEVRAHTTQYHHWQALHPAMGERCLFSLTITAE
FT                   FAAGIDTLIYFWPKSKPEALFQLTQLLSQLPVGCDVFIVGENRAGVRSAEELASDMLTL
FT                   NKIDSARRCGLYHGQLAQPPRFDLNDWWMSYDTGSLRIATLPGVFSRDGLDIGSHLLLS
FT                   SLPHGLKGNVLDVGCGAGVLSAAIARMSPETRLTLSDVNAAALTASRQTLAQNAIDGEV
FT                   LASNVFSDISGRFDLIISNPPFHDGVQTSLLAAQTLIRGAVSHLQLGGELRIVANAFLP
FT                   YPQVLDAVFGRHEVVAQTGKFKVYSAILDRAALEHSRR"
FT   gene            503838..504248
FT                   /locus_tag="ETAF_0429"
FT   CDS_pept        503838..504248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0429"
FT                   /product="DNA polymerase III psi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40553"
FT                   /db_xref="GOA:A0A0H3DMK6"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40553.1"
FT                   /translation="MTSRRDQLLQQLGITQWVLRRPALLRGEVAITLSAQTRLLIVSEA
FT                   PLSPDDLLLCDILRALSLTAEQAVILTPEQYEMLSDRQRYLCWWLGESASSEACLRSPA
FT                   LGALYHNPGAKRALWQQICHEQHHFFPDPGGH"
FT   gene            504208..504654
FT                   /locus_tag="ETAF_0430"
FT   CDS_pept        504208..504654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0430"
FT                   /product="Ribosomal-protein-S18p-alanine acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40554"
FT                   /db_xref="GOA:A0A0H3DN12"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN12"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40554.1"
FT                   /translation="MSNIISSLTPADTDAAYAVECASHAFPWTHSTFLSNQGERYYNLK
FT                   LESQGQLAAFAITQVVLDEATLFNVAVAPAYQRQGLGRTLLLRLIDDLTERGVVTLWLE
FT                   VRDSNRAAIALYHALGFNEVSLRRNYYPTADGREDARIMALPLG"
FT   gene            504850..506439
FT                   /locus_tag="ETAF_0431"
FT   CDS_pept        504850..506439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0431"
FT                   /product="Peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40555"
FT                   /db_xref="GOA:A0A0H3DPV2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPV2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40555.1"
FT                   /translation="MSPSEYAREVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAGT
FT                   VKGRGSSQHAKSDWMEMEKQRGISITTSVMQFPYHDSLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESELR
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRVIKGLDNPQLDAAVGED
FT                   LAVQLREELELVQGASTEFEEEAFLNGQLTPVFFGTALGNFGVDHMLDGLVAWAPAPMP
FT                   RMTDVRKVSADEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGRYDKGMKLRQVRTGKDV
FT                   VIADALTFMAGDRAHVEEAYPGDIIGLHNHGTIQIGDTFTQGEEMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPVANNDLIVGAVGVLQFDVVVARLKSEYN
FT                   VEAIYESVNVSTARWVECDDAKKFDEFQRKNELHLALDGGDNLAYIAPTMVNLNLTQER
FT                   YPEVRFRKTREH"
FT   gene            506664..507665
FT                   /locus_tag="ETAF_0432"
FT   CDS_pept        506664..507665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40556"
FT                   /db_xref="GOA:A0A0H3DPY4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPY4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40556.1"
FT                   /translation="MGYRIPITLGNIEPLAYKPYHPGRIALVCEGGGQRGIFTAGVLDE
FT                   FLRARFNPFDLYLGTSAGAQNLSSFVCGQAGYARRVITRYTTRSEFFNPLRFVRGGHLI
FT                   DLDWLVDCTHREMPLAFDRAERMLGQQRQFYMVASRSDDFSAAYFPAQRDSWLQVIKAS
FT                   SAIPGFYRSGVELDGVVYQDGGIADAVPVREAYRLGADTIVVIRTVPSQMFYTPRWVKR
FT                   MESLLSESSLQQMVRMMQRHEKSYRRTQRFIEQPPGRLRIFEIYPPKPLASHALGSTVA
FT                   SLNTDYHLGRRCARYFLAAVGHWLLPRDLPAHAHGPARLTHQAARQPAGETL"
FT   gene            507662..508453
FT                   /gene="yjjV"
FT                   /locus_tag="ETAF_0433"
FT   CDS_pept        507662..508453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjjV"
FT                   /locus_tag="ETAF_0433"
FT                   /product="Putative deoxyribonuclease YjjV"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40557"
FT                   /db_xref="GOA:A0A0H3DRA1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRA1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40557.1"
FT                   /translation="MIAAALIDTHCHFDFAPFCGDEAASLHRARAAGIGDIIVPSIEAS
FT                   RFASVLALAHRYPMLHAALGLHPLYIEHHRDTDIAALDTLLAQADPAVVALGEIGLDHY
FT                   GDVRQPARQLSLLQDQLALAQRYDLPVILHSRRSHDLLAKILRQRRLMRTGVVHGFSGS
FT                   LAQAQAFVRLGYAIGVGGTITYARANKTRAAVAALPLEALLLETDAPDMPLFGYQGAPN
FT                   RPEQLTRVFAALCALRSETPAQIAQALYDNTHRLFHFPPRS"
FT   gene            508697..509974
FT                   /locus_tag="ETAF_0434"
FT   CDS_pept        508697..509974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0434"
FT                   /product="putative nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40558"
FT                   /db_xref="GOA:A0A0H3DML0"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40558.1"
FT                   /translation="MQLLMGVVGMVTLILLGVLLSNNRRAIRVRTVAGAFAVQVCLGAF
FT                   VLYVPAGRDMLGAMSTGVANVIAYGNQGISFMFGGLVSDKMFELFGGGGFVFALRVLPV
FT                   IVFFSSLIAVLYYLGIMQLVIRVLGGALHKLLGTSRTESLSATANIFVGQTEAPLVVRP
FT                   YIATMTQSELFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKLIVP
FT                   ETEQTHDREDATALVAAEDRPANVIDAAASGAASGLQLALNVGAMLLAFIALIALLNGM
FT                   LGGIGGWFNYPQLSMELILGWVFSPLAFLIGVPWNEAQIAGSFIGQKLIVNEFVAYMNF
FT                   GEYLKADAEVAAAGLQVLSGHTKAIISFALCGFANLSSVAILLGGLGSMAPKRRHEIAR
FT                   FGLRAVAAGTLSNLMSATIAGFFLAL"
FT   gene            complement(510035..510898)
FT                   /locus_tag="ETAF_0435"
FT   CDS_pept        complement(510035..510898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0435"
FT                   /product="radical activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40559"
FT                   /db_xref="GOA:A0A0H3DN15"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN15"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40559.1"
FT                   /translation="MNNRRALVSKLLPFSCVDGPGSRLVLFLQGCNLRCRSCHNPYTIG
FT                   RCDECAQCVATCPHQALSLQAGKVLWDALACQQCDTCLQGCPRQASPMALSLSVDDVLM
FT                   QLRRQAAFIKGITVSGGEATLQLPFLLALFQAIRRDPGLQALDCLVDSNGELSEPGWTR
FT                   LIPWCDGVMVDLKAWDDERHRWLTGRGNRRILHSIRWLAQRRRLAELRLLVIPQHSDYL
FT                   THIDALAEFILSLGDVPVRLNAFHHHGVYGPASAWQPAAKDDVERLAQALETRGVGAVI
FT                   RPALYL"
FT   gene            complement(510870..512420)
FT                   /locus_tag="ETAF_0436"
FT   CDS_pept        complement(510870..512420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40560"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPV7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40560.1"
FT                   /translation="MPETSANALHSRCMAIACDPHLSALQKRHFLALEAENDLPYPALP
FT                   EAARQALDEGVICDMFEGHAPYKPRYVLPDYARFLANGSEWLELEPAQDFDDALSMLTI
FT                   LYHHVPSVTSMPVFLGHLDQLLLPYVGILTENELYIRIKRFWRYLDRTFPDAFMHANLG
FT                   PSDNILTRLFLRADAELAQVVPNLTFLYHPEITPAERLQQAIENICACSKPHIANAPLH
FT                   DNIFTAGGYGIVSCYNALPLGGGGSTLVRMNLKEVALRSRGEEDFFTRTLPDYCQRQTE
FT                   ILRARSDFLFTRSHFFSQSFLVHEGLIDAQRFVPMFGIFALAEAVDILCQQSGVAARYG
FT                   QDEAANALGYRISAWLDAFVRATPLPHAWQQRALLHAQSGISSDRGTTPGARLPYGSEP
FT                   DPIGHLMAVAPHHAYYPAGISDILTLDPTVKSNPQALMQLCLGAFSAGMREFTANVSGN
FT                   DLVRVTGYMVRLSDLARYEQEGSRLNTTWLAEEAARNTGMLERQARVISHEQQTRFSQ"
FT   gene            512798..513673
FT                   /locus_tag="ETAF_0437"
FT   CDS_pept        512798..513673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0437"
FT                   /product="Deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40561"
FT                   /db_xref="GOA:A0A0H3DPY9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPY9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40561.1"
FT                   /translation="MWDRFTAQAVKTFVPFFLIEPAWAAFSQLESIMTELQTAAQRALR
FT                   LMDLTTLNDNDTDEKVIALCHQAKSPAGNTAAVCIYPRFIPIARKTLREQGTPDVRIAT
FT                   VTNFPHGNDDIEIALVETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKETCAA
FT                   ANVLLKVIIETGELKDAALIRKASEISIKAGADFIKTSTGKVPVNATLESAEIMMSVIR
FT                   DMGVAKSVGFKPAGGVRTAEDAAQYLALADRLLGEGWADSRHFRFGASSLLASLLQTLG
FT                   YDAKGTGSSY"
FT   gene            513782..515104
FT                   /locus_tag="ETAF_0438"
FT   CDS_pept        513782..515104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0438"
FT                   /product="Thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40562"
FT                   /db_xref="GOA:A0A0H3DRA5"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRA5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40562.1"
FT                   /translation="MFLAQEIIRKKRDGHALSEEEIRFFINGIRDNTISEGQIAALAMT
FT                   IFFHDMAMPERVALTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAA
FT                   CGGYVPMISGRGLGHTGGTLDKLESIPGFDIFPDDSRFRSIIADVGVAIIGQTSSLAPA
FT                   DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTFALSEALAQ
FT                   AIVGVANGAGCRTTALLTDMNQVLASSAGNALEVREAVQFLTGEARNPRLFEVTMALCV
FT                   EMLISGKLAADQTEARNKLQAVLDNGKAAEIFGRMVAAQSGPCDFVERYDHYLPQAVLC
FT                   KPVFAEQAGIITAMDTRALGMSVVGLGGGRRQASDSIDYSVGLTEMVRLGDSVDGQRPL
FT                   AVVHARDEASWQQAAEAVRAAVTLGERAPEPTPVVYRRITQ"
FT   gene            515205..516428
FT                   /locus_tag="ETAF_0439"
FT   CDS_pept        515205..516428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0439"
FT                   /product="Phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40563"
FT                   /db_xref="GOA:A0A0H3DML5"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40563.1"
FT                   /translation="MKRAFIMVLDSFGIGEAKDAKSFGDEGADTLGHIARACARGEADI
FT                   GRQGPLHLPNLCRLGLGKAALASTGRFPEGLDENAEIIGAYGYANELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFHEHQNSFPQALLDTLVERANLPGYLGNCHSSGTVILDQLGEEHMKS
FT                   GKPIFYTSADSVFQIACHEETFGLERLYELCEIARDELNKGGYNIGRVIARPFVGDKAG
FT                   HFQRTGNRHDLAVEPPAPTMLKKLVDEKQGEVVSIGKIADIYANVGITKKVKATGIDAL
FT                   FDATLQEMRQAGNDTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPEMLALVKEDD
FT                   ILILTADHGCDPTWHGSDHTREHIPVLVYGPKVKPGSLGERDTFADIGQTVAHYFGLSP
FT                   MAYGKPMF"
FT   gene            516495..517220
FT                   /locus_tag="ETAF_0440"
FT   CDS_pept        516495..517220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0440"
FT                   /product="Purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40564"
FT                   /db_xref="GOA:A0A0H3DN19"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN19"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40564.1"
FT                   /translation="MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLQDVRQVNNVRG
FT                   MLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRMDVKLRDV
FT                   VIGMGACTDSKVNRLRFKDNDFAAIADFDMVRNAADAAKAKGIDVRVGNLFSADLFYSP
FT                   DPTMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTF
FT                   NDMIEIALESVLLGDQEQA"
FT   gene            517393..517779
FT                   /locus_tag="ETAF_0441"
FT   CDS_pept        517393..517779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0441"
FT                   /product="Soluble cytochrome B562"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40565"
FT                   /db_xref="GOA:A0A0H3DPW2"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPW2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40565.1"
FT                   /translation="MRKSVLALAGLAMMAGSALAQAASVSEDMDVINQSYRQAQQATTA
FT                   QDFKQALTAMRAAATAAKSEAPSKLQGQASDSADMKDYRHGLDLLIGQIDKAEKLADAG
FT                   QLDQAKTEAQQMLQTRNVYHKKYR"
FT   gene            517804..518295
FT                   /locus_tag="ETAF_0442"
FT   CDS_pept        517804..518295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0442"
FT                   /product="putative nickel-dependent hydrogenase cytochrome
FT                   b-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40566"
FT                   /db_xref="GOA:A0A0H3DPZ4"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPZ4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40566.1"
FT                   /translation="MRLTHWSVALGFLCNRLYLTVPGSTPHQLIGLTVAGLVLLRLLWG
FT                   VTGARGAARLSAFIPTPSALIHHLHELRTRTVPQAPHHNPLGAIGIWATWLLLLLIALT
FT                   GWGQGNDLAFRWPLDVWHVWLVDALTLVVCVHIAAVFAMSFWLRRNLIGAMLPGRRGGE
FT                   "
FT   gene            complement(518331..518741)
FT                   /locus_tag="ETAF_0443"
FT   CDS_pept        complement(518331..518741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0443"
FT                   /product="Regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40567"
FT                   /db_xref="GOA:A0A0H3DRD7"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRD7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40567.1"
FT                   /translation="MSRPAIIINELDAERLDRLLERPAFAAQPVAQALNEELDRAQLLA
FT                   PAAMPADVVTMNSRVRFRDLNTNEEHVRTLVYPHLQDSAEDGLSVMAPIGAALLGLRVG
FT                   DAIRWTLPNGNQTHIEVLALLYQPEAAGELLR"
FT   gene            complement(518911..519183)
FT                   /locus_tag="ETAF_0444"
FT   CDS_pept        complement(518911..519183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0444"
FT                   /product="Phosphocarrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40568"
FT                   /db_xref="GOA:A0A0H3DMP1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40568.1"
FT                   /translation="MSVTQTVEIKNRLGMHARPAMKLFELVQTFDADVILRNENGIEAE
FT                   ANSVIALLMLDSAQGGQIEIQATGPDERQALDAVVSLFNAGFDEE"
FT   gene            complement(519191..520042)
FT                   /locus_tag="ETAF_0445"
FT   CDS_pept        complement(519191..520042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0445"
FT                   /product="Hypothetical ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40569"
FT                   /db_xref="GOA:A0A0H3DN31"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN31"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40569.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVELLPELARTLA
FT                   TRDTSAAVSIDVRNMPESPEVLETAMDHLPESFTPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLENAIDQENELLEPLRSRADLIIDTSEMSVHELAEMLRARLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLEQWLPALENNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RR"
FT   gene            complement(520151..520597)
FT                   /gene="ptsN"
FT                   /locus_tag="ETAF_0446"
FT   CDS_pept        complement(520151..520597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="ETAF_0446"
FT                   /product="PTS system nitrogen-specific IIA component PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40570"
FT                   /db_xref="GOA:A0A0H3DPY2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPY2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40570.1"
FT                   /translation="MPLSVVLTPECTRNAVHCASKKRVLEIISELAAAQLNLPTQVVFD
FT                   AILTRERMGSTGIGNGIAIPHGKLEEDTLRAIAVFIHLDQPINFDAIDNQPVDLLFALL
FT                   VPADQCKTHLQTLSLMAQKLSDKGVCRRLRAAQSDEDLYQIITE"
FT   gene            complement(520735..521022)
FT                   /gene="yhbH"
FT                   /locus_tag="ETAF_0447"
FT   CDS_pept        complement(520735..521022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="ETAF_0447"
FT                   /product="Ribosome hibernation protein YhbH"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40571"
FT                   /db_xref="GOA:A0A0H3DQ27"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ27"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40571.1"
FT                   /translation="MQLNITGHHLEITDAIRQFVSEKFAKLEQYFDRINQVNVTLSIEK
FT                   VDHIAEATVFINGGELHASAQQEDMYAAIDILIDKLARQLNKHKDKLKQH"
FT   gene            complement(521044..522501)
FT                   /locus_tag="ETAF_0448"
FT   CDS_pept        complement(521044..522501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0448"
FT                   /product="RNA polymerase sigma-54 factor RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40572"
FT                   /db_xref="GOA:A0A0H3DRE1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRE1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40572.1"
FT                   /translation="MQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESNPLLEQ
FT                   LEPNDEADGDSADDERVQDDADARDDDDPLDTRDALEQREMPDELPLDASWDEIYTAGT
FT                   PSGTGTDYHDDELPVFQGETTQTLQDYLMWQVELTPFSETDLAIATAIVDAVDDTGYLT
FT                   ASLEEILESLGDEHALPEEVEAVLKRIQRFDPVGVAARDLRDCLLVQLSQFAPDTPYLN
FT                   EARSIVDRHLDLLGNHDFRNLMRSTKLKEEVLKEAMQLIQSLDPRPGLSINTGESDYVI
FT                   PDVLVHKHQGRWVVELNQDSVPRLHINQRYAALGAQARSDSDSQFIRSNLQEAKWLIKS
FT                   LESRNDTLLKVSRCIVEQQQAFFEHGAESMKPMVLADIAQQVEMHESTISRVTTQKFLH
FT                   SPRGIFELKYFFSSHVNTEDGGEASSTAIRALVKKLIAAENPAKPLSDSKLTTLLADQG
FT                   IMVARRTVAKYRESLSIPPSNQRKQLV"
FT   gene            complement(522638..523363)
FT                   /gene="lptB"
FT                   /locus_tag="ETAF_0449"
FT   CDS_pept        complement(522638..523363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptB"
FT                   /locus_tag="ETAF_0449"
FT                   /product="Lipopolysaccharide ABC transporter, ATP-binding
FT                   protein LptB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40573"
FT                   /db_xref="GOA:A0A0H3DMP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40573.1"
FT                   /translation="MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLE
FT                   IRDDLNAEQRADRADELLEEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPD
FT                   EILADEQVKRVYLGEEFRL"
FT   gene            complement(523370..523927)
FT                   /gene="lptA"
FT                   /locus_tag="ETAF_0450"
FT   CDS_pept        complement(523370..523927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptA"
FT                   /locus_tag="ETAF_0450"
FT                   /product="LptA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40574"
FT                   /db_xref="GOA:A0A0H3DN32"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN32"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40574.1"
FT                   /translation="MKFKASTLKLRDLILAGALLSASASALAVTGDTDQPIHINSMQQS
FT                   LDMQGNVATFTGDVIVTQGTIKITADKVVVTRPNGQQGSEIVEAYGNPVTFYQMQDNGK
FT                   PVEGHSQQLRYELAKDYVILTGKAFLKQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTT
FT                   VLLPSQLQDKGNAKPAPQKKSN"
FT   gene            complement(523902..524453)
FT                   /gene="yrbK"
FT                   /locus_tag="ETAF_0451"
FT   CDS_pept        complement(523902..524453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbK"
FT                   /locus_tag="ETAF_0451"
FT                   /product="YrbK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40575"
FT                   /db_xref="GOA:A0A0H3DPY5"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPY5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40575.1"
FT                   /translation="MIILLTLIALALIGWNLADNSPDGAPTTLDPNTPNYQSQHTLTVV
FT                   YDPSGKLSYKLVAQDVQHYSEQGVTWFTRPVLTTFDPQAAATWSVRADKAKLTNDNMLY
FT                   LYGNVEVNSLTPTSQLERITTDNAQVNLVTQDISSDDEVTLYGSNFTSHGLKMRGNMRD
FT                   KTARLIDKVNTYYEIQSKHP"
FT   gene            complement(524471..525037)
FT                   /locus_tag="ETAF_0452"
FT   CDS_pept        complement(524471..525037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0452"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40576"
FT                   /db_xref="GOA:A0A0H3DQ33"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ33"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40576.1"
FT                   /translation="MQQNTSPIATCYGPVSADVMARAAQIRLLICDVDGVLSDGLIYMG
FT                   NQGEELKAFNVRDGYGIRCLVTQGIDVAIITGRSSQLVADRAATLGIRHLYQGQSDKLI
FT                   AFERILADLQLAPHQAAYIGDDLIDWPVMARVGLSVAVADAHPLLLPNAHYTTRIAGGR
FT                   GAVRELCDIILQAQGNLDQAKGLSI"
FT   gene            complement(525053..526039)
FT                   /locus_tag="ETAF_0453"
FT   CDS_pept        complement(525053..526039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0453"
FT                   /product="Arabinose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40577"
FT                   /db_xref="GOA:A0A0H3DRE6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRE6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40577.1"
FT                   /translation="MSHMEFQPDFDFQQAGKDVLRIEREGLAQLDHFINQDFSRACEAM
FT                   LRCSGKVVVMGMGKSGHIGRKIAATLASTGTSAFFVHPGEASHGDLGMVEPRDVVLAIS
FT                   NSGESQEIQALIPVLKRQSVTLICMTNNPDSAMGRAADIHLCIRVPQEACPLGLAPTTS
FT                   TTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRVSDIMHSGDEVPTVSPT
FT                   ASLRDALLEITRKNLGLTVICGPDAHIDGIFTDGDLRRIFDMGIDLNNAKIADVMTRGG
FT                   IRIRPTALAVDALNLMQDRHITSLLVAENDRLIGVVHMHDMLRAGVV"
FT   gene            complement(526094..527083)
FT                   /locus_tag="ETAF_0454"
FT   CDS_pept        complement(526094..527083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0454"
FT                   /product="Inner membrane protein YrbG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40578"
FT                   /db_xref="GOA:A0A0H3DMP9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40578.1"
FT                   /translation="MLLATLLMLIGLLLLVYGADRVVYGAAAVAHALGVAPLVIGMTIV
FT                   SMGTSLPELTVSLTATLHNQIDTAVGNVLGSNITNILLILGCAALIRPLSVRSDILRRE
FT                   LPLTLGATILCGFLLYDNQLNRIDGAILMTFFGAFLWLMLKMAHRVMPGGQDSYAREQI
FT                   AELPRDTGLPVALLWMALGFIILPLASRMVIDNATVLARYLGVSELIIGLTVIAVGTSL
FT                   PELATACAGAIKGEHDIVLGNIIGSNTFNILVVLGIPALIGPRNPLIDGAAFARDYWVM
FT                   LAFTLVLTLLCLRRRHSIGRLAGALLLCAFIAYIGLLYTQPSLMLYWD"
FT   gene            527364..528194
FT                   /gene="yrbF"
FT                   /locus_tag="ETAF_0455"
FT   CDS_pept        527364..528194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbF"
FT                   /locus_tag="ETAF_0455"
FT                   /product="YrbF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40579"
FT                   /db_xref="GOA:A0A0H3DN35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN35"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40579.1"
FT                   /translation="MNHQENNLVDIRGMSFSRGNRQIFTDINLTVPRGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLRPDRGEIWFDGENIPALSRGRLFEARKKMSMLFQSGALFTDLSVFD
FT                   NVAFPLREHTRLPESLLRTTVLMKLEAVGLRGAADLMPSELSGGMARRAALARAIALDP
FT                   QMILFDEPFVGQDPITMGVLVKLIDELNHALGITCVVVSHDVPEVLSIADHAYIVAEQR
FT                   VIAHGDRQALRANQDPRVRQFLDGIADGPVPFRYPAGDYRHALLASGEGSSHVA"
FT   gene            528184..528966
FT                   /locus_tag="ETAF_0456"
FT   CDS_pept        528184..528966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40580"
FT                   /db_xref="GOA:A0A0H3DPY8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPY8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40580.1"
FT                   /translation="MLLNGLAAFGRRGIRVCAAFGRAGLMLFSALVGRPEPGKQWPLLR
FT                   RQLYSVGVQSLLIIIVSGLFIGMVLGLQGYLVLTTYSAEASLGMMVALSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLTVIFV
FT                   AVGIWGGSVVGVDWKGIDAGFFWSAMQGAVDYRTDLLNCLIKSLVFAITVMWIALFNGY
FT                   DAVPTSAGISRATTRTVVHASLAVLGLDFVLTALMFGN"
FT   gene            528971..529504
FT                   /gene="yrbD"
FT                   /locus_tag="ETAF_0457"
FT   CDS_pept        528971..529504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbD"
FT                   /locus_tag="ETAF_0457"
FT                   /product="Uncharacterized ABC transporter, periplasmic
FT                   component YrbD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40581"
FT                   /db_xref="GOA:A0A0H3DQ41"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ41"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40581.1"
FT                   /translation="MQTKKAEVWVGLFMLIALCAAVFLCLQVANVKSLGSEPTYRLYAT
FT                   FDNVGGLKARSPVKIGGVVIGRVAEISLDPQTYLPRVAMDIDQRYNHIPDTSSLAIRTS
FT                   GLLGEQYLALNVGFEDPEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGENGNASA
FT                   STAPAGNTPAPVAH"
FT   gene            529525..530175
FT                   /gene="yrbC"
FT                   /locus_tag="ETAF_0458"
FT   CDS_pept        529525..530175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbC"
FT                   /locus_tag="ETAF_0458"
FT                   /product="Uncharacterized ABC transporter, auxiliary
FT                   component YrbC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40582"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRF1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40582.1"
FT                   /translation="MLKRIVMAALLCVAPWFSAQASAAPTLDQSNPYTLMNQAAAATFS
FT                   RLKSEQPRIKQDPDYLRTIVREELMPYVQVKYAGALVLGQYYRGATPAQRDAYFKAFQS
FT                   YLEQVYGQALALYHGQRYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQT
FT                   GHWQAFDMIAEGVSMITTKQNEWAAILREKGVDGLTQQLIVAAKQPITLDTKQ"
FT   gene            530172..530486
FT                   /locus_tag="ETAF_0459"
FT   CDS_pept        530172..530486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0459"
FT                   /product="anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40583"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40583.1"
FT                   /translation="MTARGELRWRRVDATLYLQGALECDSLDALWQQRQTLLTDITCVD
FT                   ISELSRVDSAGLALLLHVQNLRPETPIPLRGVSERLRTLITLYNLQDIVVCAAPSANLA
FT                   "
FT   gene            530627..530881
FT                   /gene="yrbA"
FT                   /locus_tag="ETAF_0460"
FT   CDS_pept        530627..530881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbA"
FT                   /locus_tag="ETAF_0460"
FT                   /product="YrbA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40584"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN37"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40584.1"
FT                   /translation="MNNDQIKDVLMKALALQEVHVTGDGSHFQVIVVGELFAGMSRVKQ
FT                   QQAVYAPLMEYIADNRIHALTIKAYTPDEWQRDRKLSGL"
FT   gene            530945..532201
FT                   /locus_tag="ETAF_0461"
FT   CDS_pept        530945..532201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0461"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40585"
FT                   /db_xref="GOA:A0A0H3DPZ1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPZ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40585.1"
FT                   /translation="MDKFRLQGPTRLDGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLRDIDTTMKLLSQLGAKVERNGSVHVDASGVNELCAPYELVKTMRASIWALGPLVARF
FT                   GRGQVSLPGGCAIGARPVDLHISGLEQLGAEIRLEEGYVKASVQGRLQGAHIVMDKVSV
FT                   GATVTIMSAATLAQGTTVIENAAREPEIVDTAGFLNTLGAKISGAGTDRITIEGVERLG
FT                   GGVYRVLPDRIETGTFLVAAAVSRGRVVCRHTRPDTLDAVLAKLREAGADIEVGEDWIS
FT                   LDMHGQRPKAVTVRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHIPELIR
FT                   MGAHAEIEGNTAICHGVETLSGAQVMATDLRASASLVIAGCIAQGTTLVDRIYHIDRGY
FT                   ERIEDKLSAMGARIERVGE"
FT   gene            complement(532564..533625)
FT                   /gene="degS"
FT                   /locus_tag="ETAF_0462"
FT   CDS_pept        complement(532564..533625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="ETAF_0462"
FT                   /product="Outer membrane stress sensor protease DegS"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40586"
FT                   /db_xref="GOA:A0A0H3DQ46"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ46"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40586.1"
FT                   /translation="MLVKLLRSTLLGLAVAIVLMIALPSLRPHGLMPLFSEASFEEQPV
FT                   SYNAAVRRAAPAVVNVYNGSMSGSNSGLAIKTLGSGVIMDEKGYILTNKHVVSAADQIV
FT                   VALQDGRWFEAMLVGSDTLTDLAVLKIQASNLPVITINPKRVPHIGDVVLAIGNPYNIG
FT                   QTTTQGIISATGRVGLSTYGHQNFLQTDASINHGNSGGALVNSLGELVGINTLSLDKSN
FT                   DGETPEGIGFAIPTALATKIMNKLIRDGRVIRGFIGIGGREIVPVRNQPASAERIQGII
FT                   VNSVAANGPAALAGIHPGDIVLNVNGKPAISATETMDQVAEIRPGSEVPVIIMRNGERL
FT                   KLNVTIAEFPNVD"
FT   gene            complement(533717..535012)
FT                   /gene="degQ"
FT                   /locus_tag="ETAF_0463"
FT   CDS_pept        complement(533717..535012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="ETAF_0463"
FT                   /product="Outer membrane stress sensor protease DegQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40587"
FT                   /db_xref="GOA:A0A0H3DRF6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRF6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40587.1"
FT                   /translation="MTRRSLPLLLALSLSLGALPTAQASLPATLNGQALPSLAPMLAKV
FT                   LPAVVSVYVEGKQTPRHRRMEGLGSGVIINADKGYVLTNNHVIRDAQSIRVQLEDGREY
FT                   SARLIGRDAASDIALLQLIDARHLTAIPLADSDKLRVGDFAVAVGNPFGLGQTATAGIV
FT                   SALGRSGLNLEGPENFIQTDAAINSGNSGGALVNLKGELIGINTAILAPAGGNIGIGFA
FT                   IPSNMARSLSDQLIKYGEVKRGVLGIRGRDMTADLANAFKLDSPRGTFVNEVLPKSAAA
FT                   RAGIRAGDVLISLNGTPITSFAELRAKVGSVAPGTALQIGLLRNGKPMNVTVTLENHAL
FT                   ASVQGETLTPALAGASLSPGEAQGAPGIRIDTVEKGSPAAQIGLHKADLIIGVNRLRTR
FT                   DITALRRALAGDPPVIALHLIRGGEGMYLLLR"
FT   gene            complement(535168..535560)
FT                   /locus_tag="ETAF_0464"
FT   CDS_pept        complement(535168..535560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0464"
FT                   /product="Putative cytochrome d ubiquinol oxidase subunit
FT                   III / Cytochrome bd-I oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40588"
FT                   /db_xref="GOA:A0A0H3DMQ5"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40588.1"
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLRQQKTLQDELEKSKTDL
FT                   DQYRQELVNHFARSAELLDNMAKDYRQLYQHMATSSNNLLPDMPAHDNPFRYRLTEADN
FT                   DQAPVEIPPRDYSEGASGLLRADRHD"
FT   gene            535758..536891
FT                   /locus_tag="ETAF_0465"
FT   CDS_pept        535758..536891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0465"
FT                   /product="ATPase, AFG1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40589"
FT                   /db_xref="GOA:A0A0H3DN40"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN40"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40589.1"
FT                   /translation="MSSPYALTPDTPLARYRAALAAGDYQPDAAQQRAVEALDEIHRQW
FT                   AVRWHTAGPAAWRTRLPHWLGGRRTAEPIVGLYLWGGVGRGKTWLMDLFFDTLPGQRKQ
FT                   RLHFHRFMLWVHESLADKQGQADPLSALADALKAQADVLCFDEFFVTDIGDAMLLGTLL
FT                   PALFTRGVTLVATSNIPPAQLYPNGLQRSRFLPAIAQIQTHCQVLNVDGGTDYRLRTLT
FT                   QAHLYLTPLGARTEQAMEALFLRLAGQTGQIGGTLAINHRQMPVLRRAEAVVALHFSAL
FT                   CEAPCSSRDYIALAQRYHTVLLHGVSAMGADREACARRFLALVDEFYERRVTLIISATC
FT                   DMFGLYRGERLAFEYQRCLSRLQEMQSEAYLSLPHRP"
FT   gene            537148..537576
FT                   /locus_tag="ETAF_0466"
FT   CDS_pept        537148..537576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0466"
FT                   /product="LSU ribosomal protein L13p (L13Ae)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40590"
FT                   /db_xref="GOA:A0A0H3DPZ3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPZ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40590.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRLDKKYFHHTGHIGGIKEATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
FT   gene            537591..537983
FT                   /locus_tag="ETAF_0467"
FT   CDS_pept        537591..537983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0467"
FT                   /product="SSU ribosomal protein S9p (S16e)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40591"
FT                   /db_xref="GOA:A0A0H3DQ53"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ53"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40591.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   gene            538319..538960
FT                   /locus_tag="ETAF_0468"
FT   CDS_pept        538319..538960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0468"
FT                   /product="Stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40592"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRG1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40592.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVDMDN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLFMH
FT                   QIERDWYSLLYKIEKGSAQEADAARKQLREELLAIAPVFAQKPYFMSDEFSLVDCYLAP
FT                   LLWRLPVLGIELSGAGAKELKGYMTRVFERDAFLASLTEAEREMRLHTRG"
FT   gene            538963..539454
FT                   /locus_tag="ETAF_0469"
FT   CDS_pept        538963..539454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0469"
FT                   /product="ClpXP protease specificity-enhancing factor /
FT                   Stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40593"
FT                   /db_xref="GOA:A0A0H3DMQ8"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40593.1"
FT                   /translation="MELSQMSPRRPFLLRAFYDWLLDNQLTPHLVVDVHCADVMVPMEY
FT                   ARDGQIVLNIAPRAVGGLELADDAVRFNARFGGVPRQVYVPMAAVMAIYARENGAGTMF
FT                   EPEAAYEQDGDETRAETESDEPAMTLIDGDRSPDNEAPADDDGGDEPPPRGRPALRVVK
FT                   "
FT   gene            complement(539673..540149)
FT                   /locus_tag="ETAF_0470"
FT   CDS_pept        complement(539673..540149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0470"
FT                   /product="Putative sugar isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40594"
FT                   /db_xref="GOA:A0A0H3DN42"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN42"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40594.1"
FT                   /translation="MILGHIDDLAQRGDLPTPIRRALQRALEAGAAQLENGTHPIDGER
FT                   LYMNVMTLTPQRAEEKQGEIHRDYLDIQLVLEGEERIDFTLAGQARECQPYQQEGDYQL
FT                   CAAMAQPQRLIMTPGMFAVFLPGEPHKPGCISRTSDPIRKVVVKLHRDCLKEEK"
FT   gene            complement(540146..541021)
FT                   /locus_tag="ETAF_0471"
FT   CDS_pept        complement(540146..541021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0471"
FT                   /product="N-acetylmannosamine kinase"
FT                   /EC_number="2.7.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40595"
FT                   /db_xref="GOA:A0A0H3DPZ7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR023945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPZ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40595.1"
FT                   /translation="MNTLAIDLGGTKLAAALVDVDGQLSQRVEAATPASGDPEALTQAL
FT                   AQLITRYRGMADRVAVASTGIIHQGILSALNPDNLGGLNRFPLQECIERLSALPCHLLN
FT                   DAQAAAWAEYLALTPSGQDMAFITVSTGVGGGLVLNGRLQIGRGAFAGHIGHTLADPAG
FT                   PRCGCGRSGCVESIASGRAIAAAAQDDLVGLDARAIFQRAAAGDAQAQRLIARSAQAIA
FT                   QLIADLRATLDIQCAVIGGSVGLAPGYLDQVQHFLRQMPHAYHATLYSARHQRDAGLIG
FT                   AALWSRRETA"
FT   gene            complement(541002..541709)
FT                   /locus_tag="ETAF_0472"
FT   CDS_pept        complement(541002..541709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0472"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40596"
FT                   /db_xref="GOA:A0A0H3DQ60"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ60"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40596.1"
FT                   /translation="MSVFTTLQQHIQRNGALIVSCQPVPDSPMDSPEIVAAMAAAAAQA
FT                   GAAALRIEGVANLQAVRPRVTLPIIGIIKRDLDDSPVRITPFLRDVDDLVQAGADIIAF
FT                   DGTLRPRPEQREALLARIQHHGRLAMADCSSLEDGLYCQHLGCDFIGTTLSGYTNGETP
FT                   CEPDLALVHALSSAGCRVIAEGRYNTPAQAAQALSQGAWAVTVGSAITRIEHICQWYCQ
FT                   ALQAEAHHEYAGH"
FT   gene            complement(541875..542576)
FT                   /locus_tag="ETAF_0473"
FT   CDS_pept        complement(541875..542576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0473"
FT                   /product="DsbB-like protein Inner membrane thiol:disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40597"
FT                   /db_xref="GOA:A0A0H3DRG6"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR023792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRG6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40597.1"
FT                   /translation="MFAKMWSDLRQNPVETLVRWQEQRFLWLLMALAMGGLIVLAHAFF
FT                   QIYLYMAPCEQCVYIRFAMFVMVIGGLVAAINPRNLALKLFGCIAAFYGAIIGMGYSIK
FT                   LNGIHHAVHSPDALFGVQGCSTDPSFPFGLPLAEWAPSWFKPTGDCGYDAPMVPQGVAL
FT                   DSVQQWFIDMYVQAEGWYLIPSMQFMNMAQACFLAFALCFAILVIMSVAWAIHLLRRRA
FT                   MPADPTASTPR"
FT   gene            complement(542593..543264)
FT                   /locus_tag="ETAF_0474"
FT   CDS_pept        complement(542593..543264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0474"
FT                   /product="DsbA-like Periplasmic thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40598"
FT                   /db_xref="GOA:A0A0H3DMR2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR028588"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40598.1"
FT                   /translation="MHLTLGKTHLKALLGATLLTCAFGAAAFSEGTDYVVLEKPIPNAQ
FT                   KTLIKVFSYDCPFCYKYDKAVTGPVSDKVKDIVRFEPYHLDTKGVYGPQGSEILAVLLN
FT                   KDRAAGVSIFDDASQFKKAKFAYYAAYHDKKERWKDGKDPAAFTQTGLDAAGLSQADLE
FT                   GGLKDPAVQKTLGEWKASAYDVAKIQGVPAYVVNGKYLIMTKSIKSVDSMADLVKELAA
FT                   K"
FT   gene            complement(543328..545163)
FT                   /locus_tag="ETAF_0475"
FT   CDS_pept        complement(543328..545163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0475"
FT                   /product="Putative arylsulfate sulfotransferase"
FT                   /EC_number="2.8.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40599"
FT                   /db_xref="GOA:A0A0H3DN45"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR028610"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN45"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40599.1"
FT                   /translation="MIKMDLLQSQENTMLSTTRKTLVAGAIAFAIGAVSPAVHAAGMPA
FT                   APAVGNLGAVVVDPYGNSPLTALINLNGHAISDVNVTVQGKGKNGVAVSYPVGKQSLLT
FT                   YDGIPIFGLYQKHDNQVTVEYKEGGKLKKDAYTIRTSAIVNKYMDNRSLTDLQPVKPVK
FT                   VAKGFEDRLYLVNTHTFTPQGSDLHWSGEKDKNAGLLDASPATGSLPFDIAPFTFIVDT
FT                   QGEYRWWLNQDTLYNGHDVDINQRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLNNH
FT                   RLPRGYLDATHESIEIPNGNVMLRVGKRNYLRDDGQRVHTIRDHILEVDKAGRVVDVWD
FT                   LNLILDPLRDSLLGALDAGAVCVNVDLDHAGKQAKLEPDTPFGDALGVGPGRNWAHVNS
FT                   IAYDPKDDSIILSSRHQGVIKIGRDKQVKWILAPAEGWNEKLSAKLLKPVDAQNKPLNC
FT                   SAKGVCENSDFDFSYTQHTAWLSPKGTLTVFDNGDGRHLEQPALPTMKYSRIVEYKIDE
FT                   KNMTVQQLWEYGKDRGYEWYNPITSIVEYQPDRDTMFSFGGSTNLFEPGQPTTGRLNEI
FT                   DYKTKEVKVELDVLSDKANQTHYRAALIRPQGLFL"
FT   gene            545520..546521
FT                   /locus_tag="ETAF_0476"
FT   CDS_pept        545520..546521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0476"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40600"
FT                   /db_xref="GOA:A0A0H3DQ00"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ00"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40600.1"
FT                   /translation="MRKVDNVAVDSELLALFRALAETGSLTQAAGRVGLSQAAASRALS
FT                   KLRAVFQDQLFVKGGYGMQATPRARELMPRVTAVLQALDHLTMPYEFDPQALRRTLYLG
FT                   AVDNGVWMIFSRVVKSLFQQAPNARIEILPIGDDLFSSLKFGRMDLAIYPLIDIPPDFH
FT                   EANLFKTTFSCLVRQGHPLARQMLRGETPTLAQINAYRRLQVSLHDGQPGATVGNAVHR
FT                   QGKDYDVAMSVPYFLAAPMLLSQTDFVLTLPTQTARHFSQMANLAILPYPDGETTFYTR
FT                   LIWHHRVHHDPVIQWLRTLFLRFASEEAALESARDNADAAGCRVGAERYTQR"
FT   gene            complement(546506..547924)
FT                   /locus_tag="ETAF_0477"
FT   CDS_pept        complement(546506..547924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0477"
FT                   /product="Glutamate synthase small chain"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40601"
FT                   /db_xref="GOA:A0A0H3DQ66"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ66"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40601.1"
FT                   /translation="MSQNVYQFIDLQRIDPPKKPLKQRQGEFIEIYEPFSDGQAQAQAD
FT                   RCLSCGNPYCEWRCPLHNYIPNWLKLANEGRIWDAATLSHQTNSLPEVCGRVCPQDRLC
FT                   EGACTLHDEFGAVTIGSVERYITDKALAEGWMPDLSGVQPTGKRVAIVGAGPAGLACAD
FT                   VLARSGVQAELFDRHPEIGGLLTFGIPAFKLEKQVMVRRREIFSAMGIRFHLNTEIGRD
FT                   ITLESLLSQFDAVFLGVGTYQALPGGLEQEEASGVHSALPYLIATARHLMGYAEDPQTP
FT                   YVSMHGKRVVVLGGGDTAMDCVRSALRQGATQVTCAYRRDEGNMPGSRREVKNAREEGA
FT                   AFRFNLQPLAIETNAAGRVCGVRMAQTTLTDPDAAGRRAVRLVPDAEVTLAADAVILAF
FT                   GFRPHAMTWLAEHGVDLDAQGRIVAADHGDYPHQTSNPQIFAGGDAVRGSDLVVTAIAE
FT                   GRRAAQGILNYLCV"
FT   gene            complement(547940..552397)
FT                   /locus_tag="ETAF_0478"
FT   CDS_pept        complement(547940..552397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0478"
FT                   /product="Glutamate synthase large chain"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40602"
FT                   /db_xref="GOA:A0A0H3DRH1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRH1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40602.1"
FT                   /translation="MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDRFLRMVAEERGWRLAKNYAVGMLFLSRDEERASAARRIVEE
FT                   ELQNETLSIVGWRDVPVNQEVLGEIALSSMPHIAQIFINAPAGWRPRDLERRLFIARRR
FT                   IEKRIDDPDFYVCSLSNLVTIYKGLCMPADLPRFYHDLADLRMESAICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTITGNRQWARARTYKFKTPLIPDLQDAAPFVNETGSDSSS
FT                   LDNMLELLLSGGMDIVRAMRLLVPPAWQNNPDMDPDLRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRFAACNLDRNGLRPARYVITKDRLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRAGQILHSRETDDDLKSRHPYREWMEKNVRRLIPFEDLPDERVGSRTLDDAALLTYQK
FT                   QFAYSQEEIDQILRVLGENGQEATGSMGDDTPFAVLSSRPRLIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLSTSIGREMNVFCEAEGQAHRLNFKSPVLLYSDFAQLIGQEKEHYRAET
FT                   LDITFDPEQQDLQQALAALCDEAEAQVRRGAVLLVLSDRAISARRLPIPAPMAVGAVQR
FT                   RLVEQSLRCDANIIVETAGARDPHHFAVLLGFGATAIYPYLAYETLAKLVDSGAIARSY
FT                   RQVMLNYRNGINKGLYKIMSKMGISTVASYRCSKLFEAVGLHPAICDLCFPGVISRIGG
FT                   ATFSDFQQDLHNLSRRAWLARQPLEQGGLLKYVHDGEYHAYNPDVVQALQQAVQSGDYR
FT                   DYQRYASLVNQRPITTLRDLLALRPVAQPLALEQVEAESALFQRFDTAAMSIGALSPEA
FT                   HEALAQAMNGLGGFSNSGEGGEDPARYNTDKASRIKQVASGRFGVTPAYLVNADVIQIK
FT                   VAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQV
FT                   NPRALISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKHAGCPWELGL
FT                   VETQQALVANGLRHKIRLQVDGGLKSGADIIKAAILGAESFGFGTGPMVALGCKYLRIC
FT                   HLNNCATGVATQDEKLRRDHFHGLPLRVTHYFHFIARETRELMAQLGVSRLVDLIGRTD
FT                   LLTVLEGVTAKQSRLDLAPLLHTATPHPGKGLYCSEGNPPFDPGQLNQSLLSQLQDNIA
FT                   TRQGRALFCDIHNTDRSVGAALSGAIAERYGEQGMAASPLKIQFSGTAGQSFGVWNAAG
FT                   LELTLTGDANDYVGKGMAGGRIVIRPPVGSAFRSHEASIIGNTCLYGATGGKLFAAGRA
FT                   GERFAVRNSGALTVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEF
FT                   RQRVNAELVEVLEMAALPIHEEHLRGLITEHVRLTGSGRAEAILADWPQWAARFVLIKP
FT                   KSSDVKALLGHRSRSAAELRVQAQ"
FT   gene            553033..553983
FT                   /locus_tag="ETAF_0479"
FT   CDS_pept        553033..553983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0479"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40603"
FT                   /db_xref="GOA:A0A0H3DMR5"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40603.1"
FT                   /translation="MAKLASGLYKASFTIMQLQQLVNMFGADLQRRYGEKIHKLTLHGG
FT                   FSCPNRDGTLGRGGCTFCNVASFADEQMQRRSIAEQLEAQARKVNRARRYLAYFQAYTS
FT                   TYAEVCILRDMYREALQQADMVGLCVGTRPDCVPESVLDLLAEYREQGYEVWLELGLQS
FT                   ANDKTLRRINRGHDFACYQRTTRAARARGLKVCSHLIVGLPGESHADCLDTLQRVVETG
FT                   VEGIKLHPLHIVTGSVLAKAWQAGRLQDLTLERYVHTAGEMIRHTPPEVIYHRISASAR
FT                   RPTLLAPQWCENRWTGMVAINNYLLECGGQASALS"
FT   gene            554172..556508
FT                   /gene="arcB"
FT                   /locus_tag="ETAF_0480"
FT   CDS_pept        554172..556508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="ETAF_0480"
FT                   /product="Aerobic respiration control sensor protein ArcB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40604"
FT                   /db_xref="GOA:A0A0H3DN47"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN47"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40604.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTML
FT                   LRGQVDSIDVVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKL
FT                   NQQLKDNISQLNQEIADRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDS
FT                   SPDLVYYRNEDGEFSGCNRAMELLTGKSEKQLIGLTPRDVYDPDIAQKVIETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   EKTTFISTISHELRTPLNGIVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIE
FT                   MDKLERRKVQLDNQAIDFTGFLTDLENLSGLLVQPKGLSFTLTPDPALPHKVMADGTRL
FT                   RQILWNLIGNAVKFTQRGGVSVRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVK
FT                   DMHGGKPATGTGIGLAVSKRLAQTMGGDIVVSSVAGEGACFTLSIRAPVVEEALSEPPA
FT                   EEEMPLPALHVLLVEDIELNVIVARSVLEKMGNSVDVAMSGAEALAMFVPQEYDLVLLD
FT                   IQLPDMTGLDIARTLCQRYGKPALPPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPAL
FT                   TAVIRRFWDSAPATTLEAGEPHAHDLCELLDTEMLQQYLDLVGPQLIDQSLAVFEKMMP
FT                   GYLSVLESNMTARDQKGITEEGHKIKGAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEW
FT                   IDELKQEWRHDVQVLRDWVAQANKK"
FT   gene            556884..557537
FT                   /locus_tag="ETAF_0481"
FT   CDS_pept        556884..557537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0481"
FT                   /product="Sigma cross-reacting protein 27A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40605"
FT                   /db_xref="GOA:A0A0H3DQ03"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ03"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40605.1"
FT                   /translation="MKRVGVVLSGCGVFDGSEIHEAVLTLLALSRAGAQAVCLAPDREQ
FT                   AQVIDHLRGEPTAERRNVLVEAARIARGDVTSLAQADASQLDALIVPGGFGAAKNLSSF
FT                   ATDGAACSIDPALQHLVTRLHRDGKPLGFICIAPALLPKLLGVPVRVTIGNDAATADAI
FT                   AAMGGEHVACAVNDIVVDEAQRVVTTPAYMLANTIAEAAEGIDKLVAQVLDMTR"
FT   gene            557534..558268
FT                   /locus_tag="ETAF_0482"
FT   CDS_pept        557534..558268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0482"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40606"
FT                   /db_xref="GOA:A0A0H3DQ70"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ70"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40606.1"
FT                   /translation="MSQTAASRRVLQRIRRWGSRLVIALLGAWIAALLIFAVLPVPYST
FT                   VMVQRQVGAWLHGDFSYVAHQTWRPMSQIAPPMALAVIAAEDQKFPQHWGFDLTAIGQA
FT                   LDSADEGGRPLRGASTLSQQTMKNLLLWDGRSWLRKGLEAPLTLAEELVWSKRRILTVY
FT                   LNIAEFGPGVFGVEEAAQRYFHKPASRLTAGEAALLAAVLPNPHRFSVRAPSRYVLQRQ
FT                   RWILRQMRQLGGEAFLQRYDLR"
FT   gene            complement(558330..558920)
FT                   /locus_tag="ETAF_0483"
FT   CDS_pept        complement(558330..558920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40607"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRH6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40607.1"
FT                   /translation="MTMRFPLTRCFPALVVLSALLLQGCVAAVIGSATMATQAASDPRS
FT                   VGTQVDDGTLEARISNALSKDAQLKKEARVVVTAYQGQVLLTGQAPSQALISRAKQIAM
FT                   GVEGTKAVYNEIRLGQPVSLGTASADAWITTKVRSQLLASDQVKSTNVKVTTENGEVFL
FT                   LGLVTPKEGQAAAQTASKVSGVKHVTTAFSLLK"
FT   gene            complement(558931..559521)
FT                   /locus_tag="ETAF_0484"
FT   CDS_pept        complement(558931..559521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0484"
FT                   /product="Phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40608"
FT                   /db_xref="GOA:A0A0H3DMR9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40608.1"
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKIL
FT                   SCGNGASGANAQHFAATLINRFETERPSLPAIALNADSVVLTAIGNDRLHDEIYAKQVR
FT                   ALGHAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRI
FT                   PSHRSTRIQEMHMLTVNCLCDLIDNTLFPHQAD"
FT   gene            complement(559568..559954)
FT                   /locus_tag="ETAF_0485"
FT   CDS_pept        complement(559568..559954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40609"
FT                   /db_xref="GOA:A0A0H3DN50"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN50"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40609.1"
FT                   /translation="MAAVPERQHRPGAITAHQIGAHYEQRARRYLERAGLRFHAANVRL
FT                   RGGEIDLIMRDGATWVFVEVRYRKTACYGGAAASIDSRKRQRLQRCAAYWLAAQNQSIE
FT                   TADCRFDVLAITGSQLQWLPNAFV"
FT   gene            complement(559912..561936)
FT                   /locus_tag="ETAF_0486"
FT   CDS_pept        complement(559912..561936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0486"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40610"
FT                   /db_xref="GOA:A0A0H3DQ06"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ06"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40610.1"
FT                   /translation="MAATLLAACSGRVSTTPPAPVQSEATASADYYLQQMQQSSDDSKA
FT                   DWQLLAIRALLREGKLPQAADLLGQLPSQLSEAQQLEQRLVSAELEIARHAPQQAQAIL
FT                   TKLDVAQLSQAQQLRYYQAVIAAAQGKTTLAQIRAYIALQPLLTQEKQRKANIDATWAA
FT                   LSTLTPADLNGMVINANEDILRGWLDLLRLYQDNRQDPALLKAAIKDWQTRYPNNPAAT
FT                   LLPSALDNILHLQSASTASIALLLPLNGQAKVFSDAIEAGFNAAKNGAFSQNSAPTAAA
FT                   ATDNGAPASSGTLAAATTPSAPADVNAAGAVSPSAQGTDAAAPAAPNDSAALPPLDAAG
FT                   DPIAPSVSPGNPDAHIQVYDTSSQPLPALLSQAQQAGASLVVGPLLKNNVDQLNTLSTP
FT                   LNILALNQPEQVQNHPNICYFALSPEDEARDAARHIWAQGKRTPLLLIPRSPLGDRVAK
FT                   AFATEWQSLGGGSVLQQTFGSSAELRSTINGGTGIRLTGQPVSIAPAQPASVTIAGLTI
FT                   PAPVQPPVASGGGVDAVYIIATPAEITLIKPMIDLANGTHNGIGLYASSRSYQAGAGPD
FT                   FRLEMEGVQFSDIPLLAGSDPAILQQAPAQYRNDYSLMRLYAMGADAWTLANHFAQLRQ
FT                   IPGFQVQGATGTLSANDNCVIQRKLPWLQYQKGSIVPVQ"
FT   gene            562051..562920
FT                   /locus_tag="ETAF_0487"
FT   CDS_pept        562051..562920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40611"
FT                   /db_xref="GOA:A0A0H3DQ76"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ76"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40611.1"
FT                   /translation="MNQNDHAAISAATLYVVPTPIGNLGDITQRALETLKAVDLIAAED
FT                   TRHTGMLLQHFAINARFFALHDHNEQQKADQLLAKLREGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALCAAGVASDRFCYEGFLPAKGKARRDRLRDLQQEA
FT                   RTLIFYESTHRLLESLADMVSELGAERYVVLARELTKTWENIHGAPVAELLAWVQQDEN
FT                   RRKGEMVLIVEGYQADDEALSPEALRTLALLQAELPLKKAAALAAEIHGVKKNTLYKYA
FT                   LAQQSGDK"
FT   gene            complement(563359..564039)
FT                   /locus_tag="ETAF_0488"
FT   CDS_pept        complement(563359..564039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0488"
FT                   /product="Protein smp precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40612"
FT                   /db_xref="GOA:A0A0H3DRI0"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRI0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40612.1"
FT                   /translation="MVKATLRFRLHRTAIVLICLALLVILMQGASYFSLSHQRARLDQV
FT                   SELAQTLAQQVAARLSPLINDDTPDTKKIAPILEALTRHSRILDASVYALDGSLIAQAG
FT                   ERVEVRDRLALDGQRAGSYFNHQIVQPIDGRDGPLGFLRLTLDTHVLATESQQVDNTTN
FT                   LLRLMMLLALAIGIILARTLLQARRSRWQQSSYLLTANVPLEEESERDAPTQENAASTT
FT                   PPTS"
FT   gene            564146..565123
FT                   /locus_tag="ETAF_0489"
FT   CDS_pept        564146..565123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0489"
FT                   /product="Phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40613"
FT                   /db_xref="GOA:A0A0H3DMS2"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40613.1"
FT                   /translation="MPNSLTFCDLPAEIYRWPGLPLSLSGDEVMPLDYRAGHTGWLLYG
FT                   RHLDKAALQAFQRRLAAPLVVVAAWCIEDYQVVRLAGGMPARAAKLANEQGIDTAVLGR
FT                   LPHLRSPGLLVMDMDSTAITIECIDEIARLAGVGGEVAAVTERAMRGELDFAASLRQRV
FT                   AALEGADAAILQQVRDDLPLMPGLTSLVRKLQAFDWHVAIASGGFTYFADHLRTRLNLS
FT                   AAVANALEVHNGRLTGRVTGRIVDAQCKEDTLCELAQRLNIPLTQTVAIGDGANDLKMI
FT                   QRAGLGIAFHAKPCVYDRAPLAIRHADLIGVLCVLSATLKHEER"
FT   gene            565178..566566
FT                   /gene="radA"
FT                   /locus_tag="ETAF_0490"
FT   CDS_pept        565178..566566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="ETAF_0490"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40614"
FT                   /db_xref="GOA:A0A0H3DN53"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN53"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40614.1"
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACQAWNSISEVRLAAAPAA
FT                   GRSARLSGYAGDAGSLSKVQKLSEISLEALPRFSTGFTEFDRVLGGGVVPGSAILIGGN
FT                   PGAGKSTLLLQTLCRLSQQMKTLYVTGEESLQQVAMRAHRLGLPTEGLNMLSETSIEQI
FT                   CLIAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHV
FT                   TKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREV
FT                   SNPSAIFLSRGEEITAGSSVMVVWEGTRPLLVEIQALVDTSMMSNPRRVAVGLEQNRLA
FT                   ILLAVLHRHGGLQMADQDVFVNVVGGVKVSETSADLALLMSLVSSLRDRPLPQDLVIFG
FT                   EVGLAGEVRPVASGQERIIEAAKHGFRRAIVPHANVPKKAIPNMTVYGVKKLSDALDIL
FT                   QDLA"
FT   gene            complement(566629..568296)
FT                   /gene="yjjK"
FT                   /locus_tag="ETAF_0491"
FT   CDS_pept        complement(566629..568296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjjK"
FT                   /locus_tag="ETAF_0491"
FT                   /product="ABC transporter ATP-binding protein YjjK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40615"
FT                   /db_xref="GOA:A0A0H3DQ10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ10"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40615.1"
FT                   /translation="MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDTDIEGEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGDVKQALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAK
FT                   GRQSKGKARLARFEELNNTDYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLID
FT                   ALSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQADSGSITLGDTVTLASVDQFRDAMD
FT                   DKKSVWEEISGGQDIMRIGNFEIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDVETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDE
FT                   GRVEFFEGNFSEYEEYKKRTQGAEALQPHRIKYKKIAK"
FT   gene            568683..570611
FT                   /locus_tag="ETAF_0492"
FT   CDS_pept        568683..570611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0492"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40616"
FT                   /db_xref="GOA:A0A0H3DQ82"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ82"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40616.1"
FT                   /translation="MVMVGKWRYWSVGLCLALSAAAASADSLDAQRARYQQIKQAWDGN
FT                   RMDSVNQLMPTLRDYPLYPYLAYRALTQDMSQVNAQQIKAFLQQYPTLPPARSLTSRYV
FT                   NELARREDWIGLLAFSPQPPQPVAARCNYYYAQYATGHAEAAWRGAQTVWMSGQSLPSS
FT                   CDKLFDAWKGAGGLRDQAILARLRLALEKGNAGLVKYLQQQLPANYQTLNTALTALQAN
FT                   PRSVEAFARSVAPSDFTRDIVGVAFASLARQDADAARAMLPTLVRLQHIPSSQRQAMEE
FT                   TIAWRLMGSDASADDRRWRDGVIRRSHNAALLERRLRMALGEGNPAQVREWLGRLPQSV
FT                   RDKDEWRYWQAVALIDEGKRSEGQAILRALIKQRGFYPMVAAQRLGIPYPLQVMRAVRP
FT                   DAALAQEPAIARVRELMYWNMDNTARSEWSALVASKPRPQQEALARYALDQGWADLSVQ
FT                   ATIVAKLWDHLQERFPLAWPQEFRSATEDKGITQSYAMAIARQESAWNPEARSSVGASG
FT                   LMQLMPKTAEHTAKMFSLSHYQNSSQLFDPKINIDIGTRYLEYVYQSLGRNRILASAAY
FT                   NAGPSRVNTWLGNSDGRVDAVAFIESIPFSETRGYVKNVLAYDAYYRYFMHRPDQILTD
FT                   AEWARRY"
FT   gene            570703..571035
FT                   /locus_tag="ETAF_0493"
FT   CDS_pept        570703..571035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0493"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40617"
FT                   /db_xref="GOA:A0A0H3DRI4"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRI4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40617.1"
FT                   /translation="MQKTTPAPDQAPAEPDDWQRFIQLLQQAYQEGCQEPMLQLFLTPD
FT                   ERDALATRVRIIEELLKGEMSQRELKSQLGAGIATITRGSNSLKMASPDFKRWLVRQLL
FT                   PSTPQA"
FT   gene            complement(571026..571562)
FT                   /locus_tag="ETAF_0494"
FT   CDS_pept        complement(571026..571562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0494"
FT                   /product="Inosine/xanthosine triphosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40618"
FT                   /db_xref="GOA:A0A0H3DMS6"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40618.1"
FT                   /translation="MYHVVAATTNPAKIQAITLAFDAAFGAGQYRIEGIDVDSGVPEQP
FT                   LGSTQTRSGARHRVICARQLRPEADFWVGIEAGIEDNMTFAWMSVENHCHRGESRSASL
FT                   TLPDSVMDGIRQGQTLGHEMRRLSGIDDINRREGAIGIFTQGRLSRTSVYYQALLLALA
FT                   ALEPGYHREPPPHYA"
FT   gene            571816..572373
FT                   /locus_tag="ETAF_0495"
FT   CDS_pept        571816..572373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0495"
FT                   /product="Phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40619"
FT                   /db_xref="GOA:A0A0H3DN55"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN55"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40619.1"
FT                   /translation="MGEQQARQVGARLGQMGITHVIASDLGRTQQTGEIIAAACRCPLT
FT                   LDARLRELSMGVLESRLLASLSPQEEQWRLSMLDGSPQGCIPQGETMAQLAERMQQALN
FT                   DCLALPQGSRPVLVSHGIALGCLLSTVLGLPPYAERRLRLRNCSLSRVDYQQSAWLASG
FT                   WVVETAGDVQHLAQPSMDEVLR"
FT   gene            complement(572370..573260)
FT                   /locus_tag="ETAF_0496"
FT   CDS_pept        complement(572370..573260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0496"
FT                   /product="Right origin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40620"
FT                   /db_xref="GOA:A0A0H3DQ14"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ14"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40620.1"
FT                   /translation="MDQADIIHDLLNWLEGHLDHPLTLDNVAAKAGYSKWHLQRMFKDV
FT                   TGQAIGAYIRARRLSNAAAALRLTSRPILDIALQYRFDSQQTFTRAFKKQFNKTPALYR
FT                   REEEWHAYGMRPPIRLGDYAIPTPEFITLPSLSLVGVTQSYTCTLEQICRVRTELRTQF
FT                   WRDFLHAVQDIRDIPPVLYGLHHSHPNPDKDDEQSIMYTTALEPHLLPKQVTREVQSIE
FT                   LAGGEYAKFSYQGPTEHFQAFIMSLYNSALPTLNLTRRRGYDVERFYPLVDSTQRPPKN
FT                   LRCEYLIPIRHTPSS"
FT   gene            573455..573943
FT                   /gene="creA"
FT                   /locus_tag="ETAF_0497"
FT   CDS_pept        573455..573943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creA"
FT                   /locus_tag="ETAF_0497"
FT                   /product="hypothetical protein CreA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40621"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ88"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40621.1"
FT                   /translation="MNKYFVGLCVALTTLWGASVHAEEIGSVDTVFKLFGPDHKIVVEA
FT                   FDDPDVENVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIALSEKIRNKKADGEV
FT                   VFRKRTSLVFKKLQVVRFYDSKRNVLIYLSYSDRVVEGSPKNAISAVPVMPWSAAPQG"
FT   gene            complement(574014..575732)
FT                   /locus_tag="ETAF_0498"
FT   CDS_pept        complement(574014..575732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0498"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40622"
FT                   /db_xref="GOA:A0A0H3DRI8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRI8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40622.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVVSHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLNKVENIVREEMNYAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGDRPF
FT                   VLGPTHEEVITDLVRNEISSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTTQASLQETYDAMYAAYGRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSTASDYAANIELAEALAPTAERAAATQPMQLVDTPNAKTIAELVEQHGLPIEKTVKTL
FT                   LVHASEESGHTLVALLVRGDHELNEVKAEKLALVASPLTFANEAEIRALVNAGPGSLGP
FT                   VNLPLPVVADRAVAAMSDFGAGANIDGKHYFGINWERDVALPQIADIRNVVEGDPSPDG
FT                   KGTLLIKRGIEVGHIFQLGTKYTEALNATVQGEDGRNQLMTMGCYGIGVTRVVAAAIEQ
FT                   NHDERGIIWPDAIAPFQVAILPMNMHKSFRVKEVAERLYDELRAKGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTVVIGDRNLDNNEIEYKYRRSGEKLMISVDEIAAFLQAQIAR"
FT   gene            complement(575851..576555)
FT                   /locus_tag="ETAF_0499"
FT   CDS_pept        complement(575851..576555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40623"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40623.1"
FT                   /translation="MSQFQFAPIGVIRSPYKEKFAIPRQPGLICDGGGALELLPPYNQP
FT                   DAVRGLEGFSHLWVIFVFHQTMDGGWRPTVRPPRLGGNARVGVFATRSTFRPNPIGMSL
FT                   VELHGIETRNGVRLQLGSLDLVDGTPVLDIKPYLPFAESQPQARAGFAQQAPPADMPVV
FT                   FSPDAQAQIAQRQRDYPHLARFIRQVLTQDPRPAYRHAEEDDRVYAVHLLDFNLRWQVK
FT                   NGVCDVLGLDPR"
FT   gene            complement(576552..576974)
FT                   /gene="rcsF"
FT                   /locus_tag="ETAF_0500"
FT   CDS_pept        complement(576552..576974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ETAF_0500"
FT                   /product="RcsF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40624"
FT                   /db_xref="GOA:A0A0H3DN59"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN59"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40624.1"
FT                   /translation="MRALPLCLLTASLALSGCSLLSRPAAPIKPLAADRTPETVAKPRA
FT                   VTPRQTPITLYESAEDLIGKPFRDLGEVSGSVCQTRPHHSAPSLTTARKRMLYKAAQLK
FT                   ANAVLLHSCQILSQSHGCYRQATCTGSALSIATPAQ"
FT   gene            complement(577085..577900)
FT                   /locus_tag="ETAF_0501"
FT   CDS_pept        complement(577085..577900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0501"
FT                   /product="Methionine ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40625"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ18"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40625.1"
FT                   /translation="MSTKFTSLALVGTLLGTLALAGCGQEEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLNVELVTFNDYVLPNEALNKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLNELQDGAQIAIPNDPTNLGRSLLLLQSVGLIKLKDGIGL
FT                   LPTVLDITENPKHLKLVELEAPQLPRSLDDNQIALAVINTTYASQIGLTPAKDGIFVEG
FT                   KDSPYVNLIVAREDNKDAENVKKFVQAYQSDEVYNAANKIFNGGAVKGW"
FT   gene            complement(577963..578592)
FT                   /locus_tag="ETAF_0502"
FT   CDS_pept        complement(577963..578592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0502"
FT                   /product="Methionine ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40626"
FT                   /db_xref="GOA:A0A0H3DQ93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ93"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40626.1"
FT                   /translation="MVRGIWETVVMTLVSGFFGFVIGLPVGVLLYTSRPGQILENARLY
FT                   NLLSALVNIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFIARMVENSL
FT                   LEIPSGLIEAARAMGATPMQIVNKILLPEALPGLINAATITLITLVGYSAMGGAVGAGG
FT                   LGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK"
FT   gene            complement(578609..579640)
FT                   /locus_tag="ETAF_0503"
FT   CDS_pept        complement(578609..579640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0503"
FT                   /product="Methionine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40627"
FT                   /db_xref="GOA:A0A0H3DRJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRJ1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40627.1"
FT                   /translation="MIKLTHITKVFQQGQRRISALDDVSLHVPAGQIYGVIGSSGAGKS
FT                   TLIRCVNLLERPTQGQVFVDGQDLTAMSTGQLTRTRRQIGMIFQHFNLLSSRTVYGNIA
FT                   LPLELDRVPRDEITRRVTELLALVGLADKRDAYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRAILELLKDINRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQ
FT                   GSVGEVFSHPKTPLAQQFIHATLHLDIPDDFAERMTPTRSADSQPLLRLEFTGQSVDAP
FT                   LISQAVRRFNVDISILSSQMDYAGGVKFGVMLAEVHGDDADAQAAIAFFEQHHVKVEVL
FT                   GYV"
FT   gene            579832..580395
FT                   /locus_tag="ETAF_0504"
FT   CDS_pept        579832..580395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0504"
FT                   /product="D-glycero-D-manno-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40628"
FT                   /db_xref="GOA:A0A0H3DMT3"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40628.1"
FT                   /translation="MAQQIPAIFLDRDGTMNVDHGYVHDSDDFQFIDGVIDAMRELKAM
FT                   GFALVMVTNQSGIARGMFTEDQFMHLTEWMDWSLADRGVDLDGIYYCPHHPQGSVPEYT
FT                   QACDCRKPQPGMLLEAQRFLNIDMAASYMVGDKREDLQAAQAAGVGTKVLVRSGKPLSA
FT                   EGEALADIVLDSLAQLPQAIKARG"
FT   gene            580878..582306
FT                   /gene="rrsA"
FT                   /locus_tag="ETAF_3242"
FT   rRNA            580878..582306
FT                   /gene="rrsA"
FT                   /locus_tag="ETAF_3242"
FT                   /product="Small Subunit Ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            582405..582480
FT                   /gene="trnE"
FT                   /locus_tag="ETAF_3243"
FT   tRNA            582405..582480
FT                   /gene="trnE"
FT                   /locus_tag="ETAF_3243"
FT                   /product="tRNA-Glu"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            582649..585577
FT                   /gene="rrlA"
FT                   /locus_tag="ETAF_3244"
FT   rRNA            582649..585577
FT                   /gene="rrlA"
FT                   /locus_tag="ETAF_3244"
FT                   /product="Large Subunit Ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            585666..585785
FT                   /gene="rrfA"
FT                   /locus_tag="ETAF_3245"
FT   rRNA            585666..585785
FT                   /gene="rrfA"
FT                   /locus_tag="ETAF_3245"
FT                   /product="5S ribosomal RNA"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT   gene            complement(585920..587566)
FT                   /locus_tag="ETAF_0505"
FT   CDS_pept        complement(585920..587566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0505"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40629"
FT                   /db_xref="GOA:A0A0H3DN60"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN60"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40629.1"
FT                   /translation="MVRLLRVILPLLSLLWSAALSAAEPRLAPDEAEQARTVTILQQPI
FT                   VMLQAHFGLATPEERVKQAAQDLQNIAPGDLQSPVQITPTQRYGQPVRLFSINGKPLLL
FT                   LAQQDLDVGDDLSLDQAAERIQQRLENLRGALIEQHSTHYLALAALRFAGGTALLFALL
FT                   WLARRVQKRIRSHFDILIMQHRGWVPYRLRSYVGGLERRISAVLLLLGCAIAGYIWLVW
FT                   ALKLFPATRYWGYSLHRYSLAAATQLLQDLIAALPDLLSLAAIAAVALLIQRLLRLLFR
FT                   QVESGRLKLPGLYPDTIKATRRLLSVIIWMFALSMAYPFFPGADTLAFKGVSVFFGLMI
FT                   TLGSAGLVSHAMSGLVLIYSRALHQGDYVRIGEYDGFVDDIGILATKLKTREGFDVTIP
FT                   NAVVASGKIVNLSTHAAHGGIIISTGVTIGYDVPWRQVHAMLLLALQQTEGIQHDLEPT
FT                   IRQNELQDWYVSYELRAEIVAGAAPAQVKSALHGHILDVFNRFGVQIMSPHFVMQPKEA
FT                   IWVSQEKWFSPPAQPPAPSAAEENRGDKAGP"
FT   gene            complement(587676..589031)
FT                   /locus_tag="ETAF_0506"
FT   CDS_pept        complement(587676..589031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0506"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40630"
FT                   /db_xref="GOA:A0A0H3DQ19"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ19"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40630.1"
FT                   /translation="MLSKFKRAKHQQHLAQLPKLPQQVGEVETLFSPAAFRQALLEAIG
FT                   QATQRIYLVALYLENDDGGRDVLNALYQAKRQRPQLEIFVLVDWHRAQRGRIGAEASNT
FT                   NADWYCRMASEYPDVIVPIYGVPVNTREALGVLHLKGFIIDDRVIYSGASLNDVYLHRH
FT                   DKYRYDRYHFIQNPRLAGVMCQFVQSTLLSNPAVQRLDRCDRPKNPEIRNETRQFRHAL
FT                   RDSGYQVPAEAGNEELAVTPLAGLGKQNILNKTIHHLICSTERTLTLCTPYFNLPAPLV
FT                   RDIIFLLRQGKQVEIIVGDKKANDFFIPEEEPFKIIGALPYLYEINLRRFISRLQPYLD
FT                   NGQLTVRLWRDDDNTYHLKGMWVDDRWQLITGNNLNPRAWRLDLENAILIHDPRGEIQH
FT                   QRQHELECIRRHTQVVRSYEDLETLQQYPLKVRKLIRRLRRIRVDRLISRIL"
FT   gene            complement(589166..591838)
FT                   /locus_tag="ETAF_0507"
FT   CDS_pept        complement(589166..591838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0507"
FT                   /product="Protein acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40631"
FT                   /db_xref="GOA:A0A0H3DQ96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ96"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40631.1"
FT                   /translation="MSQRSLESLLRPKSIAVIGASNQPSRSGHLVMLNLLNGGFPGPIM
FT                   PVTPRYQAVCGVLAYPTIADLPCVPDLAILCTNAQRTPALIAELGAKGCRAAIVIAAPA
FT                   SQADALRSLALRHGVRLLGPNSLGLLAPWQKLNASFSPVPILPGRLAFISQSAAVSNTI
FT                   LDWARQREIGFSLFVALGDSLDTDVDDLLDYLARDAKTSAILLYLEHLHDARRFLSAAR
FT                   SAARNKPILVIKSGRSPQARRVLGEAAGLDIAYDAAIQRAGLLRVQNTHELFSAVETLS
FT                   HMHPLRGERLLIVGNGAAPLAMALDELQRRGGHPAPCDDALHSALCTALPAETYLQGPI
FT                   DLRDDATPARYQATLQHLLDSRCYDALLIQHAPSATAPATETARALIETLSAHPRARHV
FT                   TLMTNWSGENTSQEARRLFSEAGIPTYRTPEGAVTAFMHMVEYRRNQRQLMETPALPAS
FT                   LPANAALAHRLLAQAQADGVTRLDTHEVRDILACYGLDTLPSWIANDSTEAVHIAERIG
FT                   YPVALKLRSPDIAHNSDVQGVMLYLRNAREVEQAANAIFDRARQAYPQARILGLLVQST
FT                   ANRIGAQELRICVENDAVFGPLILLGEGGAEWDAQRDAAAALPPLNMNLARYLIVQAQK
FT                   RGHIRRRAPLADLDIAGLSQVLVQVSHLIVDCPTIQRLEIHPLLACGSTFTLLDVSLQL
FT                   LDRHAAPTRLAICPYPHQLKESIRLKNGGDALLRPILPEDEPLLQQFIQRVSKEDLYYR
FT                   YFSEINEFTHEDLAKMTQIDYEREMAFVAVQSTPQGEEILGVTRALIDPDNTDAEFAVL
FT                   VRSDRHGLGLGSILLDKLIRYARQRQLRRLLGITMPTNRGMIALARKIGFQVEILLEDG
FT                   IVNLSLSLSDSTLPDSEKC"
FT   gene            complement(591912..592601)
FT                   /locus_tag="ETAF_0508"
FT   CDS_pept        complement(591912..592601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40632"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRJ4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40632.1"
FT                   /translation="MSANAVLRLRAARLSQSTRPFHARGCRVQRCQRCLLPQIHCLCDT
FT                   LASYPAHSRFCLMMYDTEPLKPSNTGRLIADVLPDTLAYGWSRTQPDPQLLQLLDDPAY
FT                   QPYVVFPGSYAEPERVVTEVRCDDRRPLFIMLDGTWPEARKMFRKSPYLDRFPVFSINM
FT                   AQAPGYLLREAHRPEQYCTAEVAAALLALADDRQASQGLLQHFHHFRQQYLLGKSHPQV
FT                   PVAAAVE"
FT   gene            complement(592700..593131)
FT                   /locus_tag="ETAF_0509"
FT   CDS_pept        complement(592700..593131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0509"
FT                   /product="Thioredoxin 2"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40633"
FT                   /db_xref="GOA:A0A0H3DMT7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40633.1"
FT                   /translation="MNTVCPACHTTNRIPDDRRSEQATCGRCSHALFDGAIVNASEETL
FT                   DKLLQDDLPVLIDFWAPWCGPCQGFAPVFAAVAAARAGEVRCIKVNTEDQPALSSRFRI
FT                   RSIPTIMLYRNGQRVDMLNGAMPQAPFEAWLDEQLAKQA"
FT   gene            593338..594519
FT                   /gene="yfiF"
FT                   /locus_tag="ETAF_0510"
FT   CDS_pept        593338..594519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiF"
FT                   /locus_tag="ETAF_0510"
FT                   /product="hypothetical tRNA/rRNA methyltransferase YfiF"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40634"
FT                   /db_xref="GOA:A0A0H3DN65"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN65"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40634.1"
FT                   /translation="MSDSLNGKNGKVKVMYVRDSDAADERQSRAPAKGRPGARGDRSRS
FT                   DRNDRGDRSRSDRNDRGDRSRSDRNDRGDRSRSDRNDRGDRSRSDRSDRGDRAARPARS
FT                   EQGVGERSPWRTVSLGDNGGVGGESDHGGISGKSFIDPEQLRRQRAEETRVYGENACQA
FT                   LFASRPEAIVRAWFLQAVTPRFREALRWMAANRKAYHVVDDAELTKASGTDHHGGVCFL
FT                   IKKRRSLDAQQYLANQAEDAVDCVLALENVANPHNLGGIMRTCAHFGIRGIIAPESAAL
FT                   ESGAAVRTAEGGAEHVQAIDAEDFSAALDTFRRAGYTIVTTSSHKGTTQLHRATLPAKI
FT                   VLVVGHEGDGLSDGTLQQGDLSVSIGGTGSVESLNVSVATGIMLAEWWRQNAR"
FT   gene            complement(594593..595309)
FT                   /gene="arcA"
FT                   /locus_tag="ETAF_0511"
FT   CDS_pept        complement(594593..595309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="ETAF_0511"
FT                   /product="Aerobic respiration control protein ArcA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40635"
FT                   /db_xref="GOA:A0A0H3DQ24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ24"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40635.1"
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSE
FT                   FDINLVIMDINLPGKNGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
FT   gene            595958..596665
FT                   /locus_tag="ETAF_0512"
FT   CDS_pept        595958..596665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0512"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40636"
FT                   /db_xref="GOA:A0A0H3DQA2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQA2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40636.1"
FT                   /translation="MQIHIVLVAPARAENVGAAARAMKTMGFTSLRIVDSKADGEPAAR
FT                   WVAHGAGDILDGARHFDTLAQALADVDFSVASTARSRARFHYYCTPQELCAVLQEKQRW
FT                   MASCALVFGREDSGLTNDELALVDLLTGVPMAADYPSLNLGQAVMVFCYQLSSLMQVQA
FT                   AQAPAAQGEQLAALRARTDRLLTTLGVDGDTKLSDWLDQRIGLLAQRDTAMLHRLLHDI
FT                   ESALETSASGKKM"
FT   gene            597140..599497
FT                   /locus_tag="ETAF_0513"
FT   CDS_pept        597140..599497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0513"
FT                   /product="Aspartokinase / Homoserine dehydrogenase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40637"
FT                   /db_xref="GOA:A0A0H3DRJ8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRJ8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40637.1"
FT                   /translation="MLSAPARITNHLVALIERTIAGQDIQPILGDAEKIFTDLIDGLAQ
FT                   AQPGFDAAPLRLRVSQEFGQIRQVLHGIALLGQCPDSVNAALICRGEALSIAIMAALLR
FT                   ARGRQVTVIDPVSSLLARGGYLESSVDIAESARRIAAQAIPADSLILMAGFTAGNERGE
FT                   LVVLGRNGSDYSAAVLAACLRAACCEIWTDVDGVYTCDPRLVPDARLLESMSYQEAMEL
FT                   SYFGAKVLHPRTISPIAQFQIPCLIKNTANPQAPGTLIGAQRRGDDALPVKGITHLNHM
FT                   AMLNVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISFCVPQGELARACQAL
FT                   QDEFFLELKDGLLEPLDVIEHLAIISVVGDGMRTQRGISAKFFSALARANINIVAIAQG
FT                   SSERSISVVVNNDAATTAVRVTHQMLFNTDQVIEVFVIGVGGVGGALLAQIERQQAWLK
FT                   SKHIDLRVCGIANSRALLTHVHGIDMANWRGALEQASQPFNLGRLMRLVNEYHLLNPVI
FT                   VDCTSSQALADQYADFLGNGFHVVTPNKKANTASLDYYRLLRQKAAGSQRKFLYDTNVG
FT                   AGLPVIENLQNLLSAGDELQRFCGILSGSLSFIFGRLEEGATFSQATREARQLGYTEPD
FT                   PRDDLSGMDVARKLLILAREAGYALELDDICVEPVLPAAFDARGDVDTFLANLAQADDA
FT                   FSARVAAAQARGCVLRYVGEIDQGRCSVRIAEVDSDDALYKVKNGENALTFYSRYYQPL
FT                   PMVLRGYGAGNDVTAAGVFADLLRTLSWKLGV"
FT   gene            599502..600428
FT                   /locus_tag="ETAF_0514"
FT   CDS_pept        599502..600428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0514"
FT                   /product="Homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40638"
FT                   /db_xref="GOA:A0A0H3DMU1"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40638.1"
FT                   /translation="MKIYAPASIGNVSVGFDVLGAAVTPLDGTLLGDCVSVEASDRFAL
FT                   HCRGRFVDSLPAAAQENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVVA
FT                   ALAALNRFAGDPLDAQRLLTLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQGIISQP
FT                   VPCFDDWLWVMAYPGIKVSTAEARAILPLHYSRGDCVRHGRHLAGFIHACHTRQPSLAA
FT                   ALMQDVIAEPYRCGLLPGFADARRAAGELGTLACGISGSGPTLFAVCDDPAAAQAVAQW
FT                   LTQHYLQNEQGFVHICRLDTAGARQLG"
FT   gene            600432..601718
FT                   /locus_tag="ETAF_0515"
FT   CDS_pept        600432..601718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0515"
FT                   /product="Threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40639"
FT                   /db_xref="GOA:A0A0H3DN67"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN67"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40639.1"
FT                   /translation="MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDA
FT                   LLEQDFVTRSAHILAAYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTL
FT                   AFKDFGGRFMAQMLQQVAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVS
FT                   PLQEKLFCTLGGNIRTLAIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQAARNQLVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPR
FT                   FLSSGVWQPHETVATLSNAMDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAM
FT                   RELAALGYVSEPHAAIAYRALRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQA
FT                   LAARAALPLLSQTLPADFSRLRAALLDRP"
FT   gene            complement(601776..602573)
FT                   /gene="yaaA"
FT                   /locus_tag="ETAF_0516"
FT   CDS_pept        complement(601776..602573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ETAF_0516"
FT                   /product="YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40640"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ26"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40640.1"
FT                   /translation="MLTIISPAKTLDYTSPLATQRYTQPQMLAQAETLMQTVRTLTPAQ
FT                   LGSLMKISDKLAGLNAARFTEWQPRFTPENARQAILAFKGDVYTGLQAETFSEQDFDFA
FT                   QRHLCMLSGLYGVLRPLDLMMPYRLEMGTRLHTPYGNDLYAFWGDSITRQLNQQLQQQG
FT                   DRVVVNLASDEYFKAVRPAALEGELIKPIFMDEKNGSMKVISFYAKKARGLMSRFIIQA
FT                   RLRDPEQLKAFDLEGYAFAGETQGRQGRELLFTRRHSAISPAR"
FT   gene            complement(602685..604118)
FT                   /locus_tag="ETAF_0517"
FT   CDS_pept        complement(602685..604118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0517"
FT                   /product="Sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40641"
FT                   /db_xref="GOA:A0A0H3DQA6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQA6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40641.1"
FT                   /translation="MTDLISFINNILWGSVLIYLLIGAGLYFTFRTGFIQFRHFGHMFS
FT                   VLKNSNKADSGGISSFQALCTSLAARVGTGNLTGVAIALTAGGPGAIFWMWIIALIGMA
FT                   TSFIESTLAQLYKTRDDQGNFRGGPAYYMEKGLGMRWMGILFSLFLLVAFGLVFNAVQA
FT                   NSIAQATAVAFHIPPLYVGIALMLMCGVVIFGGLRSIARTAELVVPVMAIAYLLLAFWV
FT                   MGHNLARMPEVLLLVIKSAFGLQEAAAGAIGYGISQAMTQGIQRGLFSNEAGMGSAPNA
FT                   AASATPYPPHPASQGYVQMLGVFMDTLVICSATAAIILSSGVLDAAPGTISGIELTQRA
FT                   LSSAVGDWGGIFIAVAIFFFAFTSIIANYAYAESNLIFLEHNHPHGLVFLRLCTLGMVM
FT                   FGALAELPLVWKMADLSMALMAITNLIAILLLSGVAFKLARDYNHQRRLGLLPTLDLSK
FT                   YPEIQQQVEPGIWEKPPRQ"
FT   gene            604549..605502
FT                   /locus_tag="ETAF_0518"
FT   CDS_pept        604549..605502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0518"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40642"
FT                   /db_xref="GOA:A0A0H3DRK4"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRK4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40642.1"
FT                   /translation="MTDKLTSLRQLTTVVADTGDIAAMKQYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAITWARAQSGDRAQQIVDASDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEASVAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWHKANGDKSEFAPAEDPGVISVTEIYNYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTISPSLLKTLSESTGSVERKLAYQGEVKARPARMSEAEF
FT                   YWQHNQDPMAVEKLADGIRKFAVDQGKLESMIGALL"
FT   gene            605632..607083
FT                   /locus_tag="ETAF_0519"
FT   CDS_pept        605632..607083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0519"
FT                   /product="Succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40643"
FT                   /db_xref="GOA:A0A0H3DMU6"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40643.1"
FT                   /translation="MMQLHDMGLFRQQALIDGVWCDADSGDVMTVINPASGDTLGSVPK
FT                   MGAAETRRAIEAAAHALPGWRARTGKARAQILRRWFDLILAHQEDLARLMTLEQGKPLA
FT                   ESRGEIAYAASFIEWFAEEAKRVYGDTIPAPQGDKRLLVIKQPIGVTAAITPWNFPAAM
FT                   ITRKAGPALAAGCTMVLKPASQTPYSALALAELALRAGVPQGVFSVVTGSAGAVGNELT
FT                   ANPLVRKLSFTGSTEIGRQLMAQCAHDIKKVSLELGGNAPFIVFDDADLDQAVAGAMAS
FT                   KFRNAGQTCVCANRLYVQEGIYERFAEKLCSAVQALKVGNGLDDGVTVGPLIDSRARAK
FT                   VEAHIADAVARGARIACGGQADARGENFFCPTVLLDVPADAQVAREETFGPLAPLFRFR
FT                   DEDEVIARANATEFGLASYFYTRDVGRVFRVAEALEYGIVGINSGLISNEMAPFGGVKS
FT                   SGLGREGAKYGIEDYLEIKYLCLGL"
FT   gene            607254..607910
FT                   /locus_tag="ETAF_0520"
FT   CDS_pept        607254..607910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0520"
FT                   /product="putative hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40644"
FT                   /db_xref="GOA:A0A0H3DN71"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN71"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40644.1"
FT                   /translation="MWRKHFAAIFLDMDGALLDSDDHAEQVWEQWAHQRQIDHALLRPR
FT                   IYSQRVQETLRQLAPRYSDDAECQRLEQALLAAVRQRRSRLRQDAAAWLAMLGETPWGV
FT                   VTQAGQPRAAEQIAHSGMCPPPLVIGAEQVSCGRPDPEPYLLAASHYGLDPRDCLVIES
FT                   DEAGIRAAQAAGMTVIALSYRRPRHSLQRADVVIGGWRSIILHPQPEGIVVEVIA"
FT   gene            607907..608494
FT                   /gene="mogA"
FT                   /locus_tag="ETAF_0521"
FT   CDS_pept        607907..608494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="ETAF_0521"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40645"
FT                   /db_xref="GOA:A0A0H3DQ31"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ31"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40645.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDLGIPALEAWLASALATPYTLETR
FT                   LIPDEQPLIEQTLCELVDERGCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALIINLPGQPKSIRETLEGLKDASGAPLVHGIFASVP
FT                   YCIQLLEGPYVETHSAVIAAFRPKSAQRETIN"
FT   gene            608616..609926
FT                   /gene="proP"
FT                   /locus_tag="ETAF_0522"
FT   CDS_pept        608616..609926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="ETAF_0522"
FT                   /product="L-Proline/Glycine betaine transporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40646"
FT                   /db_xref="GOA:A0A0H3DQA9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQA9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40646.1"
FT                   /translation="MELHNHRRLNHQDYKTLALAALGGALEFYDFIIFVFFAAVVGALF
FT                   FPPDMPEWLRLVQTFGIFAAGYLARPLGGIIMAHFGDRVGRKRMFSLSILLMALPTLVM
FT                   GMLPTYQSIGIAAPLLLLLMRVLQGAAIGGEVPGAWVFVAEHVPPQRIGFACGILTSGL
FT                   TSGILLGSLVATWLNSWLTPQEVLAGGWRIPFFLGGLFGLMAMYLRRWLHETPVFLAMQ
FT                   ARRALAAELPLKQVVRDHRRAVAVSMLLTWLLSACIVVVILMTPSLLQTQYGLPAALTL
FT                   QANSVAIVTMSLGCVLAGGLVDRVGAGRLFIGGGLLLALCTWQFFSSLSPQIEPAQLFW
FT                   RYGLAGFSIGTIGAVPFVMVCAFPAEVRFSGISFSYNLAYAVFGGLTPIAVTLLLTLTP
FT                   LAAGGYVLALSLLGVALGFYFQRAPLRAAQGEARLSR"
FT   gene            complement(610011..610514)
FT                   /locus_tag="ETAF_0523"
FT   CDS_pept        complement(610011..610514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0523"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40647"
FT                   /db_xref="GOA:A0A0H3DRK8"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRK8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40647.1"
FT                   /translation="MLNLHNAGLFPLTSVILAMGIFFGGIAQILAGLLEYKKGNTFGLT
FT                   AFTAYGSFWLTLVALLTLPKMGLAEATDALSLGAYLALWGIFTLFMFFGTLRSNRVLQF
FT                   VFASLTVLFFLLAYGNITANAAVLHIAGIEGIICGASAIYLAMAEVINEQYGRDVLPIG
FT                   AKHA"
FT   gene            610897..612804
FT                   /gene="dnaK"
FT                   /locus_tag="ETAF_0524"
FT   CDS_pept        610897..612804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ETAF_0524"
FT                   /product="Chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40648"
FT                   /db_xref="GOA:A0A0H3DMU7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40648.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQD
FT                   GEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYQIVAADNGDAWVE
FT                   VKGQKIAPPQISAEVLKKMKKTAEDFLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVARSMEPLKVALKDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVR
FT                   DAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEDAVKALEAAS
FT                   KGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK
FT                   "
FT   gene            612915..614051
FT                   /gene="dnaJ"
FT                   /locus_tag="ETAF_0525"
FT   CDS_pept        612915..614051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ETAF_0525"
FT                   /product="Chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40649"
FT                   /db_xref="GOA:A0A0H3DN74"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN74"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40649.1"
FT                   /translation="MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAED
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGAGGFGGGADFSDIFGDVFGDI
FT                   FGGGRRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLVECDVCHGSGAKKGSEPITC
FT                   PTCHGAGQVQMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGV
FT                   DTGDRIRLAGEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGE
FT                   IEVPTLDGRVKLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQK
FT                   QLLRELEESFGGPASDKNSPRSKRFFDGVKKFFDDLTR"
FT   gene            614299..615477
FT                   /locus_tag="ETAF_0526"
FT   CDS_pept        614299..615477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0526"
FT                   /product="Na+/H+ antiporter NhaA type"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40650"
FT                   /db_xref="GOA:A0A0H3DQ34"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ34"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40650.1"
FT                   /translation="MIKSLQRFVGSDAFGGVILIIAAALAMILANTDWTSHIYQAFLNT
FT                   PVEVRVGSLHINKNMLLWVNDALMAIFFLMIGLEVKRELVCGSLASARQAAFPVIAALG
FT                   GMVVPALIYLLFNGQDAVASTGWAIPAATDIAFALGVLALLGNRVPLALKVFLLALAII
FT                   DDLGAIIIIALFYTSDLSILSLAVAGAAIVALALLNLFNVRRVGLYILVGVVLWTAVLK
FT                   SGVHATLAGVVIGFFVPLKEQDGKSPARSLEHALHPWVAYMILPLFAFANAGVSLDGVT
FT                   LSGLFSLLPLGVIAGLFIGKPLGISLFCWLAVKLKLATLPQGTTFKEIIAIGVLCGIGF
FT                   TMSIFIASLAFGDADPALAVFSRLGILLGSSLAAIVGYLLLRRVLPAQKAAA"
FT   gene            615693..616595
FT                   /gene="nhaR"
FT                   /locus_tag="ETAF_0527"
FT   CDS_pept        615693..616595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ETAF_0527"
FT                   /product="Transcriptional activator NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40651"
FT                   /db_xref="GOA:A0A0H3DQB3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQB3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40651.1"
FT                   /translation="MRLSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLVFRYADRMFMLSQEMLDIVNYRKESSMLFDVGVADA
FT                   LSKRLVSQVLETAVADHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECGVSFFCRQPLPEMPFPTCLEQRKLLIPGRRSMLGRKLLNWFNSQGLQVQILG
FT                   EFDDAALMKAFGLYHDAIFVAPSIYAQDMYANVQDNIREVGRIDNVQEEYYVIFAERMI
FT                   QHPAVQRVCNKDFSALFSR"
FT   gene            complement(616665..616928)
FT                   /locus_tag="ETAF_0528"
FT   CDS_pept        complement(616665..616928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0528"
FT                   /product="SSU ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40652"
FT                   /db_xref="GOA:A0A0H3DRL4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRL4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40652.1"
FT                   /translation="MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKA
FT                   AAQAAYNDMQPIVDRQANKGLIHKNKAARHKANLTAQINAMQ"
FT   gene            617340..618302
FT                   /locus_tag="ETAF_0529"
FT   CDS_pept        617340..618302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0529"
FT                   /product="Riboflavin kinase / FMN adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40653"
FT                   /db_xref="GOA:A0A0H3DMV2"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40653.1"
FT                   /translation="MELIRGIHNLRARHRGCVLTIGNFDGVHRGHRALLARLRQEGERL
FT                   GLPVMVMIFEPQPLEMFAPQNAPARLTRLRDKCRYLADAGVDAVLCVRFDRQFASHSAQ
FT                   DFVKHLLVERLGVKFLMIGDDFRFGAEREGDYHMLQAAGKAYGFTVTNSLSFCVGDRRV
FT                   SSTAVRHALRHDDLALAESLLGHPYRIAGRVVHGDALGRTIGFPTANLPLKRLVAPVKG
FT                   VYAVDVYGLGLTPLPGVANIGTRPTVAGIRQQLEVHLLDVTMDLYGRHIDVVLRAKLRN
FT                   EQRFDSLDALKRQIAQDVVAAREFFGLTTPVQSLMAQSQ"
FT   gene            618327..621173
FT                   /locus_tag="ETAF_0530"
FT   CDS_pept        618327..621173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0530"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40654"
FT                   /db_xref="GOA:A0A0H3DN77"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN77"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40654.1"
FT                   /translation="MSDYKNTLNLPETGFPMRGDLAKREPGMLQHWYEQDLYGIIRNAK
FT                   KGKKSFILHDGPPYANGSIHIGHSVNKILKDIIIKSKGLSGYDSPYIPGWDCHGLPIEL
FT                   KVEQLIGKPGEKYSAAEFREQCRAYAAEQVAGQKADFIRLGVLGDWEHPYLTMDYGTEA
FT                   NIIRALARIVDNGHLMKGAKPVHWCPDCGSSLAEAEVEYYDKVSPSIDVRFAAVDKAQV
FT                   LAKFGVSEAKGDVNVVIWTTTPWTLPANRAVALHPELEYQLVQVEGECLILAAELVESV
FT                   MKRAGIDHWQVLGSCKGEDLELLRFRHPFMSFDVPIIMGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVVGQKYGLEIANPVGSNGCYLPGTHPALDGLFVFKANDVVIDLLKSSGALLHVEKL
FT                   THSYPCCWRHKTPIIFRATPQWFISMDRQGLRSQSLAEIERIERQGLDEQNLSGWIPAW
FT                   GKARIESMVANRPDWCISRQRTWGVPMAMLVHKETQALHPRTTELMETVAKRVEQAGIQ
FT                   AWWDLDIRDLLGDEADQYEKVPDTLDVWFDSGSTSYSVVDARPEFGGHSPDMYLEGSDQ
FT                   HRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSVGNVVSPQQVMNKLGGDI
FT                   LRLWVASTDYTGEMAVSDEILKRSADAYRRIRNTARFLLANLNGFDPRKDMVKPEDMVV
FT                   LDRWAVGCAKQAQDEIIAAYENYDFHEVVQRLMQFCSVEMGSFYLDIIKDRQYTAKADS
FT                   VARRSCQTALYHIAEALVRWMAPILSFTADEIWGYLPGERAQFVFTEEWYQGLFGLDTA
FT                   ESMNDAFWAELLKVRGEVNKVIEQARNDKKVGGSLEAAITLYADEALATQLDSLQDELR
FT                   FVLITSAARVQPLAQASADAVASELAGLKVGLSKAAGSKCPRCWHYSTAIGQDAAHPQL
FT                   CPRCVTNVAGQGEERKFA"
FT   gene            621170..621670
FT                   /locus_tag="ETAF_0531"
FT   CDS_pept        621170..621670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0531"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40655"
FT                   /db_xref="GOA:A0A0H3DQ38"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ38"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40655.1"
FT                   /translation="MMRRPLLSTGLRWLWIVVAVLIVDLGSKQLILQHFMLGETLPLFP
FT                   SLNLHYARNYGAAFSFLADSGGWQRWFFAGIAIAICVALLVMMYRSAASQRLNNIAYAL
FT                   IIGGALGNLFDRLWHGFVVDMIDFYVGSWHFATFNLADTAICIGAALVVLEGFLPQRDK
FT                   EKM"
FT   gene            621670..622137
FT                   /gene="slpA"
FT                   /locus_tag="ETAF_0532"
FT   CDS_pept        621670..622137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slpA"
FT                   /locus_tag="ETAF_0532"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   SlpA"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40656"
FT                   /db_xref="GOA:A0A0H3DQB6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQB6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40656.1"
FT                   /translation="MPQAQATSAVLVHFTLTLEDGSLAESSRERGQPALFRLGDGSLSP
FT                   ALEAQLLGCRRGDRRAFTLAPADAFGERSDDLVQFFPLGQFRDSGEPQAGAVILFTAAD
FT                   GAQMPGLVREIVGESVTVDFNHPLAGMPVTFDLEVLAIDPPQGDEHAHSAG"
FT   gene            622118..623071
FT                   /locus_tag="ETAF_0533"
FT   CDS_pept        622118..623071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0533"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40657"
FT                   /db_xref="GOA:A0A0H3DRM0"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRM0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40657.1"
FT                   /translation="MRILLANPRGFCAGVDRAISIVDRALAIYGAPIYVRHEVVHNRFV
FT                   VNDLRERGAVFIEEIGEVPDGAILIFSAHGVSQAVRAEAKARHLTMLFDATCPLVTKVH
FT                   MEVARASRRGTEAILIGHAGHPEVEGTMGQYSNPLGGMYLVESPQDVWQLQVKDERNLC
FT                   FMTQTTLSVDDTSEVIDALRARFPAIVGPRKDDICYATTNRQEAVRSLAAQADVVLVVG
FT                   SKNSSNSNRLAELARRAGKPAYLIDSASDINDAWLSGVGCVGVTAGASAPDVLVREVID
FT                   RLQALGGSAAQEMQGREENIVFEVPRELRIEVQQAD"
FT   gene            complement(623167..623721)
FT                   /locus_tag="ETAF_0534"
FT   CDS_pept        complement(623167..623721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0534"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40658"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40658.1"
FT                   /translation="MFTKKALACLLVAGGLSLSAQAMTLSSPTVDNGKSLQNVQIFNGW
FT                   GCTGQNKSPALAWSDVPAGTKSFAVTMYDPDAPTGSGWWHWMMIDIPASVHSLAQNVGE
FT                   KESRDLPKGAIQLRNDFGYNGFGGACPPPGAKPHNYQITVYALNVAKLDIPAHASPAYA
FT                   GYFILQHKIGEARLTAPTNMR"
FT   gene            complement(623914..624399)
FT                   /locus_tag="ETAF_0535"
FT   CDS_pept        complement(623914..624399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0535"
FT                   /product="Xanthine dehydrogenase iron-sulfur subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40659"
FT                   /db_xref="GOA:A0A0H3DN82"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN82"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40659.1"
FT                   /translation="MNVKEWGEISCQINGKNYQFCVSPAMSLLEMLREHGLTSVKQGCC
FT                   VGECGACSVLIDGVATDSCLYLALWADGKQIVTAEGLGRTDSLSPIQQAYVDAGAVQCG
FT                   FCTPGLVVATHALLAKPRSRPLTHEEIRRGLSGNLCRCTGYQAIVRAVDLCQREEEQ"
FT   gene            complement(624396..625274)
FT                   /locus_tag="ETAF_0536"
FT   CDS_pept        complement(624396..625274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0536"
FT                   /product="Xanthine dehydrogenase, FAD binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40660"
FT                   /db_xref="GOA:A0A0H3DQ39"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ39"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40660.1"
FT                   /translation="MYDIKRYLRATSARHASELMLAHPDSRLLAGGTDVLIQLHHHNAQ
FT                   YAHIVDIHGLPELCGITTLDDGTLRIGSGTTFTQIIEHPLIQTHLPMLAEAAATIAGPQ
FT                   IRNVATYGGNICNGATSADSAAPSVALKAQLEILTPDGVTIRPIDGFHTGPGKVALSPG
FT                   EILLAFRFHPDDHRRAGSAYIKYAMRGAMDIATIGCAALCRIESGRFSELRLAYGVAAP
FT                   TPIRCPQAEACANGQPLSRQTLAAVAAAVAGDVSPRSSWRAEKEFRLHLIRTLAQRAIT
FT                   LAVQRAGGEIL"
FT   gene            complement(625281..627572)
FT                   /locus_tag="ETAF_0537"
FT   CDS_pept        complement(625281..627572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0537"
FT                   /product="Xanthine dehydrogenase, molybdenum binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40661"
FT                   /db_xref="GOA:A0A0H3DQC0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQC0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40661.1"
FT                   /translation="MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGN
FT                   VTAIDTREAESMPGVEAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFG
FT                   DGVAIVVARDLLSAERAAERVQVSYEALPVITRPLAALADNAPAIHPGGNLLRHSEIDA
FT                   GEPDARMAAADLQLEGHYETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTV
FT                   AQALGLPWSHVRVIKPYVGGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVAT
FT                   RTRHAFSIDARLGMRRDGQLEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFG
FT                   YCADTVYTNLPAAGAMRGYGAPQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNP
FT                   VNGKTIYSAGLTECLEKGRRLFEWDQRRAECLAQPADAPVRRGVGVACFSYGSNTYPVG
FT                   VEIAGARLLLNQDGTVNLQIGATEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDIT
FT                   AFDPGAFASRQSYVAAPAIRRAAEIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPD
FT                   QVLMSVADVAMQAYYHQEIGAQILAEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRI
FT                   LNLHDSGRILNPQLAEGQVHGGMGMGIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVD
FT                   LPDLECAFVETVEPQSAYGHKALGEPPIISPGPAIRNAIRMATGVAINALPITPKTLYR
FT                   EFVQAGLIRE"
FT   gene            628020..628838
FT                   /locus_tag="ETAF_0538"
FT   CDS_pept        628020..628838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0538"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40662"
FT                   /db_xref="GOA:A0A0H3DRM5"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRM5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40662.1"
FT                   /translation="MAEQIRVAIAGAGGRMGRQLIAATAAIPGVTLGAALEREGSSLLG
FT                   CDAGELAGCGITGVTVESSLERVAGQFDVLIDFTRPEGTMAHLAFCQAHGKAMVIGTTG
FT                   FSEQEKATIEAASQHIAIVLAANFSVGVNVMLRLLEKAAQVMGSYCDIEILEAHHRHKV
FT                   DAPSGTALAMGEAIAGALGRRLESCAVYTRQGHTGERVPGSIGFATLRAGDIVGEHTAL
FT                   FADVGERLEITHKASSRMTFASGAMRAALWLGAQQPGMYDMCDVLALDTL"
FT   gene            629382..630461
FT                   /locus_tag="ETAF_0539"
FT   CDS_pept        629382..630461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0539"
FT                   /product="Carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40663"
FT                   /db_xref="GOA:A0A0H3DMW1"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40663.1"
FT                   /translation="MGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNAADEE
FT                   SSAVHAQGLIVRDLPPIASNFRCQETLPDYLRRHRVVAIADIDTRKLTRLLREKGAMNG
FT                   CIITAESGCEPDAALALEKARAFPGLKGMDLAKEVTTQEPYEWRQGSWTLKDGLPAPSE
FT                   DAALPYHVVAYDFGVKRNILRMLVDRGCRLTVVPAQTSAQDVLALNPDGIFLSNGPGDP
FT                   APCDYAIEAIATFLRGEIPLFGICLGHQLLALASGAQTVKMKFGHHGGNHPVKDLDHDR
FT                   VMITAQNHGFAVDEATLPATLRATHKSLFDGSLQGIHRTDRPAFSFQGHPEASPGPHDA
FT                   APLFDHFMTLIENYRRTAK"
FT   gene            630481..633702
FT                   /locus_tag="ETAF_0540"
FT   CDS_pept        630481..633702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0540"
FT                   /product="Carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40664"
FT                   /db_xref="GOA:A0A0H3DN86"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN86"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40664.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDQAMKKIGLDTARSGIAHSLEESLAVAEQVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICARGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCAIENIDPMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGASGFDPKVNLDDPQALTKIRRELKDAGAERIWYVADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEERVADVGINGLTPDFLRQLKRKGFADARLARLAGVAESEIRKLR
FT                   HKQGLHPVYKRVDTCAAEFATDTAYLYSTYEEECEANPTHDRPKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVAVERP
FT                   QGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQQAVNRLGLKQPANAT
FT                   VTAIEQAVEKGAQIGYPLVVRPSYVLGGRAMEIVYDESDLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPAYTLSAEIQDELRRQ
FT                   AEKLAMELCVRGLMNVQFAVKDNQVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMVG
FT                   QTLAQQGMTEEVIPPYYSVKEVVLPFAKFPGVDPILGPEMRSTGEVMGVGRTFAEAFAK
FT                   AMLGSQSQVKTPGRALLSVREGDKHRVVDLAAKLLKQGFELDATHGTAVVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIRRSALRYKVHYDTTLNGGF
FT                   ATAMALNADPTEQVISVQEMHARLK"
FT   gene            633925..634695
FT                   /locus_tag="ETAF_0541"
FT   CDS_pept        633925..634695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0541"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40665"
FT                   /db_xref="GOA:A0A0H3DQ45"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ45"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40665.1"
FT                   /translation="MESDRQREITRLCIHCALFLLQHGAESMLVEQLSTRLGLALGVDS
FT                   VESSISANAVVLTTIKGGRCLTSTRKNVDRGINMHVVTEVQHIVIMAEHRLLDMSDVRR
FT                   RLEHIRPLRYPRALVVLMVGLSCACFCKLNGGGWDGALVAFFASAVAMYARQLMTHRQL
FT                   NPLINFCITAFIATSVSGALLQLSAFAETSLIAMAASILLLVPGFPLINAVADMFKGHV
FT                   NTGLARWAMATLLTLATCLGVVMALSLWGLQGWA"
FT   gene            634692..635159
FT                   /locus_tag="ETAF_0542"
FT   CDS_pept        634692..635159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0542"
FT                   /product="Putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40666"
FT                   /db_xref="GOA:A0A0H3DQC4"
FT                   /db_xref="InterPro:IPR020914"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQC4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40666.1"
FT                   /translation="MMTLLLQLLQDMLLAAIPALGFAMVFNVPNRALRYCALLGAIGHG
FT                   SRLLLITLGLNIEWASLMAAILIGIIGIQWSRWLLAHPKVFTVAAVIPMFPGIYAYRAM
FT                   IAVVEISRSGYSEPLFASMVTNFLKASFIVGALSIGLSLPGIWLYRKRPGV"
FT   gene            635288..635770
FT                   /locus_tag="ETAF_0543"
FT   CDS_pept        635288..635770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0543"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40667"
FT                   /db_xref="GOA:A0A0H3DRN0"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRN0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40667.1"
FT                   /translation="MIISLIAALSADRVIGLDNAMPWHLPADLAWFKRNTLAKPVIMGR
FT                   KTYESIGRPLPGRHNIVISRRAGCDDRVTWVTTPQAALEAAAEAQEVMIIGGGSIYSQF
FT                   LPQASRLYLTHVDADVAGDTYFPDYAPDEWQTCFSEFHDADSDNSHAYCFEILDRR"
FT   gene            complement(635977..636816)
FT                   /locus_tag="ETAF_0544"
FT   CDS_pept        complement(635977..636816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0544"
FT                   /product="symmetrical Bis(5'-nucleosyl)-tetraphosphatase"
FT                   /EC_number="3.6.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40668"
FT                   /db_xref="GOA:A0A0H3DMW3"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40668.1"
FT                   /translation="MSTLLIGDVHGCYHELRDLLSLAGFDPARDTLWLTGDLVARGPDS
FT                   LAVLRYVKSLGDSVRLVLGNHDLHLLAVYAGISRNKPKDKLTPLLEAPDADSLINWLRR
FT                   QPVLQVDSDLHLVMAHAGISPQWDLTTAQRCAREVEAMLASDSYPFFLNAMYGDMPNNW
FT                   SESLSGLARLRFTTNALTRMRYCFPGGELDMICKDAPDDAPAPLRPWFDLDSPVRGAGY
FT                   SIAFGHWASLEGRGTPPQVYALDTGCCWGGTLTALRWEDRRSFSVPSRRASRHAKAE"
FT   gene            complement(636821..637198)
FT                   /gene="apaG"
FT                   /locus_tag="ETAF_0545"
FT   CDS_pept        complement(636821..637198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ETAF_0545"
FT                   /product="ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40669"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN89"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40669.1"
FT                   /translation="MLDAPRIIVQVQSVYAESQSLPEEARFVFAYTVTLRNLGRFNVQL
FT                   LRRYWLITNGNGRQTEVQGEGVIGEQPLILPSGEFQYTSGAIIETPCGTMEGHYEMVDH
FT                   QGHTFRIAIPVFRLAIPSLIN"
FT   gene            complement(637223..638026)
FT                   /locus_tag="ETAF_0546"
FT   CDS_pept        complement(637223..638026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0546"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40670"
FT                   /db_xref="GOA:A0A0H3DQ48"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ48"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40670.1"
FT                   /translation="MHQGHLARKRFGQNFLTDQFVIDSIVSAINPLPGQAVVEIGPGLG
FT                   ALTEPVADRMDKMTVIELDRDLAERLSTHPFISRKLTIRQQDAMTVDFSEMAREAGQPL
FT                   RVFGNLPYNISTPLMFHLFSYASAIGDMHFMLQKEVVNRLVAGPDSKTYGRLSVMAQYY
FT                   CQVIPVLEVPPSAFRPAPKVDSAVVRLIPHRELPYPVSDVRVLSRITTEAFNQRRKTVR
FT                   NSLGHLFSADQLSALGIDPARRAETLSVADYCRLANWLCEHPQAQ"
FT   gene            complement(638031..639023)
FT                   /locus_tag="ETAF_0547"
FT   CDS_pept        complement(638031..639023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0547"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40671"
FT                   /db_xref="GOA:A0A0H3DQC8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQC8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40671.1"
FT                   /translation="MAPIRRIVITPGEPAGVGPELIVQLAQRPWPAELVVCADPSLLEV
FT                   RARALGLPLTLRRYDPALPAQAQQAATLTVLPIPLEADVIPGELNVANGNYVVATLARA
FT                   CDGCLSGEFAALVTGPVHKGIINDAGVPFTGHTEFFADRSGCPRVVMMLASEHLRVALA
FT                   TTHLPLQEVPAAITPQTLREVITILDADLRRRFGLHQPHIYVCGLNPHAGEGGHMGREE
FT                   LDIIIPTLDALRASGIRLTGPLPADTLFQPKYLDDADAVLAMYHDQGLPVLKYQGFGHA
FT                   VNITLGLPFIRTSVDHGTALDLAASGQAQPGSFITALNLAIEMTNHSNE"
FT   gene            complement(639028..640335)
FT                   /locus_tag="ETAF_0548"
FT   CDS_pept        complement(639028..640335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0548"
FT                   /product="Survival protein SurA precursor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40672"
FT                   /db_xref="GOA:A0A0H3DRN4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRN4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40672.1"
FT                   /translation="MKNWRTLILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGM
FT                   MKSVKLNAQQADQQLPDNATLRHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIA
FT                   QQNHISMQQLRSRLAADGLDYKTYRAQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQ
FT                   IGSQNSGETAVNLSHILIPLPENPTQQQVSEAQQQAESLIQQLHQGASFAKLAAAYSAD
FT                   PQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVS
FT                   VTEVHARHILLRTSPVMSDAQARAKLEALSAQITSGKITFEQAAKEYSQDPGSAQKGGD
FT                   LGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQLLGTRQVDRTDEAQKERAYR
FT                   MLFNRKFAEEAQTWLQEQRAAAYVKILGNNSANGAQ"
FT   gene            complement(640456..642843)
FT                   /locus_tag="ETAF_0549"
FT   CDS_pept        complement(640456..642843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0549"
FT                   /product="Outer membrane protein Imp / Organic solvent
FT                   tolerance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40673"
FT                   /db_xref="GOA:A0A0H3DMW8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40673.1"
FT                   /translation="MTESLTPRMKKSIPTLIATLVWSALYSQHALASLAEQCLIGVPVY
FT                   DKPLVSGDINSLPVHITADKSEANYPNNALFHGNVDIQQGNSTLTADKVQLDQKAIQGH
FT                   PDPLRTVTAIGNVHYADSQIRLQGPSAWSNLNNKDTNVWRGDYQFVGRQGRGDADLMKT
FT                   RDANRYTILDNGTFTSCLPGDNSWSIAGSEIIQDRQEQVAEIWNARFKIGPVPVFYSPY
FT                   LQFPTGSTRRSGFLIPTINYSNGDGIEFTLPWYWNIAPQADATFTPHYMEKRGLQLQNE
FT                   FRYLSEFGMGLVEFDWLGNDRQFQQDRQNQGITGQALDDLKNRDRWLFYWRHFGVLDHW
FT                   RFGVDYTKVSDPYYFTDLNSAYGSSTSGYATQKFTLGYAETNWNATLSTTQFQVFANAG
FT                   DVNAYRTAPQLDLNYYKNDLGPFDFTLYGQAVKFTNDNVYLPEADRYHVEPVLSLPLSN
FT                   RWGSINTEAKLMATHYQQDVPTQGNLTQLKDNVNRVMPEFKIDGKMVFERDATLLNGYT
FT                   QTLEPRAQYLYIPYRNQSDIYSYDSTLLQTDYTGLFRDRSYSGLDRIASANQVTTGLTT
FT                   RLYDDEQNERFNASIGQIYYFSPSRTGDETTNIDRHDNTGSLVWAGDSYLKLTDNWGLR
FT                   GGLQYDTRLNSVALGNAVMEYRKDAESVLQLSYRYASPEYITSMLPSYANNAIYNQGIS
FT                   QAGIIGSLPLADRWAMVAGYYYDTKAKQSADAIAGLQYNTCCWSVGVTYERKINSWDSA
FT                   TQNSKYDNKFSFKFALRGMNQNYSLGTAEMLRSGILPYQRAF"
FT   gene            643001..643837
FT                   /gene="djlA"
FT                   /locus_tag="ETAF_0550"
FT   CDS_pept        643001..643837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ETAF_0550"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40674"
FT                   /db_xref="GOA:A0A0H3DN92"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN92"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40674.1"
FT                   /translation="MRYWGKLVGVLLGLMAGIGFWGVVLGFLIGHMFDKSRAIKRQGYF
FT                   ANQQQRQGLFFRTTFQVMGHLTKSKGRVTEADIQVASMFMDRLNLHGDARLMAQQAFRE
FT                   GKEPGYPLRERLRELRSVCFGRIDLIRIFLEIQLQAAFADGQLHPNERAVLYVIAEELG
FT                   FSRAQFDQFLGMMEGGRQFGGGYHQAGGQQGGYQQGGFYTPPQGPTLEDACKVLGVAPS
FT                   ADATTIKRAYRKLMSEHHPDKLVAKGLPPEMMELAKQKAQEIQAAYDLIKKEKGFK"
FT   gene            complement(643914..644621)
FT                   /locus_tag="ETAF_0551"
FT   CDS_pept        complement(643914..644621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0551"
FT                   /product="Ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40675"
FT                   /db_xref="GOA:A0A0H3DQ52"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ52"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40675.1"
FT                   /translation="MGRRTPAGGALPPSATPALEHYDPPREPWLHVLYQDAHIIVVNKP
FT                   SGLLSVPGRLPEHQDSILTRIQAQFPGAESVHRLDMATSGVLVVALTKDAERELKRQFR
FT                   EREPKKNYVARVWGHPQQDEGVIDLPLICDWPNRPKQKVCFEQGKPAQTEYQVLARDAD
FT                   GTARVLLTPITGRSHQLRVHLLALGHPILGDGFYAPPQALALASRLLLHAQELRIVHPA
FT                   FATPMHFRCEADF"
FT   gene            complement(644621..647527)
FT                   /locus_tag="ETAF_0552"
FT   CDS_pept        complement(644621..647527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0552"
FT                   /product="RNA polymerase associated protein RapA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40676"
FT                   /db_xref="GOA:A0A0H3DQD2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQD2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40676.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVALDARMVTLLFPATGENRLYAR
FT                   NDSPITRVMFNPGDTITTHEGWQLCVEEVQEQEGLLTYIGSRSDSGESPVAVREVLLDS
FT                   RLTFSKPQDRLFAGQIDRMDRFALRYRARKYQSEQFRLPCSGLRGMRASLIPHQLHIAR
FT                   DVGQRHAPRVLLADEVGLGKTIEAGMIIHQQLLSGRAERVLIVVPETLQHQWLVEMLRR
FT                   FNLRVALFDDERYAEAAQDSSNPFETEQLVICSLDFVRRSRQRLEQLADASWDLLVVDE
FT                   AHHLAWSEQAPSREYQVIEQLAEQIPGVLLLTATPEQLGQESHFARLRLLDPNRFHDYA
FT                   QFIAEQQRYRPVADAVTLLLNDGHLQQDELNMLSEMVAEQDIEPLLKAANAGGEDSQQA
FT                   RAELVRMLMDRHGTSRVLFRNTRQGVKGFPQRTLHQITLPLPAQYQTAIKVSGIMGSKK
FT                   SVEAQANDMLYPERIYQEFEGENATWWNFDPRAEWLLDFLLTQRDEKVLVICAQAATAI
FT                   HLEQLLREREGIRAAVFHEGMSLIERDRAAAYFASQEEGAQVLLCSEIGSEGRNFQFAN
FT                   RLVMFDLPFNPDLLEQRIGRLDRIGQARDIQIYVPCLEGTAQSVLIRWYHQGLDAFEHT
FT                   CPTGRTIYDRYYDTLLEFLAKPTQLDGFDDFIKTCRADHDTLKSQLEKGRDRLLEMHSN
FT                   GGEAALALAESIAAQDNDVNLVNFALNLFDIVGINQEDRSDSLIVLTPSDHMLVPDFPG
FT                   LPQDGCTVTFDREQALSREDAQFISWEHPLMRNGLDLILSGDTGSSAVSLLKNKALPVG
FT                   TLLLEAVYVVEAQAPKQLQLTRFLPPTPVRMLLDAKGNNLAAQVEFESFNRQLNAVNRH
FT                   TASKLVNAVQPNVHAMLQSGEALIADQAQALIDAAKREADEALSAELARLESLKAVNPN
FT                   IRDDELETLEFTRRKVLETLDQAGWRLDALRLIVVSHQ"
FT   gene            complement(647791..650130)
FT                   /locus_tag="ETAF_0553"
FT   CDS_pept        complement(647791..650130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0553"
FT                   /product="DNA polymerase II"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40677"
FT                   /db_xref="GOA:A0A0H3DRN9"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRN9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40677.1"
FT                   /translation="MNTPHAGFILTRHWRDTPQGVCVTLWLATEHGPRCLTLPPEPAVA
FT                   FMDAAQRNAALRLLRGFPDVELRPVALRDFHHRPVLALYCRGYRQLQQIERRLGEQGIP
FT                   LLETDIRPADRYLMERFINAPLWFCGDAAGTEARIKPHPHYRPTLRTVSLDIETSPQGE
FT                   IYSIGLHGCDQRIVYMLGPANGDAQALDFTLEYVASRAALLDALNRWIARHDPDAIIGW
FT                   NLVQFDLRILQRHAEREGVPLLLGRAATPLEWREHGFRAGHFFASAPGRLIIDGIEALK
FT                   SAFWHFPSYSLDSVAQTLLGEGKVLDDPYRRMAEIARRFRQDKPALAHYNLKDCELVTR
FT                   IFAHTALMPFLLERASVTGLAPDRSGGSVAAFCHLYLPRMHRLGYVAPSLGEVAPQASP
FT                   GGFVMASRPGLYDSVLVLDYKSLYPAIIRSFLIDPVGLAVGGEQPDDTHSVPGFLGARF
FT                   SRTRHALPEIVRQLWQGREAAKRQDNAPLSQALKILMNAFYGVLGTSACRFFDPRLASS
FT                   ITLRGHEIMRQTRSLIEAQGYAVIYGDTDSTFVWLGKPHDEAQAEAIGQALAERVNAWC
FT                   REHLSQQYGLESALELEYECHYRRFLMPTLRGADLGSKKRYAGLCGDRLVFKGLETVRS
FT                   DWTPLAQRFQQELYRRVFLGQSYRDVIRRYADGLLAGEFDDQLIYRKRLRRPLAEYQRN
FT                   VPPHVRAARLADDYNHRLGRPLQYQNGGWISYIITRSGPQPLECVDAPADYQHYLERQL
FT                   QPVADAILPFLGDDFETLLTGQLGLF"
FT   gene            complement(650257..650970)
FT                   /gene="thiQ"
FT                   /locus_tag="ETAF_0554"
FT   CDS_pept        complement(650257..650970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ETAF_0554"
FT                   /product="Thiamin ABC transporter, ATPase component /
FT                   Thiamine transport ATP-binding protein ThiQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40678"
FT                   /db_xref="GOA:A0A0H3DMX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40678.1"
FT                   /translation="MIRLDNLLYRYQQQTLSFSLHAAAGERIAILGPSGAGKSTLLSLI
FT                   AGFLAPSSGDLYLNSIDCRCAPPSQRPVSMLFQEHNLFAHLTIAQNLGLGLDPGLRLDD
FT                   DQRRRLADIAELVGIHDYLPRLPGQLSGGQRQRAALARCLLRRQPILLLDEPFSALDPA
FT                   LRAEMLTLLDDVCRQRQLTLLMVSHNLDDAARIAPRTLVIDDGHIAYDGPTAALLTGSV
FT                   AAARLLGRKVPEQAE"
FT   gene            complement(650967..652574)
FT                   /locus_tag="ETAF_0555"
FT   CDS_pept        complement(650967..652574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0555"
FT                   /product="Thiamin ABC transporter, transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40679"
FT                   /db_xref="GOA:A0A0H3DN97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN97"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40679.1"
FT                   /translation="MAKRPEPLIPRWLWPGALAASLLLGIALLAFGALWYSAPAAAPAA
FT                   LWRDGYLWHVVRFSFWQALLSTLLSLLPAIALAIALFRRRFPGRTLLLRLCAMTLVLPV
FT                   LVAVFGLLSVYGRQGWLALLCQTLGIDYRFSPYGLQGILLAHVFFNLPLATRLLLQALE
FT                   SIPVEQRQLAAQLGMSPRQILRFVEWPYLRRQLPPAGALIFMLCFSSFATVLSLGSGPQ
FT                   ATTIELAIYQALSYDYDPARAAQLALLQLGCCLGLVLLSQRLSGILPVGHTRRMRWRDT
FT                   RDSLRLKLSDTLTIGLALLLLLPPLLAVIVDGLNQALGSVLRQPALWQALGTSLYIALG
FT                   AGALAVTLTMMLLWSSRELSLRGQRWRAQGMELCGMLILAMPGIVLATGFFLLLNATIG
FT                   LPTSPGLLVMVTNALMAIPYAMKVLEYPMRDLAERYDPLCLSLRIGGLNRLRWIELRAL
FT                   RRPLAQALAFACVLSLGDFGVVALFGSEQFRTLPFYLYQQLGAYRSADGAVTALLLLLF
FT                   CLTLFSLLERLPAGRKSP"
FT   gene            complement(652550..653545)
FT                   /locus_tag="ETAF_0556"
FT   CDS_pept        complement(652550..653545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0556"
FT                   /product="Thiamin ABC transporter, substrate-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40680"
FT                   /db_xref="GOA:A0A0H3DQ55"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ55"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40680.1"
FT                   /translation="MLKKLFSTLALLTASLLAQAADKPVLTVYTYDSFAADWGPGPKIK
FT                   QAFEQSCHCELKLVPLEDGVAILNRLRMEGKNSPADVVLGLDNNLLTAARHSGLFSPSQ
FT                   TDTRGLQIPGGWHDANFVPYDYGYFAFVYDRQRVNNPPTSLKQLVEGPEKWRVIYQDPR
FT                   TSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTS
FT                   PAYHQIEEHSDRYAAAMFDEGHYLQVEVAGVLKHSPQPALAHQFMQFITTPAFQNAIPT
FT                   GNWMYPTTAVALPPAFAALPKPQKTLSFTADDVAQHRAEWIRAWQSALSR"
FT   gene            complement(653727..655406)
FT                   /gene="sgrR"
FT                   /locus_tag="ETAF_0557"
FT   CDS_pept        complement(653727..655406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="ETAF_0557"
FT                   /product="SgrR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40681"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQD6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40681.1"
FT                   /translation="MATPRLQHQFIRLWQHCQGNGCDTTLAELAAALNCSRRHVRTLLN
FT                   AMQQQGWLSWQAVSGRGKRSRLAFLCSALEVQQLRAEELMEQDHFEQLVQLVGDRDSAR
FT                   QMLLAQLGRSFRQGRHILRILYYRPLLGLQPASPLRRSETHLARQIFSGLTRINEENGE
FT                   LESDLAHHWQPLTPLHWRFYLRPAIHFHHGRELTMTDVIASLERLRTLPLFRHIAQVAS
FT                   PTPHVIDIHLLAEDAWLPWLLGSVPAMILPQEWQEMRDFARLPVGTGPYQVVRNTQSQL
FT                   KIRAFDGYFGYRALIDEVNIWVLPEISEALVHAGVQLQADGSGGDELESRLEEGCYFML
FT                   FDQRSAQMHDPAVRAWLCQTINPIALLNNASHLHQRYWSPAYGLLPRWHHNKMLSDRPK
FT                   PPQLTHLRITFYSEHSEFHALYQALQPLLATHGVTLEMQEIDYTRWHDGAAESDLWLGS
FT                   ANFYLPLEFSIFAMLYELPLLSHCTGLDLASEACRWREQRLPVAEWSQQLVQRHQLHPL
FT                   FHHWLKLHGQHSMRGVRMNTLGWFDFKSAWFAPPEHPPAASR"
FT   gene            655741..657213
FT                   /locus_tag="ETAF_0558"
FT   CDS_pept        655741..657213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0558"
FT                   /product="2-oxoglutarate/malate translocator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40682"
FT                   /db_xref="GOA:A0A0H3DRP4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRP4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40682.1"
FT                   /translation="MDKLTPLKPLPALIALAITLTLWFIIPAPAGVSANAWQLLALFVG
FT                   TIAAIIGKALPIGAVSVVAIALVALTGVTAPGKPAAALNDALSGFSNALIWLIGISIMV
FT                   SQSLNKTGLGERIGYWFIALCGKRTLGIAYGLALAETSLAPVTPSNTARGGGIIHPIMR
FT                   SIADSFGSHPQPGSTEKIGRYLSLVNYNINPITSAMFITATAPNPLIVNLIAKGTGHEF
FT                   ELTWGAWALAALLPALLSLLLMPLVVYWLYPPQIRHTPDAPRFARERLRALGPISLAEK
FT                   ITLAVFLLLLVLWADIPAWLLGDGWSVNATTAAFIGLAILLCSGVLSWDDLLKCKGAWD
FT                   TVMWFAALVMMATFLGKLGLIAWLSQSVSALIDGMGMHWVGGMLLLTLVYVYAHYFFAS
FT                   TTAHITAMFAAFFAAGLALGVPPALFALVLAFSSSLMMSLTHYGTGTAPIIFGSGYVTL
FT                   GEWWKTGFILSAVNLALWLSVGSLWWHWLGYW"
FT   gene            complement(657256..659085)
FT                   /locus_tag="ETAF_0559"
FT   CDS_pept        complement(657256..659085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40683"
FT                   /db_xref="GOA:A0A0H3DMX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40683.1"
FT                   /translation="MFHWFERLTEPFPSPDPQKPPATLFGFCRHYTRGFERPLGAMALL
FT                   SAAVAVCEVMLLRYLGELVDLLSHAERATFWTDQRPSLIGMAILVLAVMPLLAWLHSNL
FT                   LHQSILGNYPMAVRWQVHRYLLGQSIAFFQRDFAGRVATKVMQSAQSVREVVMKMVDLL
FT                   IYILVYLISVLVMIASVDTLLLIPLLLWLATYILIQIRLLPRLRRIASEQANAQSVMSG
FT                   TIVDTYTHITTVKLFSHDQRESDYARHAMQRYLATVYRQMRTLTGLLFSVDIINYLLLF
FT                   SLAALSIALWQQQAVSVGVIAVGISLALRLQGMSKWIMWEVRALFESIGQVIDSIHTVA
FT                   NDIDVADKPGAVPLRLTRGEIRFNAVGFGYPGGRTLFDRLDLHIRPGEKVAIVGRSGAG
FT                   KSSLMHLLLRFYDLQSGSITLDAQNIAEVTQTSLRRQIGMITQDTALLHRSIRENLLYG
FT                   NPQASEAEMIAACRRAEAHDFICQLADDTGQRGYDTQVGERGVKLSGGQRQRIAIARVL
FT                   LKDAPILIMDEATSALDSEAEAAIQDNLAQMMAGKTVIAIAHRLSTIAAMDRLIVMDHG
FT                   RIVAQGSHRELLRQNGIYARLWAHQTGGFIGSD"
FT   gene            659197..659970
FT                   /gene="fhuC"
FT                   /locus_tag="ETAF_0560"
FT   CDS_pept        659197..659970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ETAF_0560"
FT                   /product="Ferrichrome transport ATP-binding protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40684"
FT                   /db_xref="GOA:A0A0H3DNA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA1"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40684.1"
FT                   /translation="MFSLTNLEVVRGGREVLAIEHLTIPTDRLTVILGHNGSGKSTLVS
FT                   LLAGQLRPDGGQIALDGQALSSLSAGALARRVAFLPQKLPASAGLTVRELVRLGRFPWR
FT                   GMLGRWRREDRQLIDAAMAETGVAPFADTLVDTLSGGERQRAWVAMLLAQASPLLILDE
FT                   PTSALDIQHQYQLMALLSALPRGVLVILHDLNLALRYADHVIALKQGRVAFAGSAAALA
FT                   DEQRLSDLYQTPIRLTDHPHPTPGAPPHKVAIICA"
FT   gene            659970..660893
FT                   /locus_tag="ETAF_0561"
FT   CDS_pept        659970..660893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0561"
FT                   /product="Ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40685"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ59"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40685.1"
FT                   /translation="MFNFIFRFFAPLALLISLFSFSAQALTVSDSRGTHQLPAVPTRAV
FT                   VLDWDLLEQTIELGVTPLAATDLDSYREWVAQPLIPAQTQSVGSREEPNLERIAALKPD
FT                   VILASEMQQALLPRLTQIAPVLYYTNFSAADDHAAVAIMQFRQLAQVFGREAIAEQKLA
FT                   AMQARFQHLSRALREAFHGQLPAVTVMRFASTTSTYLYTSNAMPVYVLRQLGITPALAP
FT                   PPARWGIVQQPIAGLQRVGQGYVLYFLPFHDAARLDATRLWQAMPFVRGQRVSAVRPVW
FT                   SYGGAMSLQYAAEAMAESLMALAAQK"
FT   gene            660890..662884
FT                   /gene="fhuB"
FT                   /locus_tag="ETAF_0562"
FT   CDS_pept        660890..662884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ETAF_0562"
FT                   /product="Ferrichrome transport system permease protein
FT                   FhuB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40686"
FT                   /db_xref="GOA:A0A0H3DQE0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQE0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40686.1"
FT                   /translation="MSGGVRLAAPLLLLALAVASLQWAQPLTLLQQWQLLLAPQQAQSL
FT                   DDILWLYSQLPRLAITLLVGATLGLAGSVMQQLTQNELMSPLTMGTSSGAWLALVLLAA
FT                   FWPAQQAQWGALAAMGGALLAFALIVLIVGLDNMTGLPMVIAGMVINILLGALASAVLL
FT                   LQHPYAQNIFLWGSGELAQSDWGWVRWLLPRLAPALLLLLFAPRVLQLLRLGHQGAQAR
FT                   GVAVVPLFFALMLLTIWLVSAAVTAVGLIGFIGLLTPNIVRALGVRTPRGELYASLLGG
FT                   ALLLLLTDALAQGASLWLGQLLPTGVVAAAIGAPALILFSRRRLSAPDGLGAPLISARG
FT                   RVSRWVSAALAALFALALLGYLTYQPEAAGWPFAWPQAYQWALRWPRALAALSCGVALA
FT                   LAGVLLQRLIYNPLASPDLLGVSSGATLTLVLAMLWCGQTLTALLQWGVGLAGSLAVLA
FT                   ALMALGRRQRYAPASVILTGIAMTALLQALVQFCLAQGSQDSYRILQWLAGSTYRVTAA
FT                   QALLLSALTALLLLLALSVARALTLLSIGRAFSQARGLNSARAAALLLVLVALLCAIAT
FT                   AAIGPVAFVGLMAPHLAQMLGARTAKAQMGLAALLGAATLLWADWLGQALLYPRAMAAG
FT                   TLVAIIGAAYFLLLLIVGRLTRRRLQRVA"
FT   gene            662933..665161
FT                   /locus_tag="ETAF_0563"
FT   CDS_pept        662933..665161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0563"
FT                   /product="Ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40687"
FT                   /db_xref="GOA:A0A0H3DRP9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRP9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40687.1"
FT                   /translation="MFLRNYYKNHFYFCFIYIREIMSSLRLSRMGVGLFGAISVGCTSV
FT                   AMAEESARPADEITVSGSQVALGDSYEGGQVARTGRLGMLGNSDFMDAPFTLTSYTSAL
FT                   IEQQQAASVADVLQNDSTVRVAKGFGNFQELYMIRGFPVYSDDMTLNGVYGILPRQFVA
FT                   AEMLERVEVLRGANTFLNGAAPGGSAVGGMVNLVPKRAGHAPLTRVTGGVQGDGQGYAA
FT                   LDVARRFGDDEANGIRVNLVGRDGKSAVAREKQRLGALSVGFDHRRDRLQLSADIGYQD
FT                   HHIDAPRPSVTPGGPTLPAAPSANKNYAQDWTYTDEKQLFGVVRGEYLLNDSTRVWLGA
FT                   GARQGKEHNLLANPTADGDGVLSAYLFENVRQDNVLSADVGVRHDLTTGRVNHTLVLSA
FT                   AAYQLRSKNGWAMSPTFSGFGTLNDMSSVARPEASFFGGSLSDARETERNSSHSVALAD
FT                   TLGLLEDKIKLTLGGRWQRLETRSYDYDSGALSGRYGKNALTPFVGALYQPSLDVALFA
FT                   NYAEALLPSGVAPATSNGVTVSNAGQVFAPFRARQIEAGAKYDNGTLGASVSLFQITRP
FT                   EFRLDGTTYTDNGEQRNRGIELTLFGKPHERVTMLGGVTLLDARQQKSSLGGQDGKRAI
FT                   GVPAVQANLNLGWETPFIDGLALEGRAVYTASQYADAANTLSIPAWVRVDLGARYALKL
FT                   DGHDVTLRARVENLSDKRYWSSVGGYPGSNYLVQGNPRTFILSASYDF"
FT   gene            complement(665201..665803)
FT                   /locus_tag="ETAF_0564"
FT   CDS_pept        complement(665201..665803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0564"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40688"
FT                   /db_xref="GOA:A0A0H3DMX4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40688.1"
FT                   /translation="MTEFTRHTGIVVPLDAANVDTDAIIPKQFLQKVTRSGFGRHLFHD
FT                   WRFLDAAGEQPNPAFVLNQPPFQQGSILLARENFGCGSSREHAPWALTDYGFRVVIAPS
FT                   FADIFYGNAFNSQLLPIILDEAQIATLFALVGASPGIAFNVDVEQQTLQAGDACYTFTL
FT                   DPFRRHCLIHGLDGIGLTLRQASAIADYEARRPAFLR"
FT   gene            complement(665796..667211)
FT                   /locus_tag="ETAF_0565"
FT   CDS_pept        complement(665796..667211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0565"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40689"
FT                   /db_xref="GOA:A0A0H3DNA4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40689.1"
FT                   /translation="MGKTLYQKLYDAHIVHQTPGETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AQGRRVRRPEHTFATMDHNVSTQSRDIRACGEMAQIQMETLMANCREFGVQLYDLHHPH
FT                   QGIVHVIGPEQGMTLPGTTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTLKQDRA
FT                   RTMQIAIQGRCAAGISAKDIVLAVIGHLGHAGGTGYVVEFCGPAVQALSMEGRMTLCNM
FT                   AIELGAKAGLVAPDDTTFAYLQGRPFAPQGALWQQAVDHWRTLRSDADAQYDRVVTLQA
FT                   DDIAPQVTWGTNPGQVIAIDTPIPSPASLADPIARASAHKALAYMDLQPGTRMSDVAID
FT                   RVFIGSCTNSRIEDLRAAAAIARGRRVAPGVQAMVVPGSGPVKAQAEAEGLDKIFTEAG
FT                   FEWRLPGCSMCLAMNNDRLGSGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVCGH
FT                   FADIRQLQEHDHD"
FT   gene            complement(667214..668305)
FT                   /locus_tag="ETAF_0566"
FT   CDS_pept        complement(667214..668305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0566"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40690"
FT                   /db_xref="GOA:A0A0H3DQ62"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ62"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40690.1"
FT                   /translation="MSHSHHIAVLPGDGIGPEIMAQANKVMDAVRSRFGLRITTSEYDI
FT                   GGIAIDRHGTPLPEATLRGCEQADAILFGSVGGPRWEHLPPASQPERGALLPLRKHFKL
FT                   FSNLRPARLYPGLESLCPLRADIAARGFDILCVRELTGGIYFGQPKGREGQGMHQRAFD
FT                   TEVYYRFEIERIARLAFEAAASRRARVTSIDKANVLQSSLLWREVVNEIAQDYPQVALN
FT                   HMYIDNATMQLIKDPAQFDVLLCSNLFGDILSDECAMLTGSMGMLPSASLNEHGFGLYE
FT                   PAGGSAPDIAGQNLANPIAQILSLALLLRHSLSAEAAAAAIERAVNQALTQGVKTADLA
FT                   ADAQAVSTDEMGDAIARLITQEA"
FT   gene            complement(668321..669901)
FT                   /locus_tag="ETAF_0567"
FT   CDS_pept        complement(668321..669901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0567"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40691"
FT                   /db_xref="GOA:A0A0H3DQE4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQE4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40691.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPISSPGDFASVRAIAQRVKQSRVCALARCVDADIDAAAEALRAADAFRIHTFLATST
FT                   LHLESKLRRSFDDAIAMARHAILRARRYTDDVEFSCEDAGRTPIDNLCRIVEAAIDAGA
FT                   KTVNIPDTVGYTTPYQFGGIIHTLFERVPNIDQAVISVHCHDDLGMACANSISAVQAGA
FT                   RQVEGTLNGIGERAGNCALEEVIMAIRTRQDLLQVHTGIRHQEIYRTSQLVSQLCNMPI
FT                   PANKAVVGANAFAHSSGIHQDGVLKNRENYEIMTPESIGLPQTQLNLTSRSGRAAVKHR
FT                   MEEMGYREGNDFDLERLYQAFLRLADKKGQVFDYDLEALAFIDRQQEEADHFRLEYFSV
FT                   QSGSSVMATASVRLICGAETRAEAATGNGPVDAVYQAINRITDISVDIVKYQLSAKGQG
FT                   RDALGQVDIVAEHQGRRFHGVGLTTDIVESSAQALIHVLNHIWRARQVEQERQRLHSPA
FT                   PSISTSSTH"
FT   gene            670539..671498
FT                   /locus_tag="ETAF_0568"
FT   CDS_pept        670539..671498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0568"
FT                   /product="Probable transcriptional activator for leuABCD
FT                   operon"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40692"
FT                   /db_xref="GOA:A0A0H3DRQ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRQ3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40692.1"
FT                   /translation="MTERHEHPMIPAEPQSSAENSLRNVDLNLLTVFDAVMQVQSITRA
FT                   ARSLNMTQPAVSNAVARLKLMFNDELFMRYGRGIRPTNRAYQLFGPVRQALQIVRNELP
FT                   GARFKPESSERVFNIAITSPLDILLTAKLLQRIKSYALHVQVSFDSLVNEQITRKLRYQ
FT                   ESDFLIDYQDLSGDEFCCEALFDDEFVLAVAGQHPRIGETCSLRGLLLESHAVVSINQF
FT                   SSVSRFFYSHSDLIRQIAYQGTDLSSVLSMVSKTEMVAIAPRWMVEQYADYLQLRAVTL
FT                   LDLESQRTCFFNWHRASERDSAHVWLRKLLSEFAQQGR"
FT   gene            671760..673562
FT                   /locus_tag="ETAF_0569"
FT   CDS_pept        671760..673562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0569"
FT                   /product="Long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40693"
FT                   /db_xref="GOA:A0A0H3DMX6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40693.1"
FT                   /translation="MIKALDNYHLVARIQGQIANSPNRVALRDWSPTADVAYRWREVGE
FT                   QVSRLACALLALGVEVQERVAIFAHNSVAWSLADLAILHLRAVTVPVYATNTAAQAAYI
FT                   LNDASVRILFVDGQAQYDAALALRECCPQLTRIIALSDGIDLRGCAIACHLHAFAPGGD
FT                   SASLARLAQRIDAASLDDLFTLIYTSGTTGEPKGVMLDYRSLAAQLYLHDARLNVGEQD
FT                   VSLCFLPLSHVFERAWSFYVMHSGAQNVYLHDTNLVREAMQAVRPTMMCAVPRFYEKIF
FT                   SAVQAKVAQAPWLRRQLFRWAVWCGEQRFLRERAARPQGRLMTAMHRLADRLVLAKLRA
FT                   ILGGRVRFLPAAGAKLDDHVILFFQALGLNIKYGYGMTETCATVSCWEEQDFRFGSIGR
FT                   PLPGVEVRIGEENEIQVRGPIVMRGYFNKPQETAQTFTADGWLKTGDAGALDAQGHLFI
FT                   TERLKDLMKTSNGKYIAPQLVEGTLARDRFIEQVAVIADARKFVSALIVPCFDSLEEYA
FT                   RSINLKYHDRLDLLRHSHIVALFEQRLMEMQKELAKFEQVKRFTLLPQAFSMELGELTP
FT                   TLKLRRKIILSRYHQEIESMYLDR"
FT   gene            673887..675605
FT                   /locus_tag="ETAF_0570"
FT   CDS_pept        673887..675605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0570"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40694"
FT                   /db_xref="GOA:A0A0H3DNA6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA6"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40694.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKHLFGYPGGTVLDIYDALHTVGGIEH
FT                   ILVRHEQGAVHMADGYARATGQVGVVLVTSGPGATNAITGIATAYMDSVPLVVLSGQVP
FT                   TSLIGNDAFQECDMVGISRPVVKHSFLVKQSEEIPAVLKKAFYLASSGRPGPVVVDLPK
FT                   DILNPAQKYPYAYPQQVSMRSYNPTCQGHRGQIKRGLQVLLAARRPVIYAGGGVIGAGC
FT                   HEALRALAQQLNLPVTTSLMGLGAFPASHPQSLGMLGMHGTYEANLAMHHADVIFAVGV
FT                   RFDDRTTNNLAKYCPDATVVHIDIDPSSISKTVTADVPIVGDAGDVLGALLTLLAQGDC
FT                   RQDFDSLRDWWQRIEVWRDRQCLRYVSDGQRIKPQQVIETLHRLTAGEAYVASDVGQHQ
FT                   MFAALYYGFDQPRRWINSGGLGTMGFGLPAALGVRLALPQATVLCITGDGSIQMNIQEL
FT                   STALQYDLPIVVVNLNNRFLGMVKQWQDIIYAGRHSQSYMQSLPDFVRLAEAYGHVGIA
FT                   IRSVDELETKLREALSIRDRLVFVDVTVDETEHVYPMQIRGGAMNEMWLSKTQRS"
FT   gene            675608..676099
FT                   /locus_tag="ETAF_0571"
FT   CDS_pept        675608..676099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0571"
FT                   /product="Acetolactate synthase small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40695"
FT                   /db_xref="GOA:A0A0H3DQ65"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ65"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40695.1"
FT                   /translation="MRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTEDATLSR
FT                   MTIQTKGDAKVLEQIEKQLHKLVDVLRVSELVPGAHVEREIMLVKLRASGYGREEVKRS
FT                   TDIFRGQIVDVTASLYTVQLAGTSDKLDAFLAAVREVAEIVEVARSGVVGVARGDKIMR
FT                   "
FT   gene            676301..677305
FT                   /gene="fruR"
FT                   /locus_tag="ETAF_0572"
FT   CDS_pept        676301..677305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ETAF_0572"
FT                   /product="Fructose repressor FruR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40696"
FT                   /db_xref="GOA:A0A0H3DQE9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQE9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40696.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTALPPEHPFYQRWANDPLPIIALDRALDPEHFISVVGAD
FT                   MDDAEMLAAELRRFPAQSVLYLGALPELSVSFLREQGFRKAWQGDERPVNYLYTNSYER
FT                   EAAGAAFSQWLQHNEMPQALFTTSFPLLQGVLDVTLKKHGHLPSDLAIATFGDNELLDF
FT                   LDCPVLSVGQRHRDIAERVLELVLASLDEPRKPKPGLSRMRRILLQRGRLNRQ"
FT   gene            678376..678735
FT                   /gene="mraZ"
FT                   /locus_tag="ETAF_0573"
FT   CDS_pept        678376..678735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ETAF_0573"
FT                   /product="Cell division protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40697"
FT                   /db_xref="GOA:A0A0H3DRQ7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRQ7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40697.1"
FT                   /translation="MVCTIDLHHPCLLLYPLSQWEVIEQKLSRLSSMNPAERRVQRLLL
FT                   GHASECQMDGAGRLLIAATLRQHAGLHKQVMLVGQFNKFELWDEETWYQQVREDIEAEQ
FT                   SATEILSERLQDLSL"
FT   gene            678738..679679
FT                   /gene="mraW"
FT                   /locus_tag="ETAF_0574"
FT   CDS_pept        678738..679679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ETAF_0574"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40698"
FT                   /db_xref="GOA:A0A0H3DMX8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40698.1"
FT                   /translation="MSENFQHKTVLLDEAVAGLNLRSDGIYIDGTFGRGGHSRLILSQL
FT                   GAEGRLIAIDRDPQAIAAAAQIDDPRFSIVHGPFSALADYVQEMGLSGRIDGILLDLGV
FT                   SSPQLDDPERGFSFMRDGPLDMRMDPSRGLSAAQWLMQAEEEDIAWVLKTFGEERFAKR
FT                   IARAIVERNRTEPLTRTRELAALISEASPFKEKHKHPATRSFQAIRIYINSELDEIERA
FT                   LEGALVALAPQGRLSVISFHSLEDRLVKRFMRQYSRGPQVPKGLPLTEAQLQAQGGPQL
FT                   KALGKRMPGEREVADNPRARSSVLRVAERISR"
FT   gene            679676..679996
FT                   /gene="ftsL"
FT                   /locus_tag="ETAF_0575"
FT   CDS_pept        679676..679996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ETAF_0575"
FT                   /product="Cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40699"
FT                   /db_xref="GOA:A0A0H3DNB0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40699.1"
FT                   /translation="MIGNERHSLISIIGGDLLRHGKLPVLLFIAVLLSALSVVTTTHKT
FT                   RLLTAEREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVV
FT                   QQ"
FT   gene            680035..681798
FT                   /gene="ftsI"
FT                   /locus_tag="ETAF_0576"
FT   CDS_pept        680035..681798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ETAF_0576"
FT                   /product="Cell division protein FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40700"
FT                   /db_xref="GOA:A0A0H3DQ71"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ71"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40700.1"
FT                   /translation="MKAVRSGKIRRQEEQASFVSWRFALLCGCILLALLGLLARAAYLQ
FT                   VISPEHLVREGDARSLRTQAIPTARGMIKDRAGRPLAVSVPVNAIWADPKEVNEHGGIT
FT                   LDTRWQALADALETPLDKMAARINANPRGRFVYLARQVNPAMGEYIHKLRLPGIYLKQE
FT                   SRRYYPAGQVTAHIIGVTNIDGQGIEGVEKSFDRWLTGQPGERTVRKDRFGRVIEDISS
FT                   IDSLAAHNLSLSIDERLQALVYRELTNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYN
FT                   PNNLTDTPQEAMRNRAITDIFEPGSTVKPMVVMTALQRGIVRENSVLNTLPYYVNGHEI
FT                   KDVARYAELSITGILQKSSNVGVSKLALAMPSSALVETYSGFGFGKPTNLGLVGESSGI
FT                   YPKKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSMGIYRPLSITKVDPPVPGERVF
FT                   PVALVRSVVHMMESVALPGGGGVKAAVKGYRVAVKTGTAKKVGPDGRYVNKYIAYTAGI
FT                   APASNPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNVEPDALPTGDKSELV
FT                   NNKKEGSGGRS"
FT   gene            681863..683272
FT                   /locus_tag="ETAF_0577"
FT   CDS_pept        681863..683272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0577"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40701"
FT                   /db_xref="GOA:A0A0H3DQF3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQF3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40701.1"
FT                   /translation="MDSRVAAAGDLFVAVVGHAADGRRFIPQAIAQGVAAVIAEAEGEA
FT                   EDGSVRELHGVPVVYLSHLNERLSALAGRFYGQPGADLRLVGVTGTNGKTTTTQLLAQW
FT                   AQLLGETGAVMGTVGNGLLGHVYPSENTTGSAVDVQHMLRTLADDGATLVAMEVSSHGL
FT                   VQNRVLALPFAASAFTNLSRDHLDYHGDMEHYAQAKWRLFSTHHSGEKIINADDETGRR
FT                   WLDKLPDAVAVTVSGALPAGWAGRWLAARSVAYHDGGATIAFDSCWGAGTLNSRLMGEF
FT                   NVSNLLVALATLLALGYPLAALCAASGQLQPVCGRMEVFQAPGKPTVVVDYAHTPDALE
FT                   KALLAARLHCQGLLWCLFGCGGDRDTGKRPLMGAIAEQYADRVVVTDDNPRSEEPRAII
FT                   NEILSGMLDPGLAMAIPGRAEAVTAAVMQAAPQDVILVAGKGHEDYQLVGNRRLDYSDR
FT                   VTVARLLGVVA"
FT   gene            683269..684645
FT                   /locus_tag="ETAF_0578"
FT   CDS_pept        683269..684645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0578"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40702"
FT                   /db_xref="GOA:A0A0H3DRR0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRR0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40702.1"
FT                   /translation="MIATTLQTLADAIGATLIGADSPVTAVTTDTRKLTPGCLFVALQG
FT                   DNFDGHDFAAQAREGGAGALLVNRRLALDVPQLLVADTRLALGQLGAWVRRQVPARVVA
FT                   LTGSSGKTSVKEMSAAILGLCGNVLYTAGNLNNDIGVPLTLLRLEPQHDFAVIELGANH
FT                   VGEIAYSVALTRPHSALVNNLAAAHLEGFGSLSGVAQAKGEIFAGLPPQGTAIVNADSN
FT                   DWENWQHALTEQRVWRFSPQAGAGVDFYASAVRSDAAGTHFTLHTPAGQCDVLLPLPGR
FT                   HNIANALAAAALTMSVGATLTQVQQGLAGLQAVPGRLFPIRLGEHQLLLDDSYNANVGS
FT                   MSAAAEVLGHMPGYRVMVVGDMAELGAEAEACHRRVGQAARAAGIDKVLSVGGLSRLIG
FT                   EASGCGEHFMDKTALIERLKHLLCEHAAITILVKGSRSAAMEQVVRGVSVQEMQENQSC
FT                   "
FT   gene            684639..685721
FT                   /locus_tag="ETAF_0579"
FT   CDS_pept        684639..685721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0579"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40703"
FT                   /db_xref="GOA:A0A0H3DMX9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX9"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40703.1"
FT                   /translation="MLVWLAEHLVKYFSGFNVFSYLTFRAIVSLLTALFISLWMGPHLI
FT                   AWLQKLQIGQVVRNDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFV
FT                   LLGYGVVGFVDDYRKVVRKNTDGLIARWKYFWQSVIALVVAFTMYSIGKDTPATQLVVP
FT                   FFKDIMPQLGLLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGMGLVAWATGNV
FT                   NFAAYLHIPYIRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIA
FT                   VLLRQEFLLVIMGGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            685723..687039
FT                   /locus_tag="ETAF_0580"
FT   CDS_pept        685723..687039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0580"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40704"
FT                   /db_xref="GOA:A0A0H3DNB5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB5"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40704.1"
FT                   /translation="MADYQGKRVVIIGLGLTGLSCVDFFMDRGVVPRVIDTRATPPGLD
FT                   KLPASVERHLGSIEQSWLMDADLIVASPGIPLSSPALDRAAQAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMARAAGWQVGVGGNIGVPALSLLKHECRLYVLELSSFQ
FT                   LETTSSLRAAAATILNVSEDHMNRYPLGLQQYRAAKLRIYENARTCVVNADDALTMPIH
FT                   GADTRCVSFGVDVGDYHLNRQQGEIWLRVRGEKILNTKEMQLTGMHNYTNALAALALAD
FT                   AVGLPRASSLRALTTFRGLAHRFQLVLEHSGVRWINDSKATNVGSTEAALKGLHLDGTL
FT                   HLLLGGDGKDADFTPLLPYLQGDRIRLYCFGRDAEPLMRLRPEVSRRFDTLEQAIRALA
FT                   PLTRGGDMVLLSPACASLDQFKNFEQRGDEFARLAREFG"
FT   gene            687039..688298
FT                   /gene="ftsW"
FT                   /locus_tag="ETAF_0581"
FT   CDS_pept        687039..688298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ETAF_0581"
FT                   /product="Cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40705"
FT                   /db_xref="GOA:A0A0H3DQ78"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ78"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40705.1"
FT                   /translation="MRLRLALPRPRLPHLRLPRFSLPLMGGALRLRDWVMGAGEADSAG
FT                   VVLYDRTLLWLTFGLAAMGFIMVTSASMPIGQRLADDPFLFAKRDALYLTLAFGLAMVT
FT                   LRIPMEFWQRWSNAMLLLSVAMLLVVLVVGSSVNGASRWIALGPLRIQPAEFSKLSLFC
FT                   YLASYLVRKVDEVRNNFWGFCKPMGVMVVLAVLLLAQPDLGTVVVLFVTTLGLLFLAGA
FT                   KLWQFLAIIGSGIFAVILLIIAEPYRMRRVTSFWNPWADPFGSGYQLTQSLMAFGRGEF
FT                   WGQGLGNSVQKLEYLPEAHTDFIFSILGEELGYFGVVLTLLMVFFVAFRAMSIGRRALE
FT                   ADQRFSGFLACAIGVWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLIIMSTALVFL
FT                   LRIDYETRQANAQAVVKGSR"
FT   gene            688334..689374
FT                   /locus_tag="ETAF_0582"
FT   CDS_pept        688334..689374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0582"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40706"
FT                   /db_xref="GOA:A0A0H3DQF7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQF7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40706.1"
FT                   /translation="MVMAGGTGGHVFPGLAVAHYLQAQGWQIRWLGTADRMEAQLVPQH
FT                   GIEIDFIQISGLRGKGLKALLGAPFRIARAVLQARRIIKAYRPDAVLGMGGYVSGPGGL
FT                   AAWLCGVPVVLHEQNGIAGLTNRWLSKIAKRVLQAFPGAFPHAPVVGNPVREDVLALPA
FT                   PAQRMAGRTGPVRVLVVGGSQGARILNQTLPAVAARLGERVTLWHQTGKGAQSSVEAEY
FT                   QRLGLSEHRVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFMHKDRQQY
FT                   WNAAALARTGAARIIEQPDFSVDAVVETLAGWDRPTLLLMAEKARAAAITDATQRVAEA
FT                   ICDVAR"
FT   gene            689435..690898
FT                   /locus_tag="ETAF_0583"
FT   CDS_pept        689435..690898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0583"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40707"
FT                   /db_xref="GOA:A0A0H3DRR4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRR4"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40707.1"
FT                   /translation="MNTQQLAKLRTMVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNAVTQQLSELGAQIYFNHRPENVRDASVVVVSTAIAADNPEIIAAREARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGTHA
FT                   RLGSSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVLCIDDPVIRELLPRVGRQVTTYGFSQDADVRIEEYRQCGAQGTFFLCRQDRPR
FT                   LAVTLNAPGRHNALNAAAAAAVASEEGIDDEAILRALGGFQGTGRRFDFLGEFSLQHVN
FT                   NKPGKVMLVDDYGHHPTEVDATIKAARAGWPDRRLVMVFQPHRFTRTRDLYDDFANVLS
FT                   QVDVLLMLDVYPAGEHPIPGADSRSLCRTIRGRGKLDPVLVSEPATLAQTLAQFLQEGD
FT                   LILTQGAGNIGRVARVLAECRLQPSAVME"
FT   gene            690905..691825
FT                   /locus_tag="ETAF_0584"
FT   CDS_pept        690905..691825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0584"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40708"
FT                   /db_xref="GOA:A0A0H3DMY0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMY0"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40708.1"
FT                   /translation="MAEKVAVLLGGTSAERDVSLLSGQAVLNGLKEAGIDAYPVDTMRF
FT                   PATQLREAGFERVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRSKQVW
FT                   QAAGLPVAPYVAISREQFDEGLTMDTLREINDLGLPLIVKPSREGSSVGMSKVSEPCEF
FT                   DPALVEALRHDDEILIEKWLAGPEYTVAFIGDEILPSIRIQAAGAFYDYEAKYLSDKTE
FT                   YFCPSGLSDEQEQALAALVRRAYKALGCSGWGRVDVMQDAAGEFCLLEVNTAPGMTSHS
FT                   LVPMAARQAGMRFSQLVVRILELAD"
FT   gene            691905..692690
FT                   /gene="ftsQ"
FT                   /locus_tag="ETAF_0585"
FT   CDS_pept        691905..692690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ETAF_0585"
FT                   /product="Cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40709"
FT                   /db_xref="GOA:A0A0H3DNB7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB7"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40709.1"
FT                   /translation="MRLAGMLFLLLVLAGIGWGGWVVVNWMKDASRMPMSKLVVTGERH
FT                   FTRNDDIRQAILALGPPGTFMTQNVDVIQQQIERLPWIKQASVRKQWPNELKIHVVEYV
FT                   PVARWNDLRLVDSDGKSFSVPADRTGKQPLPLLYGPEGSEMDVLEGYRAMSKTLAKDNF
FT                   TLKMVSMSARHSWQLGLDNDIRLELGREDVAGRLARFDELYPALQQQAQATHQRVSYVD
FT                   LRYDSGAAVGWAPAYIDTPPAGANQQQNQQQNQAQAKQQ"
FT   gene            692687..693943
FT                   /gene="ftsA"
FT                   /locus_tag="ETAF_0586"
FT   CDS_pept        692687..693943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ETAF_0586"
FT                   /product="Cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40710"
FT                   /db_xref="GOA:A0A0H3DQ83"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ83"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40710.1"
FT                   /translation="MIKSTDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDMAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPTDAEAIKVRYGCALGSLVSKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYAELLNLVNDELLQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGQPLNITGLTDYAQAPYYSTAVGLLHYGKESHLSGEAEVEK
FT                   RASVGNWFKKINGWLRKEF"
FT   gene            694013..695173
FT                   /gene="ftsZ"
FT                   /locus_tag="ETAF_0587"
FT   CDS_pept        694013..695173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ETAF_0587"
FT                   /product="Cell division protein FtsZ"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40711"
FT                   /db_xref="GOA:A0A0H3DQG2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQG2"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40711.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAAEEDREALRSALDGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKELGILTVAVVTKPFNFEGKRRMAFAEQGIAELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGMASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVSNKQGQQPVIDQRY
FT                   QQHGLSPLPQESKPAVAKVVNDQSVPSGKESDDYLDIPAFLRKQAD"
FT   gene            695279..696196
FT                   /locus_tag="ETAF_0588"
FT   CDS_pept        695279..696196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0588"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40712"
FT                   /db_xref="GOA:A0A0H3DRR8"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DRR8"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40712.1"
FT                   /translation="MIKQRTIKRIVQATGVGLHTGKKVTLTMRPAAANTGIIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNLVIEVDAAEIPIM
FT                   DGSAAPFVFLLLDAGIDELNCAKKFLRLKEAVRVEDGDKWAELAPYNGFSLDFTIDFNH
FT                   PAIDASTQRYSLDFSADAFVRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAFKSGHALNNRLLQTVLAKQEA
FT                   WELVTFEDGEEMPLAFRAPSTVLA"
FT   gene            complement(696206..696742)
FT                   /locus_tag="ETAF_0589"
FT   CDS_pept        complement(696206..696742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAF_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAF_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADM40713"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMY3"
FT                   /inference="ab initio prediction:RAST server:2.0"
FT                   /protein_id="ADM40713.1"
FT                   /translation="MRDSRPQSLDTLLDDNAAVDGILKNVQQRAVALLRLDRAVQALLP
FT                   APLKPFCRVANFRQGILVLEVANASWLMRLRYEQSSLLSALRGEILPSLSSIDTRINPA
FT                   LMSQCGKNAQSFAQARQEEAQAETVMRTLSVESAQQLRWLASQSPEGLRKKLERLAALA
FT                   GE