(data stored in SCRATCH zone)

EMBL: CP002156

ID   CP002156; SV 1; circular; genomic DNA; STD; PRO; 2902643 BP.
XX
AC   CP002156; AAMU01000000-AAMU01000011; CH724133;
XX
PR   Project:PRJNA13509;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Parvularcula bermudensis HTCC2503 strain HTCC2503, complete genome.
XX
KW   .
XX
OS   Parvularcula bermudensis HTCC2503
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Parvularculales;
OC   Parvularculaceae; Parvularcula.
XX
RN   [1]
RP   1-2902643
RX   DOI; 10.1128/JB.01205-10.
RX   PUBMED; 21037002.
RA   Oh H.M., Kang I., Vergin K.L., Kang D., Rhee K.H., Giovannoni S.J.,
RA   Cho J.C.;
RT   "Complete genome sequence of strain HTCC2503T of Parvularcula bermudensis,
RT   the type species of the order "Parvularculales" in the class
RT   Alphaproteobacteria";
RL   J. Bacteriol. 193(1):305-306(2011).
XX
RN   [2]
RP   1-2902643
RA   Kang D.-M., Oh H.-M., Cho J.-C.;
RT   ;
RL   Submitted (04-AUG-2010) to the INSDC.
RL   Division of Biology and Ocean Sciences, Inha University, College of Natural
RL   Sciences Inha University, Incheon 402-751, Republic of Korea
XX
DR   MD5; 7c62ea02359454b874493b6bd97e4c29.
DR   BioSample; SAMN02603918.
DR   EnsemblGenomes-Gn; EBG00001021939.
DR   EnsemblGenomes-Gn; EBG00001021940.
DR   EnsemblGenomes-Gn; EBG00001021942.
DR   EnsemblGenomes-Gn; EBG00001021944.
DR   EnsemblGenomes-Gn; EBG00001021946.
DR   EnsemblGenomes-Gn; EBG00001021948.
DR   EnsemblGenomes-Gn; EBG00001021949.
DR   EnsemblGenomes-Gn; EBG00001021950.
DR   EnsemblGenomes-Gn; EBG00001021951.
DR   EnsemblGenomes-Gn; EBG00001021952.
DR   EnsemblGenomes-Gn; EBG00001021953.
DR   EnsemblGenomes-Gn; EBG00001021955.
DR   EnsemblGenomes-Gn; EBG00001021956.
DR   EnsemblGenomes-Gn; EBG00001021957.
DR   EnsemblGenomes-Gn; EBG00001021958.
DR   EnsemblGenomes-Gn; EBG00001021959.
DR   EnsemblGenomes-Gn; EBG00001021960.
DR   EnsemblGenomes-Gn; EBG00001021962.
DR   EnsemblGenomes-Gn; EBG00001021963.
DR   EnsemblGenomes-Gn; EBG00001021964.
DR   EnsemblGenomes-Gn; EBG00001021965.
DR   EnsemblGenomes-Gn; EBG00001021966.
DR   EnsemblGenomes-Gn; EBG00001021967.
DR   EnsemblGenomes-Gn; EBG00001021968.
DR   EnsemblGenomes-Gn; EBG00001021969.
DR   EnsemblGenomes-Gn; EBG00001021970.
DR   EnsemblGenomes-Gn; EBG00001021971.
DR   EnsemblGenomes-Gn; EBG00001021972.
DR   EnsemblGenomes-Gn; EBG00001021973.
DR   EnsemblGenomes-Gn; EBG00001021975.
DR   EnsemblGenomes-Gn; EBG00001021976.
DR   EnsemblGenomes-Gn; EBG00001021978.
DR   EnsemblGenomes-Gn; EBG00001021979.
DR   EnsemblGenomes-Gn; EBG00001021982.
DR   EnsemblGenomes-Gn; EBG00001021984.
DR   EnsemblGenomes-Gn; EBG00001021986.
DR   EnsemblGenomes-Gn; EBG00001021987.
DR   EnsemblGenomes-Gn; EBG00001021988.
DR   EnsemblGenomes-Gn; EBG00001021989.
DR   EnsemblGenomes-Gn; EBG00001021990.
DR   EnsemblGenomes-Gn; EBG00001021991.
DR   EnsemblGenomes-Gn; EBG00001021992.
DR   EnsemblGenomes-Gn; EBG00001021993.
DR   EnsemblGenomes-Gn; EBG00001021994.
DR   EnsemblGenomes-Gn; EBG00001021996.
DR   EnsemblGenomes-Gn; EBG00001021997.
DR   EnsemblGenomes-Gn; EBG00001021998.
DR   EnsemblGenomes-Gn; EBG00001021999.
DR   EnsemblGenomes-Gn; EBG00001022000.
DR   EnsemblGenomes-Gn; EBG00001022001.
DR   EnsemblGenomes-Gn; EBG00001022002.
DR   EnsemblGenomes-Gn; EBG00001022003.
DR   EnsemblGenomes-Gn; PB2503_r13707.
DR   EnsemblGenomes-Gn; PB2503_r13807.
DR   EnsemblGenomes-Gn; PB2503_r13907.
DR   EnsemblGenomes-Gn; PB2503_t07274.
DR   EnsemblGenomes-Gn; PB2503_t07276.
DR   EnsemblGenomes-Gn; PB2503_t07278.
DR   EnsemblGenomes-Gn; PB2503_t07280.
DR   EnsemblGenomes-Gn; PB2503_t07282.
DR   EnsemblGenomes-Gn; PB2503_t07284.
DR   EnsemblGenomes-Gn; PB2503_t07286.
DR   EnsemblGenomes-Gn; PB2503_t07288.
DR   EnsemblGenomes-Gn; PB2503_t07290.
DR   EnsemblGenomes-Gn; PB2503_t07292.
DR   EnsemblGenomes-Gn; PB2503_t07294.
DR   EnsemblGenomes-Gn; PB2503_t07296.
DR   EnsemblGenomes-Gn; PB2503_t07298.
DR   EnsemblGenomes-Gn; PB2503_t07300.
DR   EnsemblGenomes-Gn; PB2503_t07302.
DR   EnsemblGenomes-Gn; PB2503_t07304.
DR   EnsemblGenomes-Gn; PB2503_t07306.
DR   EnsemblGenomes-Gn; PB2503_t07308.
DR   EnsemblGenomes-Gn; PB2503_t07310.
DR   EnsemblGenomes-Gn; PB2503_t07312.
DR   EnsemblGenomes-Gn; PB2503_t07314.
DR   EnsemblGenomes-Gn; PB2503_t10861.
DR   EnsemblGenomes-Gn; PB2503_t10863.
DR   EnsemblGenomes-Gn; PB2503_t10865.
DR   EnsemblGenomes-Gn; PB2503_t10867.
DR   EnsemblGenomes-Gn; PB2503_t10869.
DR   EnsemblGenomes-Gn; PB2503_t10871.
DR   EnsemblGenomes-Gn; PB2503_t10873.
DR   EnsemblGenomes-Gn; PB2503_t10875.
DR   EnsemblGenomes-Gn; PB2503_t10877.
DR   EnsemblGenomes-Gn; PB2503_t13681.
DR   EnsemblGenomes-Gn; PB2503_t13683.
DR   EnsemblGenomes-Gn; PB2503_t13685.
DR   EnsemblGenomes-Gn; PB2503_t13687.
DR   EnsemblGenomes-Gn; PB2503_t13689.
DR   EnsemblGenomes-Gn; PB2503_t13693.
DR   EnsemblGenomes-Gn; PB2503_t13695.
DR   EnsemblGenomes-Gn; PB2503_t13697.
DR   EnsemblGenomes-Gn; PB2503_t13699.
DR   EnsemblGenomes-Gn; PB2503_t13701.
DR   EnsemblGenomes-Gn; PB2503_t13703.
DR   EnsemblGenomes-Gn; PB2503_t13705.
DR   EnsemblGenomes-Gn; PB2503_t13800.
DR   EnsemblGenomes-Tr; EBT00001624877.
DR   EnsemblGenomes-Tr; EBT00001624883.
DR   EnsemblGenomes-Tr; EBT00001624887.
DR   EnsemblGenomes-Tr; EBT00001624893.
DR   EnsemblGenomes-Tr; EBT00001624898.
DR   EnsemblGenomes-Tr; EBT00001624904.
DR   EnsemblGenomes-Tr; EBT00001624910.
DR   EnsemblGenomes-Tr; EBT00001624914.
DR   EnsemblGenomes-Tr; EBT00001624920.
DR   EnsemblGenomes-Tr; EBT00001624927.
DR   EnsemblGenomes-Tr; EBT00001624933.
DR   EnsemblGenomes-Tr; EBT00001624940.
DR   EnsemblGenomes-Tr; EBT00001624946.
DR   EnsemblGenomes-Tr; EBT00001624952.
DR   EnsemblGenomes-Tr; EBT00001624956.
DR   EnsemblGenomes-Tr; EBT00001624961.
DR   EnsemblGenomes-Tr; EBT00001624967.
DR   EnsemblGenomes-Tr; EBT00001624973.
DR   EnsemblGenomes-Tr; EBT00001624979.
DR   EnsemblGenomes-Tr; EBT00001624984.
DR   EnsemblGenomes-Tr; EBT00001624991.
DR   EnsemblGenomes-Tr; EBT00001624997.
DR   EnsemblGenomes-Tr; EBT00001625003.
DR   EnsemblGenomes-Tr; EBT00001625008.
DR   EnsemblGenomes-Tr; EBT00001625019.
DR   EnsemblGenomes-Tr; EBT00001625026.
DR   EnsemblGenomes-Tr; EBT00001625032.
DR   EnsemblGenomes-Tr; EBT00001625038.
DR   EnsemblGenomes-Tr; EBT00001625045.
DR   EnsemblGenomes-Tr; EBT00001625051.
DR   EnsemblGenomes-Tr; EBT00001625057.
DR   EnsemblGenomes-Tr; EBT00001625062.
DR   EnsemblGenomes-Tr; EBT00001625068.
DR   EnsemblGenomes-Tr; EBT00001625076.
DR   EnsemblGenomes-Tr; EBT00001625080.
DR   EnsemblGenomes-Tr; EBT00001625089.
DR   EnsemblGenomes-Tr; EBT00001625095.
DR   EnsemblGenomes-Tr; EBT00001625101.
DR   EnsemblGenomes-Tr; EBT00001625106.
DR   EnsemblGenomes-Tr; EBT00001625110.
DR   EnsemblGenomes-Tr; EBT00001625114.
DR   EnsemblGenomes-Tr; EBT00001625117.
DR   EnsemblGenomes-Tr; EBT00001625120.
DR   EnsemblGenomes-Tr; EBT00001625124.
DR   EnsemblGenomes-Tr; EBT00001625128.
DR   EnsemblGenomes-Tr; EBT00001625132.
DR   EnsemblGenomes-Tr; EBT00001625136.
DR   EnsemblGenomes-Tr; EBT00001625140.
DR   EnsemblGenomes-Tr; EBT00001625144.
DR   EnsemblGenomes-Tr; EBT00001625147.
DR   EnsemblGenomes-Tr; EBT00001625151.
DR   EnsemblGenomes-Tr; EBT00001625156.
DR   EnsemblGenomes-Tr; PB2503_r13707-1.
DR   EnsemblGenomes-Tr; PB2503_r13807-1.
DR   EnsemblGenomes-Tr; PB2503_r13907-1.
DR   EnsemblGenomes-Tr; PB2503_t07274-1.
DR   EnsemblGenomes-Tr; PB2503_t07276-1.
DR   EnsemblGenomes-Tr; PB2503_t07278-1.
DR   EnsemblGenomes-Tr; PB2503_t07280-1.
DR   EnsemblGenomes-Tr; PB2503_t07282-1.
DR   EnsemblGenomes-Tr; PB2503_t07284-1.
DR   EnsemblGenomes-Tr; PB2503_t07286-1.
DR   EnsemblGenomes-Tr; PB2503_t07288-1.
DR   EnsemblGenomes-Tr; PB2503_t07290-1.
DR   EnsemblGenomes-Tr; PB2503_t07292-1.
DR   EnsemblGenomes-Tr; PB2503_t07294-1.
DR   EnsemblGenomes-Tr; PB2503_t07296-1.
DR   EnsemblGenomes-Tr; PB2503_t07298-1.
DR   EnsemblGenomes-Tr; PB2503_t07300-1.
DR   EnsemblGenomes-Tr; PB2503_t07302-1.
DR   EnsemblGenomes-Tr; PB2503_t07304-1.
DR   EnsemblGenomes-Tr; PB2503_t07306-1.
DR   EnsemblGenomes-Tr; PB2503_t07308-1.
DR   EnsemblGenomes-Tr; PB2503_t07310-1.
DR   EnsemblGenomes-Tr; PB2503_t07312-1.
DR   EnsemblGenomes-Tr; PB2503_t07314-1.
DR   EnsemblGenomes-Tr; PB2503_t10861-1.
DR   EnsemblGenomes-Tr; PB2503_t10863-1.
DR   EnsemblGenomes-Tr; PB2503_t10865-1.
DR   EnsemblGenomes-Tr; PB2503_t10867-1.
DR   EnsemblGenomes-Tr; PB2503_t10869-1.
DR   EnsemblGenomes-Tr; PB2503_t10871-1.
DR   EnsemblGenomes-Tr; PB2503_t10873-1.
DR   EnsemblGenomes-Tr; PB2503_t10875-1.
DR   EnsemblGenomes-Tr; PB2503_t10877-1.
DR   EnsemblGenomes-Tr; PB2503_t13681-1.
DR   EnsemblGenomes-Tr; PB2503_t13683-1.
DR   EnsemblGenomes-Tr; PB2503_t13685-1.
DR   EnsemblGenomes-Tr; PB2503_t13687-1.
DR   EnsemblGenomes-Tr; PB2503_t13689-1.
DR   EnsemblGenomes-Tr; PB2503_t13693-1.
DR   EnsemblGenomes-Tr; PB2503_t13695-1.
DR   EnsemblGenomes-Tr; PB2503_t13697-1.
DR   EnsemblGenomes-Tr; PB2503_t13699-1.
DR   EnsemblGenomes-Tr; PB2503_t13701-1.
DR   EnsemblGenomes-Tr; PB2503_t13703-1.
DR   EnsemblGenomes-Tr; PB2503_t13705-1.
DR   EnsemblGenomes-Tr; PB2503_t13800-1.
DR   EuropePMC; PMC3019957; 21037002.
DR   EuropePMC; PMC3156400.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002156.
DR   SILVA-SSU; CP002156.
DR   StrainInfo; 368419; 1.
XX
CC   Bacteria available from ATCC BAA-594T and KCTC 12087.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2902643
FT                   /organism="Parvularcula bermudensis HTCC2503"
FT                   /strain="HTCC2503"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Parvularcula bermudensis"
FT                   /db_xref="taxon:314260"
FT                   /culture_collection="ATCC:BAA-594"
FT                   /culture_collection="KCTC:12087"
FT   gene            52..978
FT                   /locus_tag="PB2503_00497"
FT   CDS_pept        52..978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00497"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08180"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX1"
FT                   /protein_id="ADM08180.1"
FT                   /translation="MTRRRRERTRGDLYEEVTARIIAQMEEGTVPWVQPWTSKGPGSPA
FT                   LGLPQNAATRRPYSGINILLLWGAAQEQERESQLWLTFKQALALGGAVRKGEKGTTIVY
FT                   ADRFTPQREKQKAEESGGAAREVAFLKRYTVFHVDQCDGLPDDAVTGRVPLPPRQIEPD
FT                   AERLIEATGADFRVGGDRAYYVPSQDFIQVPPQAAFRDQINYYRTCFHELGHWTGHATR
FT                   LARDLTTNFGTKDYAREELVAEMASAFLCAEMGIVPTVRHADYLASWLDILREDKRAIF
FT                   RAASLASKAADFVLAFRTPQETDQRAA"
FT   gene            1020..2819
FT                   /locus_tag="PB2503_00502"
FT   CDS_pept        1020..2819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00502"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08181"
FT                   /db_xref="GOA:E0TAX2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX2"
FT                   /protein_id="ADM08181.1"
FT                   /translation="MTYEPYPLFALAIAAENVRHASLPDDGIPALAQLIADSGLQQPLC
FT                   GYRKGRTKLLIYDGRRRLLALQHLASEDRLPKDCLNGIPCRIGSKAEARAASLGAGLGT
FT                   KGFHPTEAFRQFAALIEEGQTVPDIAKRFSLSEREVEQRLRLARLAPPIFDAFAEDAIT
FT                   LEQAMAYALIDDPNRQMRVLETGGADLSARMIRRQLTDGETPGTDKRVRLIGLAAYEAA
FT                   GGRLRRDLFADEDDLSGVTLLDAALLDDLTHARLREAETALRAEGWSWVRASVHADYDL
FT                   YQTHGRVRPERQPLPEDAQQERDTLVARRDALAGTAEHEDELDDETWAEIERLDAALED
FT                   LDAQHTAHSPEDLARGGAVISIRPDGSLDIVCGLVPRKALTPKAEKPALPHAVHRQLTE
FT                   RASEALARDLASHAETADLLVTAAMAQAAWSYGPITGIGLSGEMPRFTEGGTLPPDEAL
FT                   AARIDAAKARVGRSLAETVENVAALDDDQRAGLRQLALSSLLDLSEIRGDTRSEDGRSL
FT                   GTFLARRMGTDLTRHWQPDEVTFGRLSRDQILTALTEMGVPTKGLEKAKKADLALLAAR
FT                   KAQEAGWLPEPLRFAHAPDGAAG"
FT   gene            2816..2941
FT                   /locus_tag="PB2503_00507"
FT   CDS_pept        2816..2941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08182"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX3"
FT                   /protein_id="ADM08182.1"
FT                   /translation="MTTGEREDVAVLPPGPVRQGEGEEVAAPGPNRFPEDDSAAA"
FT   gene            2922..3254
FT                   /locus_tag="PB2503_00512"
FT   CDS_pept        2922..3254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08183"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX4"
FT                   /protein_id="ADM08183.1"
FT                   /translation="MTAPRREGRSSRCPWRAEDPAEATMDLWQPPGPPKPRAAKDFPCR
FT                   GVLCRAIRAANWFPFRLIARSARGIPRETNLPPPSVRRCASAVNGSAARTPAMAGPSPA
FT                   GISPAG"
FT   gene            3276..3605
FT                   /locus_tag="PB2503_00517"
FT   CDS_pept        3276..3605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08184"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX5"
FT                   /protein_id="ADM08184.1"
FT                   /translation="MSAIGYVTHNEERGTYKGTLRTLTIATGIELVPNGEKTDERQPDF
FT                   RIFTDERTEIGAGWHRKGKTSGRPYVSLTFAAPELGPRKLYANLGPAAGQDDPAVFAII
FT                   WNPEG"
FT   gene            3677..4090
FT                   /locus_tag="PB2503_00522"
FT   CDS_pept        3677..4090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08185"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX6"
FT                   /protein_id="ADM08185.1"
FT                   /translation="MDLILPEQASRLRTQFEDESVDQPPLVKLFCPWGAGTWLLSGLTE
FT                   DDALGLGLCDLGLGFPELGYVSLDELRRIKGPFGLTIERDLSFEALTTLTVYAEAARMA
FT                   EGVVEDRASLEAAFARLERRAKEDRRVLKARML"
FT   gene            4218..4526
FT                   /locus_tag="PB2503_00527"
FT   CDS_pept        4218..4526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08186"
FT                   /db_xref="GOA:E0TAX7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX7"
FT                   /protein_id="ADM08186.1"
FT                   /translation="MLDIDLSDLSQDKGARTTQLRHGDRLADLIDRAVAALGIEKSTFL
FT                   RAAIAKEAQRILEESSHHVMSAEDAARFEAALDRKPTVTSKAKAAAKAYRARVVHAD"
FT   gene            4516..5061
FT                   /locus_tag="PB2503_00532"
FT   CDS_pept        4516..5061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08187"
FT                   /db_xref="GOA:E0TAX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX8"
FT                   /protein_id="ADM08187.1"
FT                   /translation="MPTERSAPLRIERFDPARHDRSGFSCGVPRLDNFLQLTAKKQQAA
FT                   DMTRVYVVVEDGDTRILGYHTIGMGMMEASLLKKRPRGSPDHGELPVLFLGQVAVDERA
FT                   QGQGLGGILMHHVFEKARLVADEAGCFALLLDVMTDGGEEAFERRRDWYAGFGFEPFTS
FT                   RPARMFLTLKDMRAILER"
FT   gene            complement(5154..5237)
FT                   /locus_tag="PB2503_00537"
FT   CDS_pept        complement(5154..5237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX9"
FT                   /protein_id="ADM08188.1"
FT                   /translation="MIGKFEHTKTAAFRAFETSEKKKVEAS"
FT   gene            5347..5736
FT                   /locus_tag="PB2503_00542"
FT   CDS_pept        5347..5736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00542"
FT                   /product="IS 426 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08189"
FT                   /db_xref="GOA:E0TAY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY0"
FT                   /protein_id="ADM08189.1"
FT                   /translation="MSDDYRRIEVITGTARRRYWSADEKLSIVEETLQPGQTVSLVARR
FT                   HGMAPNLVYRWRRLMKEGGAVAVGSDQNVVGEVAVKKLEARVRELERMLGKKTMEVEIL
FT                   REALDQARSKKPILQLQSYPQDGSR"
FT   gene            5733..5939
FT                   /locus_tag="PB2503_00547"
FT   CDS_pept        5733..5939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08190"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY1"
FT                   /protein_id="ADM08190.1"
FT                   /translation="MSAVARAMGVARSHLYDRTKESGSPSGSYRKDGDTELLAAIAAVT
FT                   DERPHLWLSPCHGDRPAAVRPRQ"
FT   gene            6121..6615
FT                   /locus_tag="PB2503_00552"
FT   CDS_pept        6121..6615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08191"
FT                   /db_xref="GOA:E0TAY2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY2"
FT                   /protein_id="ADM08191.1"
FT                   /translation="MAFVMDAHDREAIAHAAVANCGISGSDVRDMMLEALKRCFRTIRA
FT                   PHRVEFLSDIGSPYTAKATRHFAISLGPKPRFTPVASPESNGISEAFVKAFKRDYVRVR
FT                   PIPDARTALPQIAGWFEDYNENHPHSGLKWKSPREFRNVHQPSRLSGETGATPPCKAKY
FT                   D"
FT   gene            complement(6526..7182)
FT                   /locus_tag="PB2503_00557"
FT   CDS_pept        complement(6526..7182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08192"
FT                   /db_xref="GOA:E0TAY3"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY3"
FT                   /protein_id="ADM08192.1"
FT                   /translation="MSTNLLVASLSTIVCAFSIWRIAALRRPTVLQRLAEKYFDQSEGS
FT                   DIVTVTPSGRLRRKNYPQAQISSGDDTKASGAAEAYVAKLRNVREVIQGVTSKFWGTVF
FT                   REYVVFGILAVIGVTGMVAGLEAQLAQVSVQDGLVAALENVGRIFESLFTTQLIESIEF
FT                   EGGLAVEIAAGLQRSAASFIGSGFVILVVLRLTRWSGPRFTGQSARLMDVTEFSG"
FT   gene            7351..7797
FT                   /locus_tag="PB2503_00562"
FT   CDS_pept        7351..7797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00562"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08193"
FT                   /db_xref="GOA:E0TAY4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY4"
FT                   /protein_id="ADM08193.1"
FT                   /translation="MNHVHLIGRLGADPLSTPYASDLGRDDPKILVRFDLAVGAASSRK
FT                   AEETPPIWVPIVLFDGQPARFAAEHLTKGDLVALSGRLDLRRWTDEDGRAIRRLQVIAS
FT                   ELRKLTPRRSPDDEGADPPPEDDISATNVVPLSHERTQRRERLQ"
FT   gene            complement(7757..8071)
FT                   /locus_tag="PB2503_00567"
FT   CDS_pept        complement(7757..8071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08194"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY5"
FT                   /protein_id="ADM08194.1"
FT                   /translation="MPRKKDPLAELKGFEAREAELKERKKALQDEAARYLGSLVMEAGL
FT                   DSWTPEQLRAGLARLAEQGPDRSDAKAVPTRPASSPNGEVKEPTAAVIADAPAAGSAHG
FT                   "
FT   gene            8223..8504
FT                   /locus_tag="PB2503_00572"
FT   CDS_pept        8223..8504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08195"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY6"
FT                   /protein_id="ADM08195.1"
FT                   /translation="MVLQGPEGLTCPITHDAQGAGAALGQSSCGVATKSGKTGFLQGRA
FT                   TAPLEPQRLRRVAGSPQDDSCIRSRNTSAETVFFRGLDLPSITGRIAP"
FT   gene            8501..8803
FT                   /locus_tag="PB2503_00577"
FT   CDS_pept        8501..8803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08196"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY7"
FT                   /protein_id="ADM08196.1"
FT                   /translation="MTASFRVQFRLSKARTQALRDLAETEGVSPNLMAKSLCETALGQQ
FT                   EPDPKSVERDLLIIRAGMEQLFRRSGRESELDAAIDALEKHRTATARTVQRGGLS"
FT   gene            8800..10839
FT                   /locus_tag="PB2503_00582"
FT   CDS_pept        8800..10839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00582"
FT                   /product="TraD"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08197"
FT                   /db_xref="GOA:E0TAY8"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY8"
FT                   /protein_id="ADM08197.1"
FT                   /translation="MSGNASGPFKTFLRGGQVTLHTLRMFGQVMRFLSFAMVSLMLVIA
FT                   WAGVMVNTAPEDRHYAMKRYEAWAYRAAGFRESLELNMRTADGSHAPFPIGTILTHPAV
FT                   AEHEKRFRRQLFVWGRIGGLGGGFGFLLLTGLFVGRGSTLTRTNVKRGAAMASAQELKA
FT                   QIGAHNRWTAMKRKELRGRPRYALAGIPYPVGSEVQHTGISGTIGSGKTQAIAALLDQI
FT                   RKAGDRAVVFDLTGGFIAPFYREDRDTILNPLDRRAPAWSVFDEAKTKAGFDAIAAAMI
FT                   PRAQKADPVWADSARMVFSTAGQLLLGDGRASNKELVDLLLNAELRTLAPFFAGTPAAS
FT                   IISADTPRMTNSVRMMLSTYLDGLRLLPSRGDRFSITEWIENDRAGSTLFLSSRADMHE
FT                   TLRPLLTVWMDTAVRALMSRPRDPNRRIWFIMDEVAALQELPSIMDGLARGRQFGAAFV
FT                   LGIQAQSQLRDIYGPDGAQTLSSVCRTKLILAASDADTAKWYADFLGRQETSRSNENVS
FT                   FGANTIRDGVMLARQERIEHLVIPEEIMNLRSLEGYLKMPEGFPLAKVKVPLVLREDRE
FT                   PAFLPREDQGLLITRARAPHTVKAMQATAHRPGSEDGQRDMFSEAERDGIDELIDPDTG
FT                   EVSATTRVEGVAQDGAEGADPPSPPDRPRPRDIGQDFPDWGFEP"
FT   gene            10839..13823
FT                   /locus_tag="PB2503_00587"
FT   CDS_pept        10839..13823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00587"
FT                   /product="TrwC protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08198"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAY9"
FT                   /protein_id="ADM08198.1"
FT                   /translation="MVASIAAVSSASAGAAYYGKDNYYAKGGDAPEPSSWFGKGAASLG
FT                   LKGGVETETFERVLNGETLDGRRVGQREGETAEQAQARAHRPGIDLTFSPPKDVSLLLY
FT                   IGGDKRILGAHRAAVDQTLKWAERNLAGTRIRTGPSATPAVKTGNLVIARFEHDISRDK
FT                   DPQLHTHAVIANITKTDDGRWRALHNDPFFAHRKTLSLAYDATLRNALRELGYRVKLED
FT                   GKSGRYSVDGVPDGARAEFSKGKDRIDSAAVGLKHPTPSARDKLAVKTRPAKDELRQEE
FT                   RVALRETRGAPWKATLEHTVAVSVERQAQGHLQRPLDDRAVGRVGMEGLARRMAQNLFR
FT                   PTKTLRLSENDPYKLERAASEKGYSARAAVSFGLRHHEEREAAFSLHHVRRTALEHAAD
FT                   GVTLRDIDRELRFLRANRKLLVNAKDPNAESTTKRSLTHEERTLSLLQDAGRTGPLVPE
FT                   QTLRSALESTHLTGGQKAAIGLILGGPNRLVGVQGYAGTGKTTMMRQTAALARDLAPLA
FT                   KKDGYKVLGLAPTHSARKTLEESGGFDSRTVSAFLREAGGGTLPPDIKNTIVLIDEASF
FT                   LSTRNMNALLERLIALKPAKIVLSGDRRQHGAVEAGRPFDIAQRAGLPTAIMKDIVRLP
FT                   KDEGHRDQRAAVEAAAQGKVAVAMKRLGANIVERPGNLAGGAVEAWRALPKDKQDKALL
FT                   VAPSHRLREAINQGIRSELIANGRLSAETMTISVLRSKNLTRAEAMSPRSYAAGDILQF
FT                   HARLDAINAKKNTRRLVTAVDEERGRLTLRNARGKDQTVPLSRLQGRYENTPYSLHREE
FT                   PLELRRGDSVMFTRSNPDAGLSAMDAAKVVGWDQERVSLNVSGTQRQFGRDDPALRSLT
FT                   HGYAMTSHAAQGRTAKDVVAVMDSKERALTSQVGFYVSISRSADTLALIVNDKERVLNT
FT                   MQRQTGLKTSAMETEGRIGDLTDLGTHQGTGTTSSLSVPALAADQRNEATGNEQDSSLD
FT                   QGLSL"
FT   gene            complement(13899..16019)
FT                   /locus_tag="PB2503_00592"
FT   CDS_pept        complement(13899..16019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00592"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08199"
FT                   /db_xref="GOA:E0TAZ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ0"
FT                   /protein_id="ADM08199.1"
FT                   /translation="MQGWSELRPVQSEAIEALLGGNDDAIIAAATAGGKTEAAFLPLLS
FT                   EILNLEVSRDAGFDLVYIAPLKALINDQQRRLESLCLETELAVTPWHGDVAVSVKAKAI
FT                   KRPRGVLLITPESLEALFIRRGQTIPQLFGGVRAVVIDELHTLLDTERGVHLRSLLARL
FT                   ELAVGRSIRRVGLSATLGDMNLARAYLRPGAEEGVTVVKADGGNAELQLQLRGYLKGGS
FT                   EDDAAEKAVAAHLFEKLRGRDNLVFAGSRGSVEVYADRLRRMTEEMHLPQEFYPHHASL
FT                   SKEHREFVEQRLKDDRLPTTAVCTSTLELGIDIGDVACVAQIGPPFTVAALRQRLGRSG
FT                   RRAGHPAILRQYAIEEATDHQSALVDRLKLSLVRSVAMIELLLEGWCEPPKAQSLHLST
FT                   LVHQILSVIAERGGASARRLFVTLCEKGPFSAVTPDLFARVLRQLGHPDVSLIEQSEDG
FT                   SILLGKVGEKLVEHYSFYAVFMTPEEYRILAEGRDLGTLPVDDVLAPGMTIIFSGRRWE
FT                   VIEVDDLEKVISVRQSHAGVAPLFGGDPGDIHDEVIDRMRVLFTDDQLPIYLDDTAGEL
FT                   LTDARTAFARSELGKKRIIDTGDNSALLATWCGTAKTWSLGLAFGAEGFKWSVYDGFLE
FT                   IDGRDTKREVRDVLDFLGAGGTIDLSDQATALSFEKFHPYLSRDLLLADAKSSRLNLGA
FT                   LPPLAGEILNSI"
FT   gene            complement(16067..17380)
FT                   /locus_tag="PB2503_00597"
FT   CDS_pept        complement(16067..17380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08200"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ1"
FT                   /protein_id="ADM08200.1"
FT                   /translation="MVEIKRRERDTIIQALRAGVVPRLGLQHIQVGRAREIEELVKDME
FT                   RIAEGGAAIRFIIGDYGSGKTFFINLIRLVALEKGLVVMSADLAPDRRLHATGGQARSL
FT                   YAEMARNCATRTKPDGGALASVVERFVSQTYRTAEEEDRSVGEVIRERLAHLEELTGGF
FT                   EFSEVVRKYWEGHETGDEDLKTSALRWLRAEFATRTDARKALGVRTIIDDASVYDHLKL
FT                   MAAFVCEAGYKGLVISLDEMVNLYKLTSSQARNANYEQILRILNDVLQGSAAHLGFLFG
FT                   GTPDFLMHTRRGLYSYEALQSRLAENSFARDGLVDLSGPVVRLANLSPEDLFVLLKNVR
FT                   RVMKHEESVPNEAIEAFMHHCAARIGEAYFRTPRNTVTAFVDLLSVIEQNPGAAWQDLI
FT                   EAIDIEVDGGDDLSDIEDLGSTGNAATTPDDDLSSFKL"
FT   gene            complement(17380..20154)
FT                   /locus_tag="PB2503_00602"
FT   CDS_pept        complement(17380..20154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00602"
FT                   /product="plasma membrane H+-transporting two-sector
FT                   ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08201"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ2"
FT                   /protein_id="ADM08201.1"
FT                   /translation="MMPTASAQDPAIRSAQEQLLERGYEPGPADGFSGPRTVSAIEAFQ
FT                   RDQDLVVSGELDDQTVARLSAPSVAPAPLPDIDYETSAAPSAKAPSLPAEGAWTAFGLL
FT                   VAIAAVGSIRFARRSQRRAMSSGSSSMTESRAAINSHLSPTREAVAAAFKRDPEKPTSS
FT                   PHSVVRSSSDRFRLKNARDLEDTARNVSNQALSSPQAVDRSSAERFRLKNARELESDAP
FT                   RQTPHRPDREVLSSDPKSGWVPKGGSRKVAGREIGGMVYVGVAPRLDGYGTRSGAFIDP
FT                   SLSVARRGDDFAGEGMGYWPKYHEITATSRATYLDWLASGRSDTRANVGYMFLYFYGLE
FT                   RRFFKDSPDTEEKTQILDEVDRLLGLFGSNHSAHRYLSAFLDIGRVLQAEGDLEPIFDH
FT                   KGFDLPLSLSVALGLRVANGENIPSDWALSWLLCHPERQLRTPARRCAPEFRAVFEQIF
FT                   ADRYPKGLPVRRPKRELTPSYQAASGEFSATITMSDAQGSLPDVSGLKTPVRAIQVVAD
FT                   EAMDALDKYSRLLGRNPEGRGTLEGLALLPPSIRPLYGSADIERLRAWAGETVKQGGVS
FT                   LGDLLVRLEGNRPEKVTRRHLTGAADALALIGYGLAPDPRYALRPPKINEPVILFPLPE
FT                   GYDLADGASDAYKAALLELGLAALIAHADGTIAPAEKTALAETIHGNTQLDEHERARLQ
FT                   ANLDWLLSVPPDFSLFRKRLKEAANGEVAVVRRIIVAIANADGVIHRDEIASIEKIYRV
FT                   MGLDPSEVYSDLHVGAMADEPVSVRPAVSAPAGETIPPETSNRTGLVLDRSRIAEISRQ
FT                   TEQASKVLGSILGGDEADDEDLALQEEETSIFDGLDPKHASLATELLERPHWAEDEIAA
FT                   LAARRGLMMQGGLEAINEWAFKHFDDALIEEYDGYDVNGAIAEALKERMAEHS"
FT   gene            20779..22344
FT                   /locus_tag="PB2503_00607"
FT   CDS_pept        20779..22344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08202"
FT                   /db_xref="GOA:E0TAZ3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ3"
FT                   /protein_id="ADM08202.1"
FT                   /translation="MKFVVKFLSGESPATKRYPHAVLTQNNWDDYGYKTTFQVTLHVTA
FT                   DERHHLGNIKIIEAHRTGGYTEMPEKPFSRLSAGHASLAAELDYYETLYKLGRSIYEPF
FT                   LKGLRDVAFDDEIKAEVEDSEAFEVSLLRFVGAKRTLADAARLFRKDGLPAKRRTRGFK
FT                   VKFKTRTARTSDSFVIEFDFRRQGRLPNRINALIGYNGTGKTRILSNLAIVASGYGYGS
FT                   KREILENAAGRFVGNAPPFKTVVVVSYSAFDTFVIPGSTEQEKERLEDSGEIFGYVYCG
FT                   LRVRSGDEDASANERPYRLRTPLEVEAEFLDALNRVRKAERLETLLEVLKPLLRDPSFQ
FT                   RIGLTQFYTNRDDDALAELFRGLSSGHKVVLKIVTELTAHISGSEPTLVLIDEPETHLH
FT                   PPLLAAFLKSIRACLETFDGYAIMATHSPVVLQETPAKYVHVLRRHADESRVVSPSVET
FT                   FAESIGVITQEVFNLNDGSTDWHETLQELARRNSLEEIEEAFGRKLGFAARSYVLSVRD
FT                   EMEG"
FT   gene            22349..23203
FT                   /locus_tag="PB2503_00612"
FT   CDS_pept        22349..23203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08203"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ4"
FT                   /protein_id="ADM08203.1"
FT                   /translation="MRSIPLLAVDATGVFDEIAAAKRQPRRQRIQAVRSKVLTAYEAYN
FT                   NVVPEVGGLAKVQMTDKQKHAMRHAYTVETQPMTKLRGELLERTIVARCPFCGIGETST
FT                   LDHYLPKEEYPEFSVFPNNLVPSCSVCNTHKRVLIVDEGTSVRMFLHPCYDSIPDENFL
FT                   SVRVRMEADALILSYGLRQPIGMALVVFQRLRTHFSELKLANRYRRMAFEHLGGQYRSL
FT                   RRTYGPNKNPKRVAEQLIEGAGDFEDRFGPNYWLARLYRALAADAEFCGGGFEALQVHA
FT                   QQQ"
FT   gene            complement(23787..24617)
FT                   /locus_tag="PB2503_00617"
FT   CDS_pept        complement(23787..24617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08204"
FT                   /db_xref="GOA:E0TAZ5"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ5"
FT                   /protein_id="ADM08204.1"
FT                   /translation="MADVDQKLTDLIGFSREAFDTAQTAQGWSSRLQWVLAVIAVVAVF
FT                   LPGQELAIVAAGLSLVGAAAIACLRFRQQGFRRYGERVRRATLLAKGLGHELSAHEYQS
FT                   IEATFGGDRKRATAKADTNYYASRLPPGEDRLIENLYESAFWSADLFKYSARTAWVRFA
FT                   GLAFAAILVIVTIVPFLSEDLDIILSRIFLVVMTVLVSREVLGDAFNYSMAQHEVCLVL
FT                   ERLEALKGKPNKTADLMLILGDYNAAVEAAPIPQTGVYERRKQNITDSWDKART"
FT   gene            24712..25878
FT                   /locus_tag="PB2503_00622"
FT   CDS_pept        24712..25878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08205"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ6"
FT                   /protein_id="ADM08205.1"
FT                   /translation="MCFSAIARSVAIFLASSNMIDCHKHVVAYHNDEITLPEAERGEMR
FT                   NRRNANRNRIKTRLKANEKPAPAFFASQGSYADKTMVQYPDKDYDIDDGVYFRKEDLLG
FT                   PNGGEMTALLARKMVFDAINDGSFKTPPELHTNCIRVLYAAGYNVDVPVYRIVTETDIF
FT                   GNETAYVELAGADWIRSDARDVSTWFDDVNQSRSPDTENGRQFRRIVRDIKKLTNSRKS
FT                   WRKRILSGYGVTILAAECYVPFAGRDDYSLHATLRAMHNRLKFSLALQSPVEPYDHVAD
FT                   HDDARSKYFRARLDDLESCLDDIAAAETEDEALDAWSDLYGDDYFSDRKAKAQTEALET
FT                   KSADGSLLGLGLAAAGIAAGAAALSAARAKPSWEPSQAVSKGGGRTNA"
FT   gene            25875..27644
FT                   /locus_tag="PB2503_00627"
FT   CDS_pept        25875..27644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08206"
FT                   /db_xref="GOA:E0TAZ7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR032701"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ7"
FT                   /protein_id="ADM08206.1"
FT                   /translation="MTAGGVISEARTALADRLGAYLLSAFDAQPFSASDLQAYNGKKVD
FT                   RGWRLPGDPPLHLLLDPEFPYAPPRIALPDETQRLLWPHVETAGLLCVFPTQTNIDAFE
FT                   PEKVATALITDARDLITRNQSGDLDEEFRKEFQSYWTLAIDDKAPFYRSLVVPRGPTRK
FT                   VRVWRGQQKSKLIRIFGDTDEALNLWLSNAYGSPPKEGWRLYDALLIWLERPLIPSEYP
FT                   NSARDIEALLSSSAPRAGDILPLLDISQSTDVLIGAPSEVGACFGAVHLDKPDAKAVQK
FT                   GFRPGRAPAAHVKRHATSPARKARKGMVERVDSSWVHGRDYNEDIKRLTDTNVIVIGCG
FT                   ALGASVAVLLAQAGVGKMRLFDGEKLDRPNTSRHPLGARQIGENKANALAEHISGRFPH
FT                   MRKIEAVPEDLVATNIDIYADISEADLVVSATGEWSSMSLIADAAGFWGAPLQTIWQEP
FT                   QALAAHSVVTFRKGPCLRCGFNLLGKPHFEAIFQNEADVWRQIPACGGAFTPYGATDLA
FT                   YTSGFCAAESLKLLSATPVRARHALWAASEDRLAQVGTRYTENLIAAFHPSPQGGVLTR
FT                   DWPESASCRVCAA"
FT   gene            28174..28584
FT                   /locus_tag="PB2503_00632"
FT   CDS_pept        28174..28584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08207"
FT                   /db_xref="GOA:E0TAZ8"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ8"
FT                   /protein_id="ADM08207.1"
FT                   /translation="MHLASDCATITSMAQDNSQHGRQFLTAHQPEIEQTLEGVYAWNSE
FT                   TAKYGVLWVFLTWTFRAAALIGALTSTAMALVLLILGSDIQVFAFDPIRHHTWFLWGAA
FT                   SMAFLVGFTFFSLIHSAVRKSHQVSIELSKRR"
FT   gene            complement(28594..31512)
FT                   /locus_tag="PB2503_00637"
FT   CDS_pept        complement(28594..31512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00637"
FT                   /product="TraG"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08208"
FT                   /db_xref="GOA:E0TAZ9"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAZ9"
FT                   /protein_id="ADM08208.1"
FT                   /translation="MEVITYGGGEFIRDMFNAVAAVVGMGAFASALRLSLVLGLLFVLF
FT                   QTAFSLNFWTTIRWFVTSLIIYLCLLVPKVEVQITDRFDPGLPGATVANVPLGLALIAS
FT                   LTTTVGDRFTEVTETAFALPTDLEYQENGFIYGSKLFKDSMSFRVTDATFGQNLSGFIR
FT                   TCVFYDLLEHRYSVTDLRETDDLWTFVTVTQPPNPARFYEYVTGPGATEVKSCDEAATT
FT                   LDGLWAGEANRIAQIYGKQVAPNLTEAAAQALILGSLAEAHDFFLGSARSASDQIRQAT
FT                   LGNLIDKAVRDQGAELGADALLDAYGQARMESEMAHAIRQGSRLAERFVPLFRTVAEAL
FT                   FYGLFPVLFPIFLLPSIGERFLRGYVGGFVTLMAWGPIYVILHRIMMGTAGFRSAGAAY
FT                   TPTSGEAITLVTQTGIETVHSDIAMIAGYMTLMVPFAAGALGRGAMAFAGLSQSFLHPA
FT                   QMAAQSAARETSTGNMSLGNTSFDTHRFNSVDGNRLATSSFVDTGEGSWNTPEGGRMRM
FT                   TAGGARVYDGMGAISRGATHVDYQGGLSTALQSEASWSLEQRDAAANRSSEARTALAHN
FT                   VADLTWQMNEGRSFEDVTGYGQDTRMAESASKLLTNASRFAERFAEGKDTRMAIEAYIA
FT                   ASASKGVTVPLLGSAKVEAGGKASAAWEARRSEIYEAAREAVRTDGSQDTYDDVVSTFE
FT                   RGSSSESGQETNAWREAFAANLQESQTASRDLEHYQARSDAARNLASHIEREGSGFTAN
FT                   WDNAFLNHMATQERGDGHVIGVNEAARRWTSGDLADRMWVEAEARNFIEDQAAHLLDRP
FT                   ELGGFRMPEGPGGSPSDFEAIDQVGAEYRSDAEAQSDVTFNAARAEQIEGTAYWTGQRH
FT                   EQSVAAMRGDDEELARLRKLTVQSRVQDSRDAEWDEFARQDPDEMSEDEANIWRKAKRS
FT                   PGVGSTPVDGEQQRSDEERMPDFQPFGQIEHFKTGADRLTAD"
FT   gene            complement(31524..32942)
FT                   /locus_tag="PB2503_00642"
FT   CDS_pept        complement(31524..32942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00642"
FT                   /product="TraH"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08209"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB00"
FT                   /protein_id="ADM08209.1"
FT                   /translation="MRRFLKLPAAVASFVYGLSMPTSAAADVNAEMNQFWNDLGVAANV
FT                   TGPSSFEGQRAGYYTFGNVYVRTPQRSLSPVNIQMPGYRAGCGGIDIYGGGFSYVNSAE
FT                   LVAFMKSVANNAASFAFQVALETISPVIAEKVGELQSVAQRINQMAINSCESGQLAVAA
FT                   VWPQSDQASRVICEASASRRGLYPDWVAARHGCGSEGERSNVLAGASVEEKASIPQNIN
FT                   IAWDALKKHPVISGDRELMQFLMTLSGTEILTAGADDDAAQSYQFLPSKMLDPGVISAF
FT                   LDGGTIDIYECETDPDDLCLAPTTGGSVTIASSDGLRARVSQMLADIMGKVRTRTALTA
FT                   DEQAFLNVTSLPVYKMINVHAAYEGVFADQTIQSYAEIIAIDLLYGLFEGYAEMLSEAG
FT                   STATSGARDSVVAWKEQLTRQREFLLQYQLENNARVEVIEQVIARTQAIERQLAGRLSK
FT                   DLADAYQFSRNASY"
FT   gene            complement(32927..33235)
FT                   /locus_tag="PB2503_00647"
FT   CDS_pept        complement(32927..33235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08210"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB01"
FT                   /protein_id="ADM08210.1"
FT                   /translation="MTLLDLETAAEAWLTSKGVALVPISREERDAARLRLLLKGDLPRR
FT                   RALRLVALWSLAPAVSACRGAHVRDMADFIHAEGFALVDAFGERTLEPEEILPCAVS"
FT   gene            complement(33235..34020)
FT                   /locus_tag="PB2503_00652"
FT   CDS_pept        complement(33235..34020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08211"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB02"
FT                   /protein_id="ADM08211.1"
FT                   /translation="MPLRARPIAEAALAAALLLASAVAQEDPLYCAERQLGRYFYCERP
FT                   EEPERATPDAPAAPVSAIEEMAGVRERLEELRAEAVLRPTEAAVRDYIVYQREQLDRAS
FT                   TFSDVWRRLLWTDPSLDYNLLRPVSGIAKQAWLDGRKEDRRATLAHLRDRYGLFYFYAA
FT                   SCSACTEFSPILRAFADTHHLTVKAVSFDGGPNPSFPDAVIDRGQMERLGLAGSPTPAL
FT                   VLFDTETRAVTPVAFGIVSHAELEDRIFVLTQKEMGQDY"
FT   gene            complement(33992..35809)
FT                   /locus_tag="PB2503_00657"
FT   CDS_pept        complement(33992..35809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08212"
FT                   /db_xref="GOA:E0TB03"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB03"
FT                   /protein_id="ADM08212.1"
FT                   /translation="MSVYLCPLGLCCLSTIAAGITLWLQAFPKWPATAAFAKIMIGVAG
FT                   AILFFVVPATVSAQDMTRDEARAEAEDLAAGLEGEVKASATQTVDADSVPSFVTGDPAE
FT                   TGHYSNPEGLESAGLSSLAIHEEGQVVSTAIVSRPVVTLAELATWTANGLAIEGDATSI
FT                   VSEYSGTYGDCTVTVSGGTGGARYRYSCNSGETLLSFEDRCRVPLDVTVPSRHEFECLW
FT                   TFLDGDLSWEPEPFCATLGSEASCGPLAFHGGGDCLPDWKTGVTICTPRRFRTTCDIDL
FT                   IDGRSPVRTVPGTPVEAWNTAACDANTADPNCTLLGETCVEGPETRAIGGVDITRDCWA
FT                   YERTYTCSSLGGEVTDCDVPAGCILEGSTCLSTDDLTGECRATEYQYVCETAGAPGGAV
FT                   GYCEEDVYCIDGDCETLTRPQNDEFPEAVSALSMMGQLQDDVDDATLTIFPGEYHKCDK
FT                   AIAGLQNCCRDDGFLTDIGFDCSADDRALANKQSAGLCHYVGTYCSDRTLFGICLKKRK
FT                   TFCCFNNVLARLIHEQGRPQVGWDWGSTKTPDCSGYTVALFQSLDLSLMDFSEFYDGVL
FT                   DTFVGPDTDATSAAITTRIIDAFACPPNC"
FT   gene            complement(35806..36531)
FT                   /locus_tag="PB2503_00662"
FT   CDS_pept        complement(35806..36531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08213"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB04"
FT                   /protein_id="ADM08213.1"
FT                   /translation="MAILCASLMSVAPGQAQDGIDRKAIEEAVRNAEAEAAAFAAEVAA
FT                   RAEAYAEEARALTETVHGRWGEAAAPSDTTEPVDLDAMVADAGVVSAARQETSGPAGVL
FT                   VFVSFSMPEQSLRQLVLDAHKAQVPVLLQGFVGGSLKETATRMRALLGADTGQDLLGGV
FT                   VIDPRAFRIFRVTEVPAFIATRAPLPDCDGLDCDAPPPPHDRIAGNMSLGAALSALASE
FT                   GTDAALQARASLKRWEAQP"
FT   gene            complement(36542..37543)
FT                   /locus_tag="PB2503_00667"
FT   CDS_pept        complement(36542..37543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00667"
FT                   /product="putative conjugative transfer protein TraU"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08214"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB05"
FT                   /protein_id="ADM08214.1"
FT                   /translation="MRRPALILAAIAYLMTPPARADAPTCGGTFVNPITDICWSCLFPI
FT                   SLGAAPIWPSSRPDTANPPSPICTCPIPLPPFVRIGLSIGYWEPVRLMDVTKKPYCFAN
FT                   LGGTRIDLGLSIGAKSSGQSDNEDDVGSWHVHYYMYPLIYWLELLTDFGCMQTADFDLL
FT                   YLTEIDPLWNNDELTFLLNPEAVVFANPIAQAACAADCVAASAHLPVDQLFWCAGCHGS
FT                   MYPMDGNIAAEYGHVQGASLAAERFLYKLHRQGIGWQHSGSGHVCQNWPNPMIKKSEYR
FT                   LQLVNPVPNVAGRWACPTLGASNVLYEIGRTIPVIGEDYGFLVWQKENCCVF"
FT   gene            complement(37540..38157)
FT                   /locus_tag="PB2503_00672"
FT   CDS_pept        complement(37540..38157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00672"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08215"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="InterPro:IPR025864"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB06"
FT                   /protein_id="ADM08215.1"
FT                   /translation="MYRAIAFAAWLALSSEATAKDLGVRGAVFPVTEPDLFAEIAGKLA
FT                   RLEAAGEIDRINERLRQRALASAERPSPVPGLTRTDTPRRFHVDPTITVLDDIVTPDGQ
FT                   VIARAGERFNPLDYVPMRQTLLFFDGDDERQVAWAKDRMHDGEALLSLILVAGPVLELT
FT                   RDWERQIFFDQGGTLTTRFGITQVPARVSREGDLLLVEEVMP"
FT   gene            complement(38111..38620)
FT                   /locus_tag="PB2503_00677"
FT   CDS_pept        complement(38111..38620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00677"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08216"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB07"
FT                   /protein_id="ADM08216.1"
FT                   /translation="MSALPRRMKTNQRWRQLGLLALLLLLLAMTRAALAWDRGWYVSIN
FT                   WTESLPFWAFVVDKRAEPQVGDYIDFWPPENPYYDDIAFVKQVVAGPGDLITCDGRRFF
FT                   FEGREIALAKEVSQAGDILHLGPCGVVPDGHYFVLTPHKDSFDSRYQEIGYVPRDRVRG
FT                   VARPLF"
FT   gene            complement(38617..39141)
FT                   /locus_tag="PB2503_00682"
FT   CDS_pept        complement(38617..39141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00682"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08217"
FT                   /db_xref="GOA:E0TB08"
FT                   /db_xref="InterPro:IPR014115"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB08"
FT                   /protein_id="ADM08217.1"
FT                   /translation="MADATPPAILIRETDKTTKRLVLAGMAVAVSLSTAALTLTLRQPD
FT                   PPVFISVSLRSLVQEHMLSTLGPEVTPFEAETRTAEFSRALDVAIGELAAEEGVIVLAS
FT                   EAVLGAQVPDFTEEVRLRARAYAADLAARRGAMPPTYDGAGATGLLQGMERDLDALAVA
FT                   ANLRPPAEERP"
FT   gene            complement(39134..39448)
FT                   /locus_tag="PB2503_00687"
FT   CDS_pept        complement(39134..39448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00687"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08218"
FT                   /db_xref="GOA:E0TB09"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB09"
FT                   /protein_id="ADM08218.1"
FT                   /translation="MPRSEATRHLRRVRRVTGTVLGEGLHAVLLALGVMVLLVLLLNGF
FT                   NAHSTALFVENYTGRMLSAEPDRQRAFTQFLTLVFGINLTSVLIVRWGDRMTKRRARHG
FT                   "
FT   gene            complement(39435..42008)
FT                   /locus_tag="PB2503_00692"
FT   CDS_pept        complement(39435..42008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00692"
FT                   /product="TraC"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00692"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08219"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB10"
FT                   /protein_id="ADM08219.1"
FT                   /translation="MTTDPLGLINRVGAALTGEGSLFDGVRRETSLDRLSEMLPYRLWD
FT                   EEKALYLNAASTGWILEVVPFLGADETVVSVLAEMFSDGIPDNAYLQILNWASPRIGPV
FT                   LDSWATARGGEAGVFKTLALHRVDHLRRGAFRSLSAHAPFLARQFRVFVALGVEGDASP
FT                   EVRHQLEGLRSNVAQALKSLGVASRPVAPDGLIRFLDEVLNPQFAVTRASAGYDPAELL
FT                   DRQIVRPDTSLRVEADRLLFETIAPADRSPFEAPGTTQLEDYRTGRFDVRAFSARKFPE
FT                   RFDQGGMALAIGHPLNDQLRLPCPVLSCLAIAFGSKESSNDLAAAKFGRAEQQAATNMV
FT                   RFLPELKDKADDWKWVRERVRDGARLVRAGSFLIMVAPEGEAEAAERAVRSLYRGMGWE
FT                   LAKDRFVATQTLGACLPLTLADGLGADLQKLRRLRFMVTDTCVQIAPLQGEYLGMSTPD
FT                   LMLLGRRGQPFFWSPFGNQGAGNHNVAIIGSSGSGKSVLMQELVTGLRGAGTNVTVIDD
FT                   GESFKHMCEALGGRHVKFTLEADVCLNPFSLLDERKAKEDGDYATESLTLVRAMIEQMA
FT                   KGEERATAEERGLIDSAVAEVWKARGILAGIDDVAAALKEQGAEGVKLANALRPYTTAG
FT                   LYGPFFNGEASLVIDNPLAVFEMKDLEAKPELRAVVMLALMFLINQRMMADRREKMALV
FT                   IDEAWALLGRGAAGEFIAGFARRCRKYGGAIITGTQGIDDYYRTEGAKAAFENSDWCIV
FT                   LKLKPEAIALVLKSERLSIDAHTADIIRSLSVSAGEYSEMLIMGPHGRHVGRLVLDPFS
FT                   ATLFSSDARTFAEIEALEAQGLTVAEAVERVAFRHQDKEVRHAAE"
FT   gene            complement(41998..42459)
FT                   /locus_tag="PB2503_00697"
FT   CDS_pept        complement(41998..42459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00697"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08220"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB11"
FT                   /protein_id="ADM08220.1"
FT                   /translation="MTRALIIPLFALAVTGCSSTMRLENVAGTWSCPRVDGVCADIAAI
FT                   DRSVVGETGPLPIRGPATPSSPLVTVGLEEDGMALTRTGDEVARIVLAPMIDAHGHYHA
FT                   SRVIYAVMSTGGWARTPVARPEATSIAATAPLPTEPRTRLASEGGDRDD"
FT   gene            complement(42456..43217)
FT                   /locus_tag="PB2503_00702"
FT   CDS_pept        complement(42456..43217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00702"
FT                   /product="predicted protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08221"
FT                   /db_xref="GOA:E0TB12"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB12"
FT                   /protein_id="ADM08221.1"
FT                   /translation="MGSLRHNLSVGGVMIAAVTLASPSLAQETPDVQGKVAKRFTDTAV
FT                   DAVDCEGFGPLCQVIAGRTVFYVDEAVRHAFIGRVYDLEAKVDLTERTLAVIAPSADIE
FT                   GAPAVGLRWADLPWDSAIIRNEGGALKVAVFSDLHCGYCQRLSAALHDAPDIEAHEFLV
FT                   GMAQSEGPSRAIGCAEDPEAALAAYYAARSLPAGSCDRDIVAPAREAAQRIGLTGTPTF
FT                   LRPDGAVTAGFRDIDTLRAWIAEGQAEETVQ"
FT   gene            complement(43444..44700)
FT                   /locus_tag="PB2503_00707"
FT   CDS_pept        complement(43444..44700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00707"
FT                   /product="putative conjugative transfer factor, TraB"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00707"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08222"
FT                   /db_xref="GOA:E0TB13"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB13"
FT                   /protein_id="ADM08222.1"
FT                   /translation="MSEENKKRLTRQRLLMYGAGAAAVAAASVWIFSGDGADNQTRAED
FT                   LRRRKAMTDVINPPGMADDFLSETGTRLAAVEGAISRLEADNTSLKEALRSRDLELAAT
FT                   RADLQKTRDDAAAMVEDMAGRVASVSTRTEPALGLPTSEPSAIGDPFGRRGVLPSGAAP
FT                   QPLSVEPVIPRTVQVLQFAAATEALDTRVLEPAVFRLDEGDYVPPNAYAPAHVLVGVDM
FT                   STGVRLSADPKPVLLRITGPARSVLQNGRQLDVDLTGCLVNGAAHAELSSERVYVKLQK
FT                   ITCDRGDGEVAESPVEGYIAQLGKVGVRGRVVSREGDIVSKALVAGVVGGFGRGIARNT
FT                   DQIFAAGTAGGSTIIGQDNLSAGEIAAGGFGEGLATAADTVSDYLIDRAEQYQPVIEMP
FT                   TGIDVEIVFLSGFYARGTQ"
FT   gene            complement(44697..45428)
FT                   /locus_tag="PB2503_00712"
FT   CDS_pept        complement(44697..45428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00712"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08223"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB14"
FT                   /protein_id="ADM08223.1"
FT                   /translation="MIRTLLISAASAACLSAAAHAQQIVEASDGGVVTGYVSASGITRL
FT                   RFTSDAAASVQMAEGGEGAGFSIQHEPATGDLYLTLGRLPRQGEAVGAASFFVTTRAGY
FT                   TYQVELAAKATPSTQIEVRNPDLARRQTERALAETSLDEEVVALTRAMWASALLDGYEI
FT                   KRPVVRERAAGTLRLAVRATYESDALQGRVLIARNPSRGDVAIEESLFLAPGVAAVTIQ
FT                   GPRVLGPGASVPVLIVDRGQP"
FT   gene            complement(45425..46024)
FT                   /locus_tag="PB2503_00717"
FT   CDS_pept        complement(45425..46024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00717"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08224"
FT                   /db_xref="GOA:E0TB15"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB15"
FT                   /protein_id="ADM08224.1"
FT                   /translation="MDTNVSYTRLKTALRQRNVLAVFTLLLGVTGLLQTYLIATRDRHV
FT                   ILTPTLLSDTAISARAPSPEYLEQVTRDVAGLFLNRHPHNLSYFRENILRLAHPSTHGE
FT                   IESALMETERRLIATKTATVFYPAEIYVDPLTLYSEIRGELHTYLGPERVSSDPALYAA
FT                   DWRFEAMRLWLEDFYPITADEARAPKAPLIKAETTR"
FT   gene            complement(46027..46320)
FT                   /locus_tag="PB2503_00722"
FT   CDS_pept        complement(46027..46320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00722"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08225"
FT                   /db_xref="GOA:E0TB16"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB16"
FT                   /protein_id="ADM08225.1"
FT                   /translation="MAQTDRTRIPATLDEPEKLAFWTIDEFIVLIGGFMLGIVLSRFVE
FT                   GILAGFVGVWALKKFKKGESLNLLRYAAYWVLPSSLFAFKRTLSSYKRDLAG"
FT   gene            complement(46448..46774)
FT                   /locus_tag="PB2503_00727"
FT   CDS_pept        complement(46448..46774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00727"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08226"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB17"
FT                   /protein_id="ADM08226.1"
FT                   /translation="MQSFVSHQRTERAAQTVVAGALLVAAAAVMAAPALAGADTTFDTA
FT                   VTTITGYINGSAGKLAALVSLGYGIVRMATSGWSLGHVGVPIAVGVSAGIGGPIVQSSV
FT                   TALI"
FT   gene            46777..46878
FT                   /locus_tag="PB2503_00732"
FT   CDS_pept        46777..46878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00732"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08227"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB18"
FT                   /protein_id="ADM08227.1"
FT                   /translation="MGFLMMTPEPFRPAHQETEFPDDQTVLSTEYMA"
FT   gene            47170..47559
FT                   /locus_tag="PB2503_00737"
FT   CDS_pept        47170..47559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00737"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08228"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB19"
FT                   /protein_id="ADM08228.1"
FT                   /translation="METHQIRLSADGDFQSCLQAVRRRACSLGVSTGKITDIVRAALLS
FT                   ASGPELIRFGKRHDCTSLTAPARAPKAASVEVSGPSAMKLKQLLGELIGEAPFDASLRV
FT                   VVHASVRLLAERDDDAFRSAFTRKT"
FT   gene            47705..48094
FT                   /locus_tag="PB2503_00742"
FT   CDS_pept        47705..48094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00742"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08229"
FT                   /db_xref="GOA:E0TB20"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB20"
FT                   /protein_id="ADM08229.1"
FT                   /translation="MARLRRGLSQTHLAEMVGIGSGSTIAKFEAGKRPPSLPTLIKLAA
FT                   ALEIETPALLDGLDDRQLPAEDPSPLDGAIVLELIRRRAVTLESPHIRKVVYSNLDKLD
FT                   DRTLRRLLEDLAGGGPGSNDGSHAA"
FT   gene            complement(48091..48369)
FT                   /locus_tag="PB2503_00747"
FT   CDS_pept        complement(48091..48369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00747"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08230"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB21"
FT                   /protein_id="ADM08230.1"
FT                   /translation="MPDDRSGMPDPTPSMRRSSKPATPQEYQGLQAPIAREPIPGEPCR
FT                   LIGKVYNWSPIYYEVAILSRDEVGKRKVAKRRVHLSPCPQCPDHGSA"
FT   gene            complement(48714..50117)
FT                   /locus_tag="PB2503_00752"
FT   CDS_pept        complement(48714..50117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00752"
FT                   /product="possible phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00752"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08231"
FT                   /db_xref="GOA:E0TB22"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB22"
FT                   /protein_id="ADM08231.1"
FT                   /translation="MVSRSDADRYLKSRGRRWWYCRRVPTRFAHLDTRGTIRESLGTDS
FT                   LEVARLRRDHLAEADDAYWQGLALAAAGEGGAEALGALRQRHKAAQTRALAAGFTYRTV
FT                   DRLAATPDLDDLVERLLAVRERSHSDDIAPREAEALLGGAPQPPVRVSDAFEIYLREIA
FT                   FNDTLYKSPRQRYSWEKTKRTSIGYFIDQVGDLVLTEITRDHALDYQRWWSAQVKPTDP
FT                   KAKPVAPNTANRHIGNIRTLYTSYFKHIGEEERPNPFRGIHFKAKSRTEVPPFENDWVR
FT                   SRILKPGALLGLNLDLQVITYMLIETGCRPSEIINLQLEDIVLEAAVPHIAIRARTSRE
FT                   IKTLTSAREIPLVGVALEAAKRARGGFPRYQDKSELFSANMMKGFRRRGLFPTPDHVIY
FT                   SFRHAFEKRMQEANIDYGLRCLLMGHKTTRPVYGDGGSLAYRRDELLKIAHPFSPEIFE
FT                   RLDDEVASR"
FT   gene            complement(50249..50325)
FT                   /locus_tag="PB2503_t07314"
FT   tRNA            complement(50249..50325)
FT                   /locus_tag="PB2503_t07314"
FT                   /product="tRNA-Asp"
FT   gene            50641..52023
FT                   /locus_tag="PB2503_00757"
FT   CDS_pept        50641..52023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00757"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08232"
FT                   /db_xref="GOA:E0TB23"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB23"
FT                   /protein_id="ADM08232.1"
FT                   /translation="MTENDTDQSPKTTPTFSELGLDTKILEALTESGYTHPTPIQADAI
FT                   PEALRGRDVLGIAQTGTGKTASFVLPVIHRLARGRARARMPRSLILAPTRELAAQVSEQ
FT                   FEKYGKNHKLSMALLIGGVSFADQDAKLTRGVDVLIATPGRLLDHHERGKLLLTGLEVM
FT                   VVDEADRMLDMGFIPDLERIFKLTPFTRQTLFFSATMPPEIQRLTDQFLSAPARIEVAK
FT                   PATTAKTITQRIARLPSGEDKLKRAALRHLVETAENLKNGIIFCNRKKNVDVIAKSLQE
FT                   HGFDARPIHGDLPQSFRTETLQMFRDGGLKLLVASDVAARGLDIPDVSHVFNFSVPINA
FT                   DDYVHRIGRTGRAGRLGHAVMLVTPDDGKAFDAVLKVTGLDKIEEHDISALLDDWNGAA
FT                   RPPEKGRNNRRGGPNKKEASSSRPTSNKGRDRRDDRHDDGPADPVVGFGDHTPDFLLKE
FT                   MS"
FT   gene            complement(52020..52928)
FT                   /locus_tag="PB2503_00762"
FT   CDS_pept        complement(52020..52928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00762"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00762"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08233"
FT                   /db_xref="GOA:E0TB24"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB24"
FT                   /protein_id="ADM08233.1"
FT                   /translation="MEGVIIAGPTASGKSAAALEIAAALDGEIVNADAMQIYRELPILT
FT                   ASPSAVDRAQIPHHLYNCVPGEERWSAGLFARKAAALCDDILARGRRPIVVGGTGLWLK
FT                   ALTDGLSPIPPIDDSYGRAAAARWAQLGPEDFRREVLNLDPAMEALAPADRQRHLRAWT
FT                   VATATGTPLSEWQRVPPTPVLTIEWARGVLMPDRETLRTRSAHRFAAMVERGAMGEVAA
FT                   LLARDLSLSLPIMKAVGVRELSKVLAGEWSLEEGVSAAVTATHRLVKRQTTWFNNQFSA
FT                   WPQSASANALNEALGGGQGRR"
FT   gene            53016..53351
FT                   /locus_tag="PB2503_00767"
FT   CDS_pept        53016..53351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00767"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08234"
FT                   /db_xref="GOA:E0TB25"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB25"
FT                   /protein_id="ADM08234.1"
FT                   /translation="MTASAREEIDSAIKSNDIMLFMKGTPQFPQCGFSSAVVQILDYLG
FT                   ADYGSMNVLEDQEIRQGIKDYSDWPTIPQLYVKGEFVGGCDIIREMFEQGELRPFLAEK
FT                   GLITAEA"
FT   gene            complement(53454..54071)
FT                   /locus_tag="PB2503_00772"
FT   CDS_pept        complement(53454..54071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00772"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00772"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08235"
FT                   /db_xref="GOA:E0TB26"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB26"
FT                   /protein_id="ADM08235.1"
FT                   /translation="MSKRQNAKYKIDRRVGENIWGRPKSPFNRREYKPGMHGQRRAGKM
FT                   SDFGQQLMAKQKLKGYYGNISEKQFQRIYDEAAKRKGNTAELMIGILESRLDAVVYRAK
FT                   FVPTVFAARQFVNHGHVKVNGVRTNIPSYRLKPGDVVEVRERSKNMALVLEALQLPERD
FT                   IPDYVDVDPKKMTATLVRVPEFSDVPYAATMEPNLVVEYYAS"
FT   gene            complement(54235..55140)
FT                   /locus_tag="PB2503_00777"
FT   CDS_pept        complement(54235..55140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00777"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08236"
FT                   /db_xref="GOA:E0TB27"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB27"
FT                   /protein_id="ADM08236.1"
FT                   /translation="MAYGDRKTHRLDGGYGVFDKFGFGIAAALGIAVATFIDMTQSNEA
FT                   SALFLFGEWVTRISNAVGLGPIPLYVVVLLLMLIGALSIFYFQPITFRGAFAQGFGALA
FT                   AIMTIAPSDMGAPLPGLTGALPTSNFIDDLPPAGDGGNIATDEISFRPYGGARLVPLTF
FT                   SQTQSTTTDAETNRARAYELRIKVVLPNGISKDISKMAIQGGLRGRLNVEGTRTTYNLF
FT                   RNSGAEVDYRDNAMYFSTSLPGVPGRDTLSLAARIEIEGYQITEERFEAQRGANPVWEI
FT                   QMQPSRTPLYIQRLRTPYRF"
FT   gene            complement(55200..55958)
FT                   /locus_tag="PB2503_00782"
FT   CDS_pept        complement(55200..55958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00782"
FT                   /product="putative phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00782"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08237"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB28"
FT                   /protein_id="ADM08237.1"
FT                   /translation="MTQDDPQLPMIGRRRLYLMRHGHVDYFAPGLTDFRQVPLTEHGCA
FT                   QARAAGVLLSDISFDAVFTSGLPRTQETARLVLEQNDRAGPTPINMPTFEELAGGKVVA
FT                   KSREELAAWLAFSLEAAADQDATFLPGGESFADAFERSGRGLSSLITDYRWRQALLVAH
FT                   DGINRLLLSRVSGAGLKGVGAFEQDLACINVLDFDVVTDTHGGVEITRTIIKAVNVTAY
FT                   DVSKAGLRKTSLEHLFDIDFDGARPQGAPA"
FT   gene            56147..57850
FT                   /locus_tag="PB2503_00787"
FT   CDS_pept        56147..57850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00787"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08238"
FT                   /db_xref="GOA:E0TB29"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB29"
FT                   /protein_id="ADM08238.1"
FT                   /translation="MRGSAKVRRSGREILALFLLIASGVYGLGFWSLVTFDPDSAWTRY
FT                   ELLDESGRTARAAWHGSKAIALRLEDGLDGPETQNMQLIVAGAHDRAGDPDEAIRLYRA
FT                   VLEGPMGEEMRPADEMAIVYRIADLHLTQGRVVEAASLAVRIVEAAGAGHVAHSRVPDA
FT                   ETALYTDYLDRLSTDLRGLLPPNDRRPPIAGETPDLLVAAENMTTLGAYYAARGTPPET
FT                   AAGLLSTAYDLRASLLGIDHQDTIHSALLLGPVYERMGQVDKAVPLYLDAFHAQERTYG
FT                   ANHPVLSLYIRLLVSAYEEQGRMTEAEALNLHMRNIFSDAFGARRYAANQDRDRTADIN
FT                   RPVSEAFPLPASYKPDDLVAAGAEAIPLSKLPHLDEMKIRMASIDETTSMPASLSALLS
FT                   QCEQPGEALSLRSGYRSYDTQAQLYRRAGPKGRVTPPGTSEHQLGLAADIDVNGRFMRA
FT                   SDRAYRCFEENAFRYGFILTYPQGNDYLGADDGFEPWHWRFVGPRTALLYREIGPLGKP
FT                   QEFLAALPCYEERAMSGLFLSVEGRDVCLDTLASETTAQDDKAKGRGETG"
FT   gene            57854..59143
FT                   /locus_tag="PB2503_00792"
FT   CDS_pept        57854..59143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00792"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08239"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB30"
FT                   /protein_id="ADM08239.1"
FT                   /translation="MGHQEYLRRTAFVRCLFIEPPKDVVRAAADHPIEFVGSERQPDIV
FT                   LADLREIPDEQLAGRIATAQQAATGTPLLFLIGGDQRRAAPILSAVSIDTVVMSAPGEA
FT                   FLMTAIKRRVLQADRAEEVALRLEAMAALGRGALPVPCLRPQPRALFVGLPGALSLKTL
FT                   TGLTRLTPTGAALSRHQALTLLEMKAADRVFIQPHKQRRQMTGLVRLIRRHSELSSLPV
FT                   IVLEKHAKGRHRAFWATAGANAVVEIDDLPLAVGMAEQLSRESQLAKSVEDNLADLSFT
FT                   DDGTQSRLCGGRFFEAVLAQRCRSAHAPFSLGAVRLIPQSLGTPHPAIFSEPAVYAAMG
FT                   ATNTDLIMRAAPDLLLISLPGSDRIAARRTLRLLATLISDLKFGATEEARTFATRTAVV
FT                   SARQGADPKTLIRQLVAAVGEERAETRELA"
FT   gene            complement(59147..62638)
FT                   /locus_tag="PB2503_00797"
FT   CDS_pept        complement(59147..62638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00797"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00797"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08240"
FT                   /db_xref="GOA:E0TB31"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB31"
FT                   /protein_id="ADM08240.1"
FT                   /translation="MALVSATSSISAERAWQEPGPLTVHGAPEGADALIIAQAVSQAGG
FT                   LIVHIARDASRAAALAGSLAFFAPQVPIVRFPAWDCLPYDRLSPSPEIVAARMAALSTL
FT                   NAHNGKTPLVIVTTVNAMTQRVPSQALISTASFSARPGASVSMDELISFLTMNGYARAS
FT                   TVREPGDYAVRGGLIDLFPPGTDEPLRLDFFGDTLETIRAFDPNTQMTTHQRQDVHLSA
FT                   ASEALLNDETISRFRSGYLAQFGAPGDDPVYEAVSAGRRQAGMEHWLPLFYDGLETVFD
FT                   HLGDALVFVDHLGDEAARERFDQIADYYETRREDMTAREDQKGGLDIVPYRPMPPDRLY
FT                   ITPAEWDAALTATRLRPLTPFSAPEGKRAFDFGAKKGRPFTAERAAGQNVFEAVAAHIA
FT                   AMRKSRKVIIAGWTAGSADRLKSVLADHDVDGMTSALSWPEAKDQPLPVVALPLENGFE
FT                   TDDLCFIAEQDILGDRLVRRSKTKRADNFLTEASSLSVGDLIVHVDHGIGRYDGLETLE
FT                   VGGAPHDCLILTYQKGDKLFLPVENIELLSRFGSDDPSHPLDRLGGGAWQSRKAKMRER
FT                   IRLMAEELIAIAAKRAARRAEELAPPSGAYDEFAARFPYTETDDQLNAIDDVISDLSRG
FT                   RPMDRLVCGDVGFGKTEVALRAAFVAAMSGRQVAVIAPTTLLVRQHFRGFVERFQGFPV
FT                   KIRQLSRFVSAKEASATREGIKNGDVDIVIGTHALLSKHVAFRDLGLLIIDEEQHFGVK
FT                   HKERLKEFRGDTHVLTLTATPIPRTLQLSMAGIRDLSLIATPPVDRLAVRTTIGPFDPV
FT                   VARETLLREHYRGGQSFYVVPRLSDIDTVADFLRHQVPEIKFEIGHGQMSATELEDVMN
FT                   GFYDGKFDVLLATTIIESGIDVPTANTLVVHRADMFGLAQLYQIRGRVGRSKQRAYAYL
FT                   TTSPRKKMTEGAEKRLKVLQSLDTLGAGFTLASHDLDIRGAGNLLGEEQSGNVKDVGVE
FT                   LYQHMLEEAVANLRDGNDETDETWSPTINIGTAVLIPDHYVADLDVRMSLYRRLSDLTA
FT                   SEEIEAFAAELIDRFGPLPSEVDHLLQIVGIKMLCRRANVEKIDAGPKGAVIGFRKEAF
FT                   PNPIGLVNYLSSSPLDLKVRADQKLVFKQEWPNETFRLKGCRKILTILAKIAEEDA"
FT   gene            complement(62760..63209)
FT                   /locus_tag="PB2503_00802"
FT   CDS_pept        complement(62760..63209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00802"
FT                   /product="DNA-binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00802"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08241"
FT                   /db_xref="GOA:E0TB32"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB32"
FT                   /protein_id="ADM08241.1"
FT                   /translation="MATTETIAQKLLQVLGNTYVLYGKTHSYHWNVTGARFHALHNLFE
FT                   EHYRAMWESLDDIAERIRTLGVTAPLSTREMAEASSIKENDNAVPSADTMLQNLVSDHT
FT                   TWLEDAEGALDEASDVGDTGTEDLLSTLIAAHEKMRWMLKSSIDD"
FT   gene            complement(63332..64462)
FT                   /locus_tag="PB2503_00807"
FT   CDS_pept        complement(63332..64462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00807"
FT                   /product="aspartate aminotransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08242"
FT                   /db_xref="GOA:E0TB33"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB33"
FT                   /protein_id="ADM08242.1"
FT                   /translation="MAVTQKARDLQAAGRDVLTLSMGELDFETPAPVKEAAIAAIAAGE
FT                   TRYTAVDGTPALKAAITEKYRRDHDFLLSPEEIVATTGGKFLIYAALRATLEPGDEVII
FT                   PSPYWVSYPGIVRMCGAVPVILATQAGQGFLPDPQTLKATMTPKTRWILLNFPNNPSGA
FT                   TLPLEHAAALAEVIEAHPRALVLSDDIYELIRFDASPPGPLFAKMKGMRERTLTVNGVS
FT                   KSHAMTGWRLGFGAGPAPLMAAIRRVAGQTTSNPCSISQAAAVAALGMEPSFLTDWRTA
FT                   LRTRRDLVVRTLNRIEGISCLSPSGAFYVFPDINGVVKRKGLADDTAFCTALLDEEALA
FT                   LVPGSAFGAPGFVRLSFAAADSVLEEAMGRLKRFCA"
FT   gene            64626..65774
FT                   /locus_tag="PB2503_00812"
FT   CDS_pept        64626..65774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00812"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08243"
FT                   /db_xref="GOA:E0TB34"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB34"
FT                   /protein_id="ADM08243.1"
FT                   /translation="MRFHLIQAQADPSVTVDGVVSSVTQSAQETWSWLLGSGTQWAIWA
FT                   AVAVGIFLVLRLLRSILSGIFQSSKLPQKSVRNIISRLFAATNSLFLLVFSFVVTRPFF
FT                   IDDLSDRWSAVIGYVFIIAAALQVAFWARVIVKALLNSLVANTAEEESTLENARSLITL
FT                   FANFAIFAIAVIFILQNLGQDVGALIAGLGVGGLAIGLAAQSVFRDLFASLSIILDKPF
FT                   VKGDFIAWSGFLGTVQKIGLRTTRLTSLSGEQLVVSNDDLLSNVIKNFRRMNERRVVQT
FT                   LGVTYQTPRRVLEILPERLRELLEGREGVRFDRSHMSGYGDSAITFETVYYVLSRDYAQ
FT                   HMDLQQDILLDIHKLFEDLGAEFAYPTQTLFIEGEWATGQST"
FT   gene            66197..66529
FT                   /locus_tag="PB2503_00817"
FT   CDS_pept        66197..66529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00817"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00817"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08244"
FT                   /db_xref="GOA:E0TB35"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB35"
FT                   /protein_id="ADM08244.1"
FT                   /translation="MPLYEHVFVARQDISPAQVEALTDELQTIIRENGGEIRKSEYWGL
FT                   RNLQYKINKNRKGHYSLMNIDSPSEAIVELERQMRIKEDILRFMTLKVEEHDDEPSPVM
FT                   SRRDRD"
FT   gene            66547..66771
FT                   /locus_tag="PB2503_00822"
FT   CDS_pept        66547..66771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00822"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00822"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08245"
FT                   /db_xref="GOA:E0TB36"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB36"
FT                   /protein_id="ADM08245.1"
FT                   /translation="MAKTFFRRRKTCPFSGEKAPKIDYKDPKLLGRYISEKGKIVPSRI
FT                   SAVSAKKQRELARAIKRARFLALLPYTTE"
FT   gene            66775..67392
FT                   /locus_tag="PB2503_00827"
FT   CDS_pept        66775..67392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00827"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00827"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08246"
FT                   /db_xref="GOA:E0TB37"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB37"
FT                   /protein_id="ADM08246.1"
FT                   /translation="MQVILLERVEKLGSIGDEVSVKDGFARNFLLPRKKALRATDANRK
FT                   VFEAQREAIEQENAEAREKAERLSSSIADKTFVVIRSASDMGQLYGSVSARDIAEIATT
FT                   KKLKLQRNQVLLNAPVKELGIFPVRVMLHPEVIVNIKINVARSQEEAEAQERGENILAK
FT                   KEEGVEQVVGTGEFDEFGEAPAETPAATQGADAHSDEAEDRA"
FT   gene            67634..69112
FT                   /locus_tag="PB2503_00832"
FT   CDS_pept        67634..69112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00832"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00832"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08247"
FT                   /db_xref="GOA:E0TB38"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB38"
FT                   /protein_id="ADM08247.1"
FT                   /translation="MADGSSHTGFGSDAKVPFSIEAEQAVLGAILFDNEVFYRVSSFLK
FT                   SDHFYDPVHGRIYETIEKLIVGGRLASPVILATFLEQEPAFKDVGGEAYLSDLARAVPS
FT                   TVGAQDYARVVFDFATSRGLIRLGTDMIEKAQAVDLDDDPQEQLAAAEAKLYALAETGR
FT                   FGSGFESFENALKTAIELTNAAYQRGGGLAGVSTGLRDLDEKLGGLHPSDLIILAGRPS
FT                   MGKTALATNIAVNAAKAYLPERQADGSIKAKSGGVVGLFSLEMSAEQLAGRILSEFSNI
FT                   PSEKIRRGDIDQSDFEQIYEAARQLNDIPLHIDDTGGLSIGQVAARARRLKRQHGLDLL
FT                   VLDYLQLLSGSKKAGDNRVQELTEITTGLKALAKELNVPILALSQLSRQVEAREDKRPQ
FT                   LSDLRESGSIEQDADVVMFVFREEYYLGRAEPKEGTAEHVEWQEKMSDVMGQAEVILGK
FT                   QRHGPIGTVKLAFDPRRTRFGNLASPDRFPDPGL"
FT   gene            69143..70291
FT                   /locus_tag="PB2503_00837"
FT   CDS_pept        69143..70291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00837"
FT                   /product="alanine racemase region protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00837"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08248"
FT                   /db_xref="GOA:E0TB39"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB39"
FT                   /protein_id="ADM08248.1"
FT                   /translation="MSSPPASPTLTVDLGALGRNYDELKRRTGGTSAVAPVVKANAYGL
FT                   GMHAIARTLYREKGARLFFTATCREALALLVDGQRFFDDAPPRVYVLNGFDGDRALQEK
FT                   VGYLPILSDWQDVGDWVAGGGGPCGISVDIGMNRLGMSFQDAGGLPQDTRLNPDDVQLI
FT                   MMHLSHSGDPTAPENELQAEKFFTSGMMLARLYPKAQFSLSNSGGILLGLAPEQQIVRA
FT                   GYALYGGAPNGLPGQGLDQVTTFEASVLQVRDIGSGESVGYNGTWRAERPTRLAVLGAG
FT                   YADGIQRALSNRGAVWLGGGLCPIRGAVSMDLVTVDITDAPSPVTRGDKAEIWGAQIDL
FT                   DLVARQAGTIGYDLLTGVGSRVERIYRLAPQAPRPPAGSGGQ"
FT   gene            complement(70277..70981)
FT                   /locus_tag="PB2503_00842"
FT   CDS_pept        complement(70277..70981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00842"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00842"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08249"
FT                   /db_xref="GOA:E0TB40"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB40"
FT                   /protein_id="ADM08249.1"
FT                   /translation="MSEAGPKRFYETVTVAAEDGVYVIKLDGRPAKTPGRHLLGAESQI
FT                   LAEALAAEWSQQQDIIDLTTMPLTRLTGFARDGGEDARGPWRQTILAYAGSDLLCYRAP
FT                   ETGLAARQAEIWDPFLARFAERVGAPLTVTEGIIAVEQDPKSLAAIEAYLDPYSLERLY
FT                   AAKLLTEMTGSAVLALAALDEDAPAHEIFAASRLDETFQAERWGIDAEAAIREASLRRD
FT                   FEDTLRFASLTP"
FT   gene            complement(70974..71948)
FT                   /locus_tag="PB2503_00847"
FT   CDS_pept        complement(70974..71948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00847"
FT                   /product="Ribosomal large subunit pseudouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00847"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08250"
FT                   /db_xref="GOA:E0TB41"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB41"
FT                   /protein_id="ADM08250.1"
FT                   /translation="MGASVSGVQEVTVTSAEAGQRLDRWMKRRFPGVTQGQVQKWLRKG
FT                   QVRLNGGRVKADHRVESGEVVRVPPIDPEAAAPPPSRPVVGPAEAEMMRGLVIYEDDDI
FT                   LALNKPAGLAVQGGAKTLIHIDGMLDVFGEGEARPRLVHRLDRDTGGVLLLAKSRAVAA
FT                   TLSLAFQQHRIGKTYWAITKGVPHPLFGRIDMRIEKAGEPGREKMRGTEQGQSALTDYQ
FT                   TVETAGQKAAFLALRPHTGRTHQIRVHLSAIGTPIVGDRKYGGAGAVLEGLPNQMHLFC
FT                   RQMHVPRRGRPPLVVTADLTGGMATSWSIFGFSRPDDLEWPDE"
FT   gene            complement(71933..72451)
FT                   /locus_tag="PB2503_00852"
FT   CDS_pept        complement(71933..72451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00852"
FT                   /product="CrcB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00852"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08251"
FT                   /db_xref="GOA:E0TB42"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB42"
FT                   /protein_id="ADM08251.1"
FT                   /translation="MVSEEGRGEGDVITSNFARVSPDSEPLHRTKARGAGWRRAVGELC
FT                   VSMAFQTYLAVAIGGAIGAVARFGVIRSLTAWHGGEPVWSVLAINVLGSFGLGMAVTVL
FT                   EDRQSPLAAFLLVGCLGAFTTFSTFALDAVTLYKERGSTLAGLYVGLSVGLAIAGFLLG
FT                   HQLLRWGRP"
FT   gene            72414..72980
FT                   /locus_tag="PB2503_00857"
FT   CDS_pept        72414..72980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00857"
FT                   /product="putative shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00857"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08252"
FT                   /db_xref="GOA:E0TB43"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB43"
FT                   /protein_id="ADM08252.1"
FT                   /translation="MTSPSPRPSSLTISRPVVLIGLMGAGKTTVGRRLAELLALPFKDA
FT                   DEEIEDAANMSVADIFETYGEGYFREGERKVIERLLSEGPMVLATGGGAFMNAATRELV
FT                   KLKAISIWLRADLDLLVKRTAQKATRPLLQQGDAREILARLLKERAPVYAEADIVVDSL
FT                   EGPHLKTVNRIIKALDRHAEGGATL"
FT   gene            72977..74092
FT                   /locus_tag="PB2503_00862"
FT   CDS_pept        72977..74092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00862"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00862"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08253"
FT                   /db_xref="GOA:E0TB44"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB44"
FT                   /protein_id="ADM08253.1"
FT                   /translation="MTLRRVPVALGERSYDVVIGPGALGQSVERLREIVGGGQAAIVAD
FT                   DTVWAQHGHQVSALLAEAPVITVPPGEGSKSFASFERVAEALLAANVGRDGTVIAFGGG
FT                   VVGDLAGFAAATLRRGCRFVQIPTTLLAMVDSSVGGKTAINARAGKNLVGAFYQPALVV
FT                   ADTSLLHSLPNRELRAGYAEILKYGFLGNRAFADYLETNGKVILDQSPDELAYAIEVSV
FT                   QEKARIVAADEREKGERALLNLGHTFGHALEAAAGYDGRLLHGEGVAVGMTLAARFSAD
FT                   CGMITEAEAKRVERMIADSGLPTRPQDIPGLITSAAEQRAFMQQDKKVEAGQLRLVLLE
FT                   AIGAARLVRSVDETALMAFLTTAFSTVSSAS"
FT   gene            74089..75348
FT                   /locus_tag="PB2503_00867"
FT   CDS_pept        74089..75348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00867"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00867"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08254"
FT                   /db_xref="GOA:E0TB45"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB45"
FT                   /protein_id="ADM08254.1"
FT                   /translation="MTLILILFLLCLSAFFSGSETALTATSRARIRTLELKGSRPAAAV
FT                   LKLTEDKERLIGAILLGNNLVNILASALATSFLASIFPGGLGVALATAVMTILVLVFAE
FT                   VMPKTAAISRPDRFAMAVAVPMQVLVRLFAPVTAVVQAVVRVTLSTLGVDVSNTHVLSP
FT                   HEELKGAVDLHHEEGQMEKEARDIIRGALELDDITVEEIMIHRKNIEMLDVDQPNRDIV
FT                   EAVLQSKFTRIPLYKDNPDDIIGVLHAKDLLRALWAHENDPDRISIRELAMEAYFVPET
FT                   TTLQEQLDAFKATRQHFAMIIDEYGSIQGLVTLEDILEEIVGEIEDEYDAPIIGVKRQA
FT                   DRSVIVDGTVTIRDLNRMMDWRLPDEEAVTIAGLVIHEGRCIPDVGQIFSFFGYRFEVL
FT                   KKRRNQVTSLRVVPLDAVKR"
FT   gene            75345..76670
FT                   /locus_tag="PB2503_00872"
FT   CDS_pept        75345..76670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00872"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00872"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08255"
FT                   /db_xref="GOA:E0TB46"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB46"
FT                   /protein_id="ADM08255.1"
FT                   /translation="MSAPAPRRALVFIFITVLLSMIGVGIILPVMPALLTDLTGFAEGE
FT                   SARLYGYLMFAYAAMQFLFSPVIGALSDQYGRRPVILVSLFFYGIDFLLMAFVPTFGWL
FT                   VLGRLLSGATAATFSTAGAFIADVSPPEKRAQNFGIIGAAFGLGFIIGPVLGGLAAAYG
FT                   PSLAILFPSDSGVASALTAFGPRYPFLLASVVIFANFIFGLTAFPESLPVERRRAFDWR
FT                   RANPIGGLISVSRNRTVLVIMGAYFLMQVAHHSFPAVWAFYTTAKFGWSALSISLSLSY
FT                   VGITAAVVQGYLTRKAIPALGETRAVVIGSVAMALSTLGYAFFTPAGPWVYVWITVGAL
FT                   GGFMMPGMQAKMTKATAEDAQGELQGAIASLSSITMAFSPLMMTQIFAAFTDRTEGQDF
FT                   PGAPYAVASLFLFASGALFLWGARRNRPAPPEPIAAQDAGTA"
FT   gene            complement(76687..76956)
FT                   /locus_tag="PB2503_00877"
FT   CDS_pept        complement(76687..76956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00877"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00877"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08256"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB47"
FT                   /protein_id="ADM08256.1"
FT                   /translation="MSVADRITEKLQHAFAPIELQVIDQSYLHAGHSEAGAAGESHFRV
FT                   VIVAAAFDGLSRLARHRAITKVLAEELAGPVHALSVEARGAAAD"
FT   gene            77053..77700
FT                   /locus_tag="PB2503_00882"
FT   CDS_pept        77053..77700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00882"
FT                   /product="DnaJ-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00882"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08257"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB48"
FT                   /protein_id="ADM08257.1"
FT                   /translation="MPDDGYKYKPRMGFDIRVKPTRGGSKRRRPVEETATRQCEHEDCA
FT                   EVASVRVAKSPDQPNIHIWLCQAHAREHNKNWNFFEGKTDAEAAAIRNQARYGDRPTWK
FT                   MSKNGRAAAAAKAAMGGAQGAAEDQLGLASDRPQPQDDGIYREGRRLTRLQVQAFRTLN
FT                   LKPTSSSGDIRKRYAELVKRFHPDSNEGDRSAEHQLQEVIKAHQILKKANFI"
FT   gene            77697..78380
FT                   /locus_tag="PB2503_00887"
FT   CDS_pept        77697..78380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00887"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00887"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08258"
FT                   /db_xref="GOA:E0TB49"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB49"
FT                   /protein_id="ADM08258.1"
FT                   /translation="MRGQKSARGAGSLSALRRWGAFFVLALLIAGCGATGGGLGLTNNV
FT                   APTPSDTLPPLLLIHPPFAETYACAEHWEGEHKKRGDALGTDCFVIGQVPTPTGGVILS
FT                   PFKNRGFENSDWFTYRAAILAPVAGTVARVVRRTEPNQPGIIGAAPATYVEIVDRDGVH
FT                   IVVAHIEAITVASGDEVTAGQVIGRVGNNGLSRAPHIHIGAWKGRTAYQLRHDQQAMLG
FT                   GRGQD"
FT   gene            78418..78777
FT                   /locus_tag="PB2503_00892"
FT   CDS_pept        78418..78777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00892"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08259"
FT                   /db_xref="GOA:E0TB55"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB55"
FT                   /protein_id="ADM08259.1"
FT                   /translation="MTDDPIDTDGVSLTTIIYGLYLIALFTGFPFFIGVIIAYVARDGV
FT                   TPAARSHYDHQVRIFWTVLITGVAIAILIATFFLAPLAWLLAAYIWVWVFIRCIRGLRG
FT                   SSRGDPYEGPRGALP"
FT   gene            78823..80721
FT                   /locus_tag="PB2503_00897"
FT   CDS_pept        78823..80721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00897"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00897"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08260"
FT                   /db_xref="GOA:E0TB56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB56"
FT                   /protein_id="ADM08260.1"
FT                   /translation="MLHINDLTYRVEGRTLFDQATAMIAQGWIVGFTGRNGTGKSTLFR
FT                   LIQDQISPDGGSLSLTPGRRIGGVAQEAAATEDTLIETVLAADTERADLLHRAEHATDP
FT                   HEIARIQTRLADIDAYSAEARAAQVLSGLGFDSVDQRRPCAEFSGGWRMRVALAGALFA
FT                   APDLLLLDEPTNYLDLEGAVWLETYLKKYPYTAIVISHDRGLLNRSVSHILALEGGKLS
FT                   VHPGGYDTYARRRAEQQRLAEAQAHKTEAQRAHMQAFVDRFRAKASKAKQAQSRLKALE
FT                   KLKSSDVPLDESTTPFVFPAPKPAMAPPIVRLQSADLGYEEDRPVLRDLTLRIDEDDRI
FT                   AILGTNGQGKSTLVKAIAGRLSPLNGNVYAHKKLKIAYFAQHQLDELRPDETPYDHVKA
FT                   LMPEGTEAQIRARTAGLGFGPEKADIPVRNMSGGEKARLLLGLIAFEGPHLMILDEPTN
FT                   HLDIQSREALIAALDAYPGAVLLITHDAHLAEATVDRLWEVKNGAVHILDEDIDNYRAR
FT                   ILASAKAAGEQKKTSGKTGPTAPTPADHRREAAARREALKPLRAHITGLEGEIARIDGV
FT                   IAQMDDILATPGLFDTDLARATDISQKRARAEEKKAALEEAWLEASSQYEEAIAAD"
FT   gene            complement(80718..81605)
FT                   /locus_tag="PB2503_00902"
FT   CDS_pept        complement(80718..81605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00902"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00902"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08261"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB57"
FT                   /protein_id="ADM08261.1"
FT                   /translation="MGVSHLIVGVTALFGAATQSSDLGSVCTVETARQEGFLAGSFARH
FT                   PVDARELFLSKCRFPRLFSTSRPSTDGRLGPAFLDGWQAGFFTACEPMGLLEAGSASLG
FT                   ETEESVTPALCKEMAAATVKVYDDRLTALDGQIDALTQALEGEDDAFRRGDLRDEITRL
FT                   QAQRGAEEGARRQLVALVASDSYNRQVYAVGTTYATAKAAKERASAAIADAEAALALNE
FT                   QRLNGLFSQLRQTRDADRRAALLQEAERLEDRSALLRSSMSALRREERDSEQAFQIARR
FT                   DYLKTKTALAESRP"
FT   gene            complement(81704..82339)
FT                   /locus_tag="PB2503_00907"
FT   CDS_pept        complement(81704..82339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00907"
FT                   /product="3-oxoadipate CoA-transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00907"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08262"
FT                   /db_xref="GOA:E0TB58"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB58"
FT                   /protein_id="ADM08262.1"
FT                   /translation="MPWTRDNMAERASKELQDGFYVNLGIGIPTLVANYIPDGMDVTLQ
FT                   SENGMLGMGPFPYEDELDADLINAGKQTITELPKTSYFSSADSFGMIRGGHINLSILGA
FT                   MEVSEAGDLANWMIPGKMVKGMGGAMDLVAGVKRVVVLMDHTSKSGEPKLLKECSLPLT
FT                   GVSCVDRVITNLGVFDVLKENKTLKVVELAPGVSFDEVKSVTAAALTD"
FT   gene            complement(82354..83058)
FT                   /locus_tag="PB2503_00912"
FT   CDS_pept        complement(82354..83058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00912"
FT                   /product="3-oxoadipate CoA-transferase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00912"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08263"
FT                   /db_xref="GOA:E0TB59"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB59"
FT                   /protein_id="ADM08263.1"
FT                   /translation="MVNKVYENAEAALEGVPFDGMVVMSGGFGLCGIPETLTLALRDSG
FT                   AKELTVIANNCGVDDWGLGLLLQTRQIKKMISSYVGENKIFEEQYLSGEIELEFNPQGT
FT                   LAERIAAGGKGIPAFYTKTGVGTIIADGKEEREFNGERYIMETALIADLSIVRAWKGDT
FT                   LGNLVYRKTARNFNPMMATAGKVCIAEVEHLVEPGELDPDMIHTPGIFVDRILQADQEK
FT                   RIERVTTRERAA"
FT   gene            83234..84508
FT                   /locus_tag="PB2503_00917"
FT   CDS_pept        83234..84508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00917"
FT                   /product="DNA photolyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00917"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08264"
FT                   /db_xref="GOA:E0TB60"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB60"
FT                   /protein_id="ADM08264.1"
FT                   /translation="MSQSSMFPEAGAAPLAYASSLAFVPTRAAALARLDAFAPNMGSLY
FT                   AKNRNRDDGPADRRYVSCLSPYLRHRLITEQEVIAAALNRFAFSTAEKFIQEVYWRTYF
FT                   KGWLERRPWVWDLYTDDRDRRLNELSGDQATAYQAAVEGRTGIDGFDAWTKELIATGYL
FT                   HNHARMWFASIWIFTLRLPWSLGADFFHRHLLDGDAASNTLSWRWVGGLHTKGKTYLAR
FT                   PSNIEKFTNGRFSPSPEDLAKEAPALEDDWNGEPGDPPGDLPLTSRDPAFLLLHEEDLG
FT                   LETLPVEKARLVGVGLFVDPACRSAAPVGGLVSQFTQGAIDDTRHRAKTVVGCDAVIVP
FT                   DEDNLLEAVTAAGANTVILPYLPVGPLRGPVARMTGRLAAEGFRVETMLRSHDRHAWPH
FT                   ASKGFFRLKKKIPSLIARERTPSLL"
FT   gene            complement(84517..85314)
FT                   /locus_tag="PB2503_00922"
FT   CDS_pept        complement(84517..85314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00922"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00922"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08265"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB61"
FT                   /protein_id="ADM08265.1"
FT                   /translation="MAKITPQEIDPASLPSVKGIVTEEEWRLRCELAATYRLVALFGWD
FT                   DLVFTHISVRLPEMEGHPRFLINPYGVLFEEMTASALLTIDLDGRKIDESPYQANPAGF
FT                   VIHSAIHGARHDAGAVLHLHSPYGVAVAAQEGGLGRYSQFAMQVHDDLAYHDYEGIATN
FT                   TEERARLVADMGDRSFLILRNHGTLTTGPNCAIAFLRMYFLERACHAQILAQAGGTLRD
FT                   AGPDLAQLVGRQSQPAWAPGIGDKLVWPGLMRRLARTNPGWDR"
FT   gene            85469..86248
FT                   /locus_tag="PB2503_00927"
FT   CDS_pept        85469..86248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00927"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00927"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08266"
FT                   /db_xref="GOA:E0TB62"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB62"
FT                   /protein_id="ADM08266.1"
FT                   /translation="MGIETTPGRIAFVAGDRPDAQDAFARLTALYGQTTTEEADVIVAL
FT                   GGDGTMLETLRHALPLNVPVYGMNCGTVGFLMNAYDPEGLLDRLAAANPVVINPLKMTA
FT                   EDRRGQIHEAMAINEIALLRETRQTARIAVRVQGRTRMDQLICDGILLSTPAGSTAYNL
FT                   SAHGPILPINSNLLALTPISPFRPRRWRGALLSYDATVEFEVLEPDFRRVSATADNMEV
FT                   RDVYKVTGSISSDVRMTLLFDAGAGLEERVLEEQFAY"
FT   gene            86339..88243
FT                   /locus_tag="PB2503_00932"
FT   CDS_pept        86339..88243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00932"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00932"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08267"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB63"
FT                   /protein_id="ADM08267.1"
FT                   /translation="MGAQAVRLTSIDIDNALTNAHLELAFQPIMALQSRAVSRYEAYVR
FT                   WDHPGLGSLPPGAFLSFFESQGRIGDLTRYVLRHAVREAKKANITAPGGVSINLAFGDL
FT                   VDERLPGDIAEILDRYEWAPERLTLECPQFSPEVSADEQAEAYGRFRELGCELALEVRG
FT                   RASDAMKTWSPFPFQEIKTGGPGVLRQVRSRRGAPGLSTLSELLAFAKQRQVRIVAVGV
FT                   EDLQAAHALTQLGFDLGQGNALGRAAALKPEAAAEGQDPATYLPKISPLDLSQEEEAHR
FT                   RQAAGREAQIAAAKRAALRRLKTSPSLNRPSDPAHQAVTAARKLQVRLETTFEAADRAP
FT                   AATGGASHAPKNAAATATKTETPIDAPPSATAPSAQPEKGGSSALPAAAPFGLFPPDPV
FT                   CLTGPVDGRTLILTVPPAHSLPIDWAVDAAAHAVDGDSISPGPLLRAALAETAKGQVDV
FT                   ETVDLGREMRQTDLVNDLAEDTVDPADLLDALIAELPEVRDEDAGAADSRADLPPVEAP
FT                   AFLARGRVQSRDHLVLRLLKRKYRITHFWPRSFKRALKAYKARKATDQTQDTLYRDWGQ
FT                   QNAVPVMTVGHDQARIIPMEAYQRGARGEGGTMAVEPRQDAPALKVGQESDRPLPQSG"
FT   gene            complement(87983..88993)
FT                   /locus_tag="PB2503_00937"
FT   CDS_pept        complement(87983..88993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00937"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00937"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08268"
FT                   /db_xref="GOA:E0TB64"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB64"
FT                   /protein_id="ADM08268.1"
FT                   /translation="MSTDTLIIGDGLIGMAVGWALAEAGQTVTVLGQSEMTGSLAAAGM
FT                   LAPSFEAQHPRAAPGLADLLYESLTLWSGFHDRLVKASGLTLDYRREGIIALADRQAPP
FT                   PVAGPPIAVPEGFATLGPACLIADEGQVDPRRVHGALATALAKAGGQRRGGRVEALDLE
FT                   AGAALLSDGSRVSAARFVIAAGVGSAALLAGDLPKLTSVRGRAVLVEWPGFPTRHVVRT
FT                   ADLYFCPKADGRLYVGATEEPAMAEEGALARLWERAVALLPDLEGRRILARFDGHRPAL
FT                   ATGTPLIGLHGDDPRLIVAYGHDRNGILLTPVTVERVLRLIGGLPRFIGLESPLE"
FT   gene            complement(89021..89569)
FT                   /locus_tag="PB2503_00942"
FT   CDS_pept        complement(89021..89569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00942"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00942"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08269"
FT                   /db_xref="GOA:E0TB65"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB65"
FT                   /protein_id="ADM08269.1"
FT                   /translation="MNHFTAAPAPPAPLRRLLGEVAPSLAAALGGPLAGAAADILSKRV
FT                   LGGQPSTADDWGPIIEATGRGDPETVGAIKEAEIAFRHAVLDSRIDLARIAAADRADAR
FT                   AREVKTKDPTPAILGMGIISGFFVTLIFMVALPVPEGAGTMFSIMLGALATMTAAVVNY
FT                   YFGSSAESAVKTRLIGGLR"
FT   gene            89712..90908
FT                   /locus_tag="PB2503_00947"
FT   CDS_pept        89712..90908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00947"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00947"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08270"
FT                   /db_xref="GOA:E0TB66"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB66"
FT                   /protein_id="ADM08270.1"
FT                   /translation="MYVVLIPIVLIGLSIVIARRGLVAPLLRRPITILAAGSAVGFLLN
FT                   WAEINIGTSVPMAVASRFVLGMLVFTAALQCRLSRLPKVSGIATRLIAICFPLTVIVYW
FT                   IAGIVIVPDTAFLSAMAVAMAVSLSGTPTPASALLTAPVDPRLVVSSRVEAGAMLPLVL
FT                   PLIMTVIGIGLDPDPQRGFFGNAAVAAVMSFAAGGSLGLLAAWFFPLDSGDFPIAPLAL
FT                   ALGAYALALIFGFEPVTMMAATGLLYAEEADLSAPVRTRLWRVTESVATPFILALFGLA
FT                   AVPYAILGGGASVWILALIAFLVARRAARFFTLNTARLAAHERQFLTWYGGAPGHLTAL
FT                   VVTYMAVAGLGISDQALSFGVAVVVVGLVVGRLLDRILIRRLVQQTALAEKRRYGVAL"
FT   gene            91058..92749
FT                   /locus_tag="PB2503_00952"
FT   CDS_pept        91058..92749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00952"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00952"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08271"
FT                   /db_xref="GOA:E0TB67"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB67"
FT                   /protein_id="ADM08271.1"
FT                   /translation="MSTPASQDPASDDALSADGAPPPHETVIPLTAPERSWSTAPLAEE
FT                   AEGPHGAPWTGASRRLWTSAKITAIGLVLLFLIGWPLGTALAHFQATGLWRLRLGSTIS
FT                   TLPWLLTVSILVLALGYAGAIALRLERAASRLTAGIARGGDDIGAAARHQVTALNDEID
FT                   RALARLADAERLIRHQVAAIDNAGAAIEKGAAAGTQKLSEEREALLALAEDMNATADQV
FT                   AEKIAEKTQAANEAQSASSAQWQAQERELDQQIKRLEAISTESYARFEALADAMEEQRA
FT                   TDAAAQQEGRAAETERRHAVVESHVDKIAAAQTALKEQSSRLEELIAEQRARADRLAAA
FT                   ISAHAERLGTVDLPPSPETTPDTDQGWAPRAKSWKAILTGVKAQQEMPSESLSLPPPPS
FT                   APLALETEEPAPPAAPSPPQDDPAPVAADLLERCLLRAQNYSLALQTQLFGSPSKDDLR
FT                   RFEKGERHLFAKMLNARDKTLLKARITAELDSNNVFRGRSLAFLRDFSLLVEALPEAAG
FT                   NPDIVESYLNTPLGQLYVLIGSLLDARRGGANGLGDEVERPGDDVV"
FT   gene            complement(92675..93322)
FT                   /locus_tag="PB2503_00957"
FT   CDS_pept        complement(92675..93322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00957"
FT                   /product="lipoprotein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00957"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08272"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB68"
FT                   /protein_id="ADM08272.1"
FT                   /translation="MIIVFVNRFLLFPAAAAALAGCVSILPDAADLPPRVTLDVDIPVE
FT                   MTSRPIDATLVIADPDAEAVLNTFNVAVKTAPYQFEYLDGSEWTDRVPVLFRTYLERRF
FT                   ENVGALTAVGDRSDLPVGADFELKTDLRAFYLDRTVSPEAARLSFGARLVDAQGGTLGT
FT                   RIIDRTIPIEGRGREGAVEALNRVAIDASDDVISWSLDLIAEAVGAAPARVQ"
FT   gene            complement(93319..94251)
FT                   /locus_tag="PB2503_00962"
FT   CDS_pept        complement(93319..94251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00962"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00962"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08273"
FT                   /db_xref="GOA:E0TB69"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB69"
FT                   /protein_id="ADM08273.1"
FT                   /translation="METRAHYVLIGAFMLGGIVLTVLFTLWLGSARSEYDEYRIIFTQK
FT                   ISGLQEGANVLFNGIPVGEVASLELDQENPNRSLALVRVDQGTPVKTDTGVELELAGVT
FT                   GLAVIQFTGGSPEAPLLQNVSPERIPTIDANLGGVAAVLESSGELALNLQRLISQRNAE
FT                   AVGRVLADVESLTDIFADRENEIGLIIDNAAAVSTEMRVAAENISAASARLDAVLADVE
FT                   TVVDGDVRQATEAFADAAVDLQELIVEMREVLEENRGAIRSFTREGLGAAVAMVNKASR
FT                   LVDTTQAILLEFDRNPAAFFVGEGRPTAR"
FT   gene            complement(94265..95083)
FT                   /locus_tag="PB2503_00967"
FT   CDS_pept        complement(94265..95083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00967"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00967"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08274"
FT                   /db_xref="GOA:E0TB70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB70"
FT                   /protein_id="ADM08274.1"
FT                   /translation="MMAEQSDLVISVRGLVNQFGPFRVHDQLDLDVRRGEILGVVGGSG
FT                   TGKSVLLRAIVGLRSPQGGTIQLLGKDVTRLTEEAQALLTQRIGILFQDGALFSSMTVA
FT                   QNVMAPLREHLSISDRLAQEIAAMKISMAGLDMSAGGKYPSELSGGMRKRAALARALAL
FT                   DPDILFLDEPTAGLDPIGAAKFDELILGLRDSLGLTVFMVTHDLDSLYRDCDRIAVLAE
FT                   KKVIATGPISEVSALDHPWIKDYFSGPRGRAAFLSTPQSSATPTRPGLDA"
FT   gene            complement(95080..96222)
FT                   /locus_tag="PB2503_00972"
FT   CDS_pept        complement(95080..96222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00972"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00972"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08275"
FT                   /db_xref="GOA:E0TB71"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB71"
FT                   /protein_id="ADM08275.1"
FT                   /translation="MTIASFDLSGSATEKRFIPKGEWTLRGGLTKIDSKIRALNFGPRE
FT                   DLAEIDLSQIEALDTAGALMLQRLRHRCMGEGRPQAIATLTGMTDPQHELMERMAAHIA
FT                   DCEGDPPRRKSFILLLNRVGQGTIAVGNEGLAILSFVGSVVARLAGTIMSPARFRLTAT
FT                   VAHMEEAGLNSTLIVGLMSFLIGAVVAFMGARVLSEFGAEVFSVELVGISVLREFGVLL
FT                   TAILIAGRSGSAFTASIGSMKLREEIDAMRALGISPLDALILPRTIALVLTLPVLAFLA
FT                   GFLGLLGGGVVGWLALDIPPQLFIGRLQEIVTVENLFVGLVKAPFFAFVIAVVGCYHGM
FT                   SVENSAEELGRRTTMAVVQSLFLVILLDALFAMLFLELDI"
FT   gene            96402..98663
FT                   /locus_tag="PB2503_00977"
FT   CDS_pept        96402..98663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00977"
FT                   /product="putative adenylate/guanylate cyclase
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00977"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08276"
FT                   /db_xref="GOA:E0TB72"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB72"
FT                   /protein_id="ADM08276.1"
FT                   /translation="MLEQRLQQRLRLLAIPAFTLVGILALTALLSSRMHGVQPRETFFD
FT                   LFLQAAPAPLEQAETIALIDIDQASLDNLGPWPWPRTAIARLVAAAERAGARSVTVALP
FT                   LEGRDPLSPDNLAAFLPRNEENGDTIRQLQAMPTTDAALGAAARALPTAVSAGAGARSW
FT                   IGWQRADFEGTPWLRAIDNDGRSGLALPIAPLSAGIERALTDTSAPVVGTWLKDSDGQV
FT                   RRLPLLWATAQGPMPATALAPFALSGGVAVDLAATRRETGAPPPTALTVGGANKILLGP
FT                   KVDLRYWPGRTDTLDTVPAWRVLEGGAQWSTMLRDRDVFIGESVTSDGVAQTPWGEISF
FT                   AHLHAHMARQIVAGDVPIRPVVSGVTEFVLTLLAGAITIAAAIFARPLAAIIVSVVVAL
FT                   LSVVVFLWIFSETGRLFDPSFIIGAALGAPLVIFIVVVGNILMRDDALRGAFHGNLPPA
FT                   TMERLQKSTSGPLLNGVRREVVVLSCGFRLPEGLEAKFHARPDDFVRFCGAANDALRRT
FT                   ILSHGGTVDFAENGRLMGYWNVPEVLPHPIEKACACALAMIDEMNNLTENVQTAAFAAG
FT                   GLLSDTEMSFADASVEVGIAVGECFAGPIGLGTRNRYGVVGPAVTIARQLRSRSGFYGP
FT                   AIVTDDRIFEALRHHYAFLDLDVLRFSEDDTAHTIYGLVGNPFLKASKAFRELADVQRE
FT                   MVGAWRLGEYAKTTIHLQRLRGFPGVPDGYVERFDARLAQARGQRRSLDRGDHIECLKA
FT                   "
FT   gene            complement(98953..99612)
FT                   /locus_tag="PB2503_00982"
FT   CDS_pept        complement(98953..99612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00982"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00982"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08277"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB73"
FT                   /protein_id="ADM08277.1"
FT                   /translation="MREGKGRSLGRLLITLSPVFALSACASVKVAVPGYETNKTALSRA
FT                   ASEHLALKAATEELADHPWQDVSGSGFVSFVFGTDAEIGRQAAIDAYVDAIQISHEDPV
FT                   EAVVMDADKSLSDARRVVEVSRQTADAILPLPADIAAVERAIGDARLCRRLYVSSLEVL
FT                   EREGADVSPALIRDLRDAYSQTISDLSQMADLVALRVAETGDRTVYAQPGTTSGQR"
FT   gene            99724..100683
FT                   /locus_tag="PB2503_00987"
FT   CDS_pept        99724..100683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00987"
FT                   /product="proline iminopeptidase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00987"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08278"
FT                   /db_xref="GOA:E0TB74"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB74"
FT                   /protein_id="ADM08278.1"
FT                   /translation="MVQRKLYPPHDPIERGRLRVSALHEIYYEVSGHPAGRPVVVCHGG
FT                   PGGGSTPSMRRFFDPHRYRIVLFDQRGCGRSTPHAELRDNTTWDLVSDMEALRAHLGID
FT                   RWQVFGGSWGSTLALAYALTHPDRVRELVLRGIFTLRRAELLWFYQEGANWLFPEGWQA
FT                   FLAPIPEEERGDMMAAYYRRLTGSDRATQITAAKAWSVWEGSTVSLRPSPERMAGFSAE
FT                   TFALAFARIECHYFVNGGFFAQDDWILDQAPRLAELPGVIVQGRYDVVTPMRTAWELHR
FT                   RWPGSELDIAPEAGHAASEPGIVDRLIRATDRFADLDA"
FT   gene            complement(100715..102223)
FT                   /locus_tag="PB2503_00992"
FT   CDS_pept        complement(100715..102223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00992"
FT                   /product="sodium-dependent transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00992"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08279"
FT                   /db_xref="GOA:E0TB75"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB75"
FT                   /protein_id="ADM08279.1"
FT                   /translation="MAVAGTGQSNENWSGRAAFILAAVGSAVGLGNLVRFPYVAGDSGG
FT                   GAFIFVYLATILFIGVPVLIAEFMIGRRGGGSAIAAVSRLARTEGRTRAWVIFPILGIL
FT                   ASFLIVSYYSVLAGWILHFIQVFAVDIGGRFVAEGPVALTAPAFEGQSDEEIGGILPKL
FT                   LSQPGRMIVLHALFMAATVFILSRGVKSGIEAAANVMMPIFFVLLLGLTTFSLVTGEAM
FT                   QALTFLFTPDFSQLTGSTLLRAVGQAFFSLSLGAAMMLTYGTYLSRETDIKSSSQIVAT
FT                   ADTAVALIAGLALFPIVFASPVLSADVMGDNDPGLGLLFVTVPRAFHLMPFGSLFGLAF
FT                   FVMALFAALTSAIALLETSVSWADGDYDVPPAQKARRRVIGAICLGGLAFLIGIGHALS
FT                   QVPQTVAATFFNDWSPLDAIPLFQGMNFLDAIDALATTVLQPFVGMITALFAGWAISTS
FT                   AAKEELRFDNDSTFALWQTLVRWVAPIAVGLVLLYGAIIVPLLD"
FT   gene            102354..102716
FT                   /locus_tag="PB2503_00997"
FT   CDS_pept        102354..102716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_00997"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_00997"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08280"
FT                   /db_xref="GOA:E0TB76"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB76"
FT                   /protein_id="ADM08280.1"
FT                   /translation="MTTEQHAVIDEDQLGGLAEVAGTEAVQAILDAFWSSTEELSTELS
FT                   TALHDADAENAIKLGHALKGSSANVGAAAMAARAKAIELAAREGELDVAQKAFIEFAKD
FT                   INATRLAMDNLLIRYG"
FT   gene            complement(102727..103911)
FT                   /locus_tag="PB2503_01002"
FT   CDS_pept        complement(102727..103911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01002"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01002"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08281"
FT                   /db_xref="GOA:E0TB77"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB77"
FT                   /protein_id="ADM08281.1"
FT                   /translation="MGVFQSMPSLGRRSLVELGPRIARLHWPLILVLTGLAGAGVLTLY
FT                   SVSLGDMDEYAKTHLIRYFIGAGGLFIVAMIPLRVWLSLAYPLYAAGIVLLLMVPVFGE
FT                   VVNGSQRWIAIGGFRLQPSEMMKIALVMALARYYHGLEFERVSTISGLLAPLGMIAVPV
FT                   GLVFIQPDLGTALLIGFSGVAMILLAGLSWRYILVGVFAAFFGIAGGIQTGLVKAYQWE
FT                   RVTAFLDPTYDPLGANFHANQSKIAIGSGGVEGKGMLEGTQSQLGFLPEKHTDFIFTIF
FT                   GEEFGLRGALLLLGAYLAVFLLTVHVARSARSHFGRLMSLGIGVTLVLYVLVNTGMVMG
FT                   LAPVVGVPLPLVSYGGTVMLAMMGGFGLVLSTWIDRDQDTLRTRGWKTDRLIHP"
FT   gene            complement(103911..105884)
FT                   /locus_tag="PB2503_01007"
FT   CDS_pept        complement(103911..105884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01007"
FT                   /product="Cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01007"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08282"
FT                   /db_xref="GOA:E0TB78"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB78"
FT                   /protein_id="ADM08282.1"
FT                   /translation="MKVEPFDTQRQMTFTRRATLVTGGVTALFGGIVYRLWDLQVKRYD
FT                   EFAAKADNNRFKQRIVVPGRGDIVDRYGKVLATNRQNFRILLIPEEAENERTALVNLAA
FT                   LIPLSDEEIKAALREVERTRNQPFVPITVRDDVTWEQYAAVNYHSSRLKGISSEVGESR
FT                   YYPDGEVVAPFLGHVGAATAQDLAGVSERTERLLYLQPGFRLGKNGLERSYDEVLRGEA
FT                   GSQTIEVTAAGRVLAEEDERGRPQVPGKVLALTIDDEIQAKAMEIMSADYEEYPEGTER
FT                   PSAASGAAVVLDIVTGDILALASTPAFDPNLFATDVDPATLRELSTSPQNPLISKPVSG
FT                   VYPPGSTFKAITAIAALEAGISPTTRFRCPGYYYYGGQRFRCWKREGHGSVDLVGSLQH
FT                   SCDVYYYNMGARLGIDQIADVAQRFGLGQTFDIGLQNEKSGIVPSTEWKRTRYRTNPAN
FT                   QTWFPGETLSVAIGQGATTATPLQLAVMSARIASGKRVMPRIVRGVATDSVPVQDFEDI
FT                   GVEASHLAAVRDGLDAVVNRWGTAARSRLLPDYRMAGKTGTSQVRSLRINPQTGQPFSN
FT                   YQLPWNERDHALFIAFAPVESPRYAISVVVEHGGSGSRSAAPRARDLMRAVLDKDPGNP
FT                   SKHDLYEPGAVIQRRMAGLRET"
FT   gene            complement(105881..106399)
FT                   /locus_tag="PB2503_01012"
FT   CDS_pept        complement(105881..106399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01012"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08283"
FT                   /db_xref="GOA:E0TB79"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB79"
FT                   /protein_id="ADM08283.1"
FT                   /translation="MGDERGLLSRLLTAAAPGLILFSAVLLMITPLKVFGHSVPLPLAP
FT                   FIVIFLYAAYAPNALPAPITFAAGLLQDLLFASPLGLWATVFLSLHYAVLAQHDYLKGR
FT                   LHRVIAVLFAMLVAAVGAILWGLSSLVFAEVLPVRPLAVQLLVTILMYPACAYVFLTVR
FT                   RSERGPSPA"
FT   gene            complement(106392..107297)
FT                   /locus_tag="PB2503_01017"
FT   CDS_pept        complement(106392..107297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01017"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01017"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08284"
FT                   /db_xref="GOA:E0TB80"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB80"
FT                   /protein_id="ADM08284.1"
FT                   /translation="MTVYTELRREGAGVRGRPKRYGIVFLLALSATMTLSSFFGAQASV
FT                   FERARETVLDIAEPVVSIFGAPSRWLSSRIGNIEDYFRIYAENKRLREENAELRVWMEE
FT                   SRTLRRQLAYYESLLDTKLPTPATFVDASVIGESQGPFDRSLILSAGRNDGVKLGLAVV
FT                   DDGGMVGHVVSAGRSAARVLLLTDQQSRLPVFIEEVEVQAILAGRSAGDPVLDVFADAD
FT                   IERVPPGSRVVTSGADGMLPRGLPVGVVTAGRDGKGRPRVELFGNFTTPDLVRVVDYAF
FT                   PSDVELEEILSGRPPEADDG"
FT   gene            complement(107386..108423)
FT                   /locus_tag="PB2503_01022"
FT   CDS_pept        complement(107386..108423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01022"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01022"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08285"
FT                   /db_xref="GOA:E0TB81"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB81"
FT                   /protein_id="ADM08285.1"
FT                   /translation="MLSSFFGLLSADMAIDLGTANTLVYVKGRGVVLNEPSVVAIEHRN
FT                   GRKIVRAVGNEAKEMLGRTPGAIEAIRPMRDGVIADFEVAEAMISHFIRKVHNRRAFAS
FT                   PRIVICVPSGATAVERRAIMESALSAGARRVDLIEEPMAAAYGANLPVSEATGSMVVDI
FT                   GGGTTEVAVLSLDGIVYSRSVRVGGDTMDEAIVSYVRREYNLLIGEASAERIKVEIGSA
FT                   RADKESDGKSIQIKGRDLMHGVPKEVRVTASQVADALKEPVGQILEAVKVALEATPPEL
FT                   AADIVDTGIMLTGGGALLKNLDAVLREETGLPVSIAEDPLSCVALGTGKVLEENKRQSI
FT                   FASAG"
FT   gene            complement(108549..109337)
FT                   /locus_tag="PB2503_01027"
FT   CDS_pept        complement(108549..109337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01027"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01027"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08286"
FT                   /db_xref="GOA:E0TB82"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB82"
FT                   /protein_id="ADM08286.1"
FT                   /translation="MGGFVLSVVFFPGGPMVTLFQKLAHFFNNMDARALSSLLVTLLLI
FT                   AIIAVLIVFGADWLGIDQSSLNQIMNRVAASPFALIGVIAVFSALALVGFPQTLLIAGT
FT                   VAVFGPVTGALNSWIATMCSATLTFVLGLVFGGRFVRKLSAGRAATMIEVVRQHGLLAS
FT                   MFIRVTPSAPFIVINAICGAAHIAIWKFWLGTGIGIAPKILFLSVFTEQVDELLGFFQS
FT                   RDPRDLLTIGLLLLAWLGFLLVVRVIFRRLRQSTLQGLDG"
FT   gene            complement(109406..112672)
FT                   /locus_tag="PB2503_01032"
FT   CDS_pept        complement(109406..112672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01032"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08287"
FT                   /db_xref="GOA:E0TB83"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB83"
FT                   /protein_id="ADM08287.1"
FT                   /translation="MGQRLTHHFCRLGRSLALIFGGVVGLVILTAKTLSGDGVSLAPFE
FT                   GPIRGALSAAMPESDLAFEALRLIHDEDAVTLLSLKAERLDFTTGTGTRLSVPNATIAL
FT                   DVRALIGGQVAISDLIVDGGQVSLGGERAGPSLNLVEALGRVMTLWDRLGGHFDRALFR
FT                   DFRVDYGTAEAGLAGTLSGDLRLSVDGRSPALSMDIPFEGGGAARLRADLLGPDGYGSV
FT                   RLELDRVVANEAIEQLIGRDLPVAVSGTLNGEIDASLPRPGQPATTHIDLRLHDGTLTA
FT                   QDRQFPFDEIGLVGVATPGERRMEILDLRVVSPLGQGRFAGSLTPLEGGAAHRFALSAP
FT                   KVDITADAYLEGPLALEAVRLMGTYDWTDRLLSVTTLKAGVLGSVLTGNVEVSLPQDAP
FT                   LRVAAEAGIPGPLSPQDILRAWPLPAADGVRRWAQANILAGTVTDIAMTAAYPPTPDQA
FT                   VVDLSFRTDDTTVRHVPTMSPITDLSGRFRIHDNRLLFEAFSGRLGAARVTGGSVDIPQ
FT                   LIPREAPATFAVQIEGSLRDVLSEVDKAPQRFLTTAGYVPRNFGGQTRFDLEIVRPMKV
FT                   FVPIEDYRFSGSGVFSDLSYPDIFAGVRVSGGEGTVTLAPEGLTIAGDVETDGMPTQFR
FT                   WHRGFAAGSLRTLDASMRLSASAGESFGLALRRFVRGEVITRIEGYGQHTAFDHLTIGA
FT                   DLKRATLLWPDGTIFKAAGEGGTIDLSVARGPEDAGSRALSIEDFSLKTPGAIAEGQLR
FT                   MGPTGGLDDLKLTRLWIAGAADLALRAERIEDGLVIEAEGRYVDATPLIGRRLSGRPRR
FT                   TIGLPGKVSLDLNVDKVDLKAGTALHDLTVSGLFDGERVERLIADGRLGEGTFASRLAP
FT                   AGEGQDAKLMVETSDFGQLLRGLFGIESVWGAAAAFEATLPAEGGLYGEFRTGDLILRR
FT                   APTVARLLSIASLDGLENILNGEGIAFDGLVGQLSLAEGMLSLSETRMTGSSLGLTAGG
FT                   QVDFREEEVALFGSVVPAYPVNSLAGKIPGIGDLFISREGEGMFAIAYRVTGEFDEVRI
FT                   DVNSAAALTPGILRRLFEPFGGANSREPDPALSTSRQETE"
FT   gene            112649..113320
FT                   /locus_tag="PB2503_01037"
FT   CDS_pept        112649..113320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01037"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01037"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08288"
FT                   /db_xref="GOA:E0TB84"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB84"
FT                   /protein_id="ADM08288.1"
FT                   /translation="MMSEALAHSDVVILSGPPRYSIVVIFSLLGWRITTAQALRRITNA
FT                   MVVAKHPRATGMVMPSPPRKWRIIMVEIGNAAPSFELPSENGNVSLSDFKGKWLVLYFY
FT                   PKDDTSGCTKEAIGFSEQLDAFREAGAEVLGVSKDSVAKHQKFREKHDLTVPLASDEGG
FT                   DIIDLYGVWVEKSMYGKTYMGIERATFLIDPEGVVREIWRKVRVPGHVDKVLKALTDHA
FT                   G"
FT   gene            113310..114152
FT                   /locus_tag="PB2503_01042"
FT   CDS_pept        113310..114152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01042"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08289"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB85"
FT                   /protein_id="ADM08289.1"
FT                   /translation="MQDERRRRLAAVLLTSDPLLKVERALAGVETTDIDGQAEGRDSDP
FT                   ADLDPWPLPARRARPPLLDPADMPKRGSGSDRGRAALLHAIAHIEINAIDLAADMAGRF
FT                   TPTLPAADRQAFLDDWTAVMMDEARHFRLLTERLVAYGVSYGDLPAHSGLFDAALRTRD
FT                   DVAARLAVAPLVLEARGLDVTPAMINRLRRAGDTESARVLEEIYEDEIGHVAAGVRWFE
FT                   RVCAHRGLAPATAFRDLVAAYYGPGLKKPFNQEGRRRSGFPVTWYDAPELQKSFTTSS"
FT   gene            114360..115709
FT                   /locus_tag="PB2503_01047"
FT   CDS_pept        114360..115709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01047"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08290"
FT                   /db_xref="GOA:E0TB86"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB86"
FT                   /protein_id="ADM08290.1"
FT                   /translation="MGRKIGRFFRERQIYHRSEGVVRFIKLSARTQIAMATILGTALLW
FT                   VAYASVNVVFKEQIIVAKDQERRDQEAAYRRRLQTAEGAYEEIQALNYAYEREFDAAIT
FT                   GLTREYEALRSLVENKAAVDRRFQALAENLSAAGAPGGTRRQSTNRLMIDPVGREPTPR
FT                   QSRISALREEALNSVQGNRVAAGIDDAVLQRVRQDSAALSARQVVLMASLEEDMRRAIR
FT                   ERQRILGHTGVDLSPMVSSVRQSTADAQYSAVAPAPTDDGSFIGQGGPFIPADLGSDAS
FT                   PTDPTAYFRSAARVHDTFTELVTLNEALSAVPLSQPLKVPHRMTSRFGIRWDPMRRNVR
FT                   AAHKGLDFAAPRNSPLLATAPGKVTFAGWRSGFGRTVEIDHGNGFKTRFAHMNRIKVKA
FT                   GDVVELHDVVGLMGSTGRSTGTHLHYEIHYRGRQVDPLKFIEAGRYVFES"
FT   gene            115693..116364
FT                   /locus_tag="PB2503_01052"
FT   CDS_pept        115693..116364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01052"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08291"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB87"
FT                   /protein_id="ADM08291.1"
FT                   /translation="MFSRVKSQRRAQEPSSLPDEVPDPSQPSRKASAKPKTQRTNRGPS
FT                   VPSIISGDMAIRGVIESTGEVQYDGQLEGDIHAKTLIVGDGASVEGEITAEKVRISGTV
FT                   KGAIKAIEVEMANTAIVTGDITHKSLMIESGARFEGKCQYSDEPLGTVTPQLALSSPPA
FT                   DNAQPTEAGGTRPSLAAPDTNRLESAAPPRRRPTPLTSGTTTQGSQRQFVKRPTNAATL
FT                   R"
FT   gene            complement(116472..117347)
FT                   /locus_tag="PB2503_01057"
FT   CDS_pept        complement(116472..117347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01057"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08292"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB88"
FT                   /protein_id="ADM08292.1"
FT                   /translation="MRKEAVIILAMGLVATIGLRVALQGGTDRADHRTPRGGDAEAREE
FT                   GGVFSPYKENGGEIFVVDLKADLPAAKAGAVGETEVEVTLCLPDTLPGGACASRSSLLS
FT                   SPPEPTDMLTADGQRRPVTASLVHPTDYEAPVRMVRTCEQFAELWAEGWGGLTTADRAD
FT                   EARFLRYCGLRRLAALAQPAERSRFDGTPLGALLEDVPEADWPTLPDERAMRPAITALE
FT                   GTPPRWSAQSAALDMRITDIGHADFDDDGDGEHLLFLAGRMRGGTLGFSTFALLENTAD
FT                   GGRLRRIDFR"
FT   gene            complement(117443..117865)
FT                   /locus_tag="PB2503_01062"
FT   CDS_pept        complement(117443..117865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01062"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08293"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB89"
FT                   /protein_id="ADM08293.1"
FT                   /translation="MTLHLMKLAVGIDDLEALSIRQRQLRRHGGRPNPFHITRMMPRRA
FT                   SEILSGGSLYWVIKGHFACRQGIVGIERVTLDDGRAACRLDLDPTLIPVRALARRPFQG
FT                   WRYLAGEDAPKDMSSDDQGARLPAELRVSLSDLGLL"
FT   gene            complement(117862..118896)
FT                   /locus_tag="PB2503_01067"
FT   CDS_pept        complement(117862..118896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01067"
FT                   /product="lysozyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01067"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08294"
FT                   /db_xref="GOA:E0TB90"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB90"
FT                   /protein_id="ADM08294.1"
FT                   /translation="MLDISDLRGVQGEFSTMKTGQTGLNLIKAYEGLRLTAQAEPALPD
FT                   GERLWSVGYGHRKTAAQGMTVTEKEAARLLADDIGPIEGLIQSTVRCPLNQNEHDALVS
FT                   LIFNIGEENFRRSTVLAKLNDGDKLAAADAIERWSRARVDGRLVKLDGLVRRRAAEKSL
FT                   FLMPTDAELVVPTSEISPAAECDGAIREAAEVTNAPLFDFDAFRRSRDKNLTPEEREMR
FT                   LQALFHAQQALTGDPSKMIISKAEEREDIGVTIGAAVAGLMILFVIGLSGVLLIDQSWP
FT                   GLLTPLGLDAAMMDRVHAELPLWLMGAGGVAFYFIAYVIAKRASRHSMKRRRAVEVARV
FT                   YGRS"
FT   gene            119056..119784
FT                   /locus_tag="PB2503_01072"
FT   CDS_pept        119056..119784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01072"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08295"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB91"
FT                   /protein_id="ADM08295.1"
FT                   /translation="MRNNVLRSLALLAIGGLGALAGYGVVQMTDETAPIADETAAADMT
FT                   AENTATTDESPTETQDLSQLGATLPGEDEASAVDVAAADSSSTEATAADGQASAEGDTS
FT                   SPEEGETPTNSFTKNPVRLAKRDDGTYYSANPVRLAKRDDGRYYTEASPTKVFDPCTKA
FT                   DGTPYVGPGTAVNAFAPVNPCLPQATQVAFAGQPTPVVPPTATAIDISYLDPSFGGPLI
FT                   PGGFGPEPPAGDPGSDYSAL"
FT   gene            complement(119798..120805)
FT                   /locus_tag="PB2503_01077"
FT   CDS_pept        complement(119798..120805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01077"
FT                   /product="NifR3/Smm1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01077"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08296"
FT                   /db_xref="GOA:E0TB92"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB92"
FT                   /protein_id="ADM08296.1"
FT                   /translation="MSPKDGHHSHRFCVAPMIDWTDRYCRWVHRLLSAKARLYTEMVVD
FT                   EAILHGDRDRLLGFDSAEHPVALQIGGSDPRKLAEVAAIGAQAGYDEINLNVGCPSDRV
FT                   QSGRFGACLMAEPETVAEGVRAMAAAVPCEVTVKCRIGIDDQSPEEALPRFLDAVEAAG
FT                   VRTVIVHARKAWLEGLSPKENRTIPPLDYDLVVREAQRRPALSFILNGGLAGGAAAERW
FT                   LTTFPGVMLGRAAYEQPFLLSEVDQRLFGAPPAARSRLEIVEAVADRAAAEAVPIWRYA
FT                   RHMLGLYHGQPGAKTWRRQLSEEGRSAKACPAWLVDVAETVSAKAEAPDRAPVA"
FT   gene            complement(120802..121566)
FT                   /locus_tag="PB2503_01082"
FT   CDS_pept        complement(120802..121566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01082"
FT                   /product="acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01082"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08297"
FT                   /db_xref="GOA:E0TB93"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB93"
FT                   /protein_id="ADM08297.1"
FT                   /translation="MRILCSNDDGIHSPGLAALEDIARTLSDDVWTVAPEIDQSGMSRS
FT                   ITLTRPLRIRKEGDQRFAVDGTPTDCVQLAVGHLLDRRPDLVLSGVNNGHNLAEDVSFS
FT                   GTIAVALHGMTYKIPSVAFSQARMDRNKPRWDTARAWGPKVLKRLLDVGWPDDVVMNVN
FT                   FPNRGPEEVGGVAVCHQGRRANVELYAEERTDLRQRRYYWFGFQGTPEEPPAGTDLRAI
FT                   YDGLVAVTPLHLAFTHEPTMPALEKALDDLAE"
FT   gene            complement(121803..123080)
FT                   /locus_tag="PB2503_01092"
FT   CDS_pept        complement(121803..123080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01092"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01092"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08298"
FT                   /db_xref="GOA:E0TB94"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB94"
FT                   /protein_id="ADM08298.1"
FT                   /translation="MHDIRAIKDDPDGFDAAMSRRGVAIKAADLIALDERRVANTKAMN
FT                   EAQAAQKQASKAIGQAMGAGDQAKAEALKAEVAALKASVQEREADDRRLSDELRAALLP
FT                   IPNRLAPDVPDGESEDDNVEIRRWGTPPDIATPQDHVDLGEGLGQMDFETAAKISGSRF
FT                   ALLTGDLARLERALATFMLDLHRHEFGYIEVSPPVLVRDDALVGTGQLPKFEEDLFKTT
FT                   SGHYLTPTAEVPLTNLVRDSLLEEDSLPRRYTAYTPCFRSEAGSAGRDTRGMIRLHQFS
FT                   KVELVSITTPEEGHQEHERMTQAAETVLQRLDLPYRVVTLCAGDIGFGALKTYDLEVWL
FT                   PAQNTYREISSCSYVGDFQARRMNARFRREGEKKPLYVHTLNGSGLAVGRTLVAVLENY
FT                   QEADGAIRVPDALQPYIGQSRIERAS"
FT   gene            123164..124339
FT                   /locus_tag="PB2503_01097"
FT   CDS_pept        123164..124339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01097"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08299"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB95"
FT                   /protein_id="ADM08299.1"
FT                   /translation="MGPMADGSSPAPTIDLVPAMAEIDKGSWDALTQRADRPSYPFAKW
FT                   DFLEVLERSAAVRPETGWGPRHLVVKRGAEMVGVMPLYLKAHSRGEFVFDHGWADAYDR
FT                   AGGRYYPKFLAGIPFTPATGPRLHAATADAERLLIEGAAQATDQLGLSSLHITFPVPEE
FT                   VERLRAAGYLIRTGTQYRFEDEGFGDWDGFLSALASRKRKGLRKERAAIAEAGIEIEWI
FT                   TGSGITEDVLDHFWTFYQDTGARKWGTPYLTRSFFSMIAEVMADEILFVFAKRAGQAIA
FT                   GAMNFIGGDTLYGRYWGCTEHVPFLHFEVCYYQAIDFALQHGLRFVDAGAQGEHKIARG
FT                   YRPVTTYSAHYLPNPSFREAVERFLDAERREVQDAISYLSDFTPFKKTEGP"
FT   gene            124336..124746
FT                   /locus_tag="PB2503_01102"
FT   CDS_pept        124336..124746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01102"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08300"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB96"
FT                   /protein_id="ADM08300.1"
FT                   /translation="MKEIARFYDPEEALIAAGFLRAQGLSVHLADEATLAAQPHLRIGL
FT                   GGYRLLADQRDAHMARIALNTIAAASSSPDTPPAERSDGAPDRCPQCGGPLRRRRHRLL
FT                   PALLLLTGALFPFSRAGKELRCGTCGHKQQAP"
FT   gene            124756..125184
FT                   /locus_tag="PB2503_01107"
FT   CDS_pept        124756..125184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01107"
FT                   /product="Histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01107"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08301"
FT                   /db_xref="GOA:E0TB97"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB97"
FT                   /protein_id="ADM08301.1"
FT                   /translation="MDLSTPYDPENVFAKILRGDIPAAVIAETDDTLAFMDAFPQTKGH
FT                   SLVIPKSQATNLLEIGEAPLAALIAETQRIARAVHRALQPDGIRLMQFNGSAAGQSVFH
FT                   IHFHILPIWADQAPGPHGQGQADPETLSALAEDIRAAL"
FT   gene            125171..125881
FT                   /locus_tag="PB2503_01112"
FT   CDS_pept        125171..125881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01112"
FT                   /product="putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01112"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08302"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB98"
FT                   /protein_id="ADM08302.1"
FT                   /translation="MPPSDQLRLILVTGASRGIGRALTVALAAAGHHPIALARTQGALE
FT                   ALDDEITAAGGRVTMIPADLTDREAMARLPEALAARFGRLDGFVANAGSLGDLTPIADI
FT                   QEKMWDRTMALNVTANAFLLTGLDPLLRQSAAGRVVGITSSRARKFKPFWGPYSASKAA
FT                   FEAVFLTYAAETEESALRVNLVNPGPMRTAMREKAMPGEDPASLPPPAALAPLVLDLLS
FT                   PEEDRHGQLVTFSA"
FT   gene            complement(125925..126431)
FT                   /locus_tag="PB2503_01117"
FT   CDS_pept        complement(125925..126431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01117"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01117"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08303"
FT                   /db_xref="GOA:E0TB99"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TB99"
FT                   /protein_id="ADM08303.1"
FT                   /translation="MQAGLAFPNKDQDDLLDIHSCYLRLLTLIERLHRQLLEVIKDELE
FT                   RESLDDINAVQALLLYNIGDAELTAGELRTRGHYLGSNVSYNLKKLVDTGYISHKRSDA
FT                   DRRSVRVSLTDKGFEIREIIGGLFERHLNSVEKVGDVHAEMMDTTNTTLERLERFWADQ
FT                   IRFQL"
FT   gene            126541..127557
FT                   /locus_tag="PB2503_01122"
FT   CDS_pept        126541..127557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01122"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01122"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08304"
FT                   /db_xref="GOA:E0TBA0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA0"
FT                   /protein_id="ADM08304.1"
FT                   /translation="MPAYVFPGRFPSTRPRRLRSAPWIRDLVAETALRPQDLVLNLILR
FT                   DETAAAGPIPAMPGIARHTVDEVVTRAEIAWEAGIKALALFPFTGPDSRSPGGEAALDA
FT                   DNLMCRAARGIKASLPSIGLIADVALDPYTDHGHDGLLADGEILNDETVAVLCDQAALL
FT                   AQAGFDTLAPSDMMDGRVGAIRRRLDDDGYTDRLILSYAVKYASRFYGPYRDAIGSRGV
FT                   LLGDKATYQMDPRNADEALKEAALDCAEGADILMVKPGLPYLDRIAAVKATFGLPVAAF
FT                   QVSGEYAMLRCAADQGAFAFAPAALEALICLKRGGADMIFSYYADEAARWLSDGLPS"
FT   gene            complement(127569..128051)
FT                   /locus_tag="PB2503_01127"
FT   CDS_pept        complement(127569..128051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01127"
FT                   /product="putative oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01127"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08305"
FT                   /db_xref="GOA:E0TBA1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA1"
FT                   /protein_id="ADM08305.1"
FT                   /translation="MNDPFLDLKAAFSRYPTGVTVVSCLPAKGGPVAITVNSFTSVSLD
FT                   PSLVLWCIERRASVFEAFAESEAYAVSVLAADQQSISNQFATPGRHSFPAETGEVAITG
FT                   CPLVRGRVAGFDTKIVTRHEAGDHVILIGEVVHFDSREGAPLVYAGRHYFSGPVIS"
FT   gene            128185..130035
FT                   /locus_tag="PB2503_01132"
FT   CDS_pept        128185..130035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01132"
FT                   /product="trkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01132"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08306"
FT                   /db_xref="GOA:E0TBA2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA2"
FT                   /protein_id="ADM08306.1"
FT                   /translation="MEGLVVTWQMWVVFGTIFAAIVAYSSDRVSLEVVSGWVIAGLLVF
FT                   FHFFPVYGPDEANRLSSESLLSGFASPALFAILGLLIVGQGMYQSGALELPTRMLLRLF
FT                   DRAPKLAVSSMFMFVITVSAFLNNTPVVVMFVPIISAMAVQSKIAPSRLMMPLSFVSIL
FT                   GGMLTTIGSSTNLLAVEIFEQETGEAIGLFALAPLGLVLAVVGLGYLAIATRYFLPNRL
FT                   GEIQATADGRQFLAQITLERGSPLIGETAAAGQFPSLKDVTVRLVQRGDDLILPPFDDT
FT                   TLRLRDKVVIAATRETLTKLLKSNVGLRASFLSEVSPPEGGTGELSLIEAVVAPGSRII
FT                   GRSINQIRFRFQTNCVILGIQRRSRMMRGDIQDIRLDAGDVLLILGDRQDIRRLRSDRD
FT                   ILMLEQSMTQLPDPDHARFAGLIFVGVVGTVAFGLLPIAIAATVGAAAMVATGCLNVRQ
FT                   ASRAVDRRVFLLVGAAIAMGTALQATGGAIYISQLLEPLSQRPNGAVVLLSAFFLLTAL
FT                   LTNVLSNNATAVLMTPIAVSAAQAAGIPPMPLVLTVIYAANCSFATPVAYQTNLLVMAP
FT                   GNYRFRDFIVIGTPLILLLWLVFTFVAPSYFRAVGLLPVG"
FT   gene            130072..130806
FT                   /locus_tag="PB2503_01137"
FT   CDS_pept        130072..130806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01137"
FT                   /product="arginyl-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01137"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08307"
FT                   /db_xref="GOA:E0TBA3"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA3"
FT                   /protein_id="ADM08307.1"
FT                   /translation="MTKPFQSESKEFFLTSPTPCPYLPGRQERKIFTFLGGKDAEIVNA
FT                   DLSERGFRRSQNIAYLPACDRCRACRSVRVPVADFSSRRWKRLIGRNRDLVRTVLPAKT
FT                   TAEQFGVLRSYLDARHAEGGMADMTALDYAAMVEQTPVSTEVVEYREGGELIACSLRDR
FT                   FEGALSMVYSFFDPAASKRSPGTFMILDHIIEAAETGLDYVYLGYWIEGSRKMDYKRRF
FT                   TPLEALTSTGWQTLPRLPRNRP"
FT   gene            complement(130819..131814)
FT                   /locus_tag="PB2503_01142"
FT   CDS_pept        complement(130819..131814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01142"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01142"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08308"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA4"
FT                   /protein_id="ADM08308.1"
FT                   /translation="MFGGARDGAQMLAYSLGEYEAIEEDLTMAISFDGRVAIVTGAGAG
FT                   LGRSHALDLARRGAKVVVNDFGGAVDGSGGSSGPAEAVVAEIAAAGGEAIAHGADVTNA
FT                   DQVAHMVETAMEKWGRIDILINNAGILRDASFHKGSIEDFEKVVDVHLMGAVICSKAVW
FT                   PIMRDQAYGRVLVTTSSSGVYGNFGQSNYGAAKMGLVGLMNVLVIEGKKYDIRVNALCP
FT                   AAATRMTEGLLPPGADALLTPDSVTPAAVYLVSEDSPNRTILNATAGGYSVTYIEETRG
FT                   IALPTSQQNAEAIAENWEKITDETGAERLVEGNQQTMKFAVMAQKVAQSD"
FT   gene            complement(131889..133202)
FT                   /locus_tag="PB2503_01147"
FT   CDS_pept        complement(131889..133202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01147"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01147"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08309"
FT                   /db_xref="GOA:E0TBA5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA5"
FT                   /protein_id="ADM08309.1"
FT                   /translation="MSKVGNKGGSGAGPTGTTGGGDGKNTLYCSFCGKSQHEVRKLIAG
FT                   PTVFICDECVELCMDIIREESKTSLVKSGEGVPSPQHIHSVLDDYVIGQAYAKRVLSVA
FT                   VHNHFKRLNHAQKNSDVELAKSNILLVGPTGSGKTLLAQTLARILDVPFTMADATTLTE
FT                   AGYVGEDVENIVLKLLQSADYNVERAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQ
FT                   ALLKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFIVGGAFAGLDKVIQSRGDGASIG
FT                   FNAEVKELEDRRIGDVLREVEPEDLLKFGLIPEFIGRLPVIATLEDLDEEALVQILTSP
FT                   KNALVKQYQRLFEMEDVKLTFKPEALVAVAKKAITRKTGARGLRSIMEGILLDTMFDLP
FT                   TLENVEEVVINAEVVEGKGDPLYVYGEKDSQVAAKSSA"
FT   gene            complement(133399..134031)
FT                   /locus_tag="PB2503_01152"
FT   CDS_pept        complement(133399..134031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01152"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01152"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08310"
FT                   /db_xref="GOA:E0TBA6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA6"
FT                   /protein_id="ADM08310.1"
FT                   /translation="MRDPHDIYMNTLVPMVIEQTSRGERSFDIYSRLLKERIIFLSGQV
FT                   HDQVSTLIVAQLLFLEADNPKKDIAFYINSPGGSVTAGLAMYDTMRYIRPQISTMCVGL
FT                   AASMGSLLLTAGDKGMRFSLPNSRIMVHQPSAGFQGQASDIERHARDIIQTKKRLNEIY
FT                   VEHTGQDYETIERTLDRDTFMTPEDALDFGLIDQVLEKRAVASGDEG"
FT   gene            complement(134253..134831)
FT                   /locus_tag="PB2503_01157"
FT   CDS_pept        complement(134253..134831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01157"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08311"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA7"
FT                   /protein_id="ADM08311.1"
FT                   /translation="MAQPNTEPSMDEILASIRRIIAEDDQPSIEKQAQLETLQLAEEDA
FT                   VEGADRPMAEAKESTEALEADGPAAAAEEELPAEATAEVVSDPLDDYDHHEPPAPSPSA
FT                   QEESVSMTAAAAPALQDQLVGAEASEAAADAFGALEENVRLTNQGARTIEDLVETMLQP
FT                   MVRQWLDTHLPRIVEEKVEEEVRRIARRR"
FT   gene            complement(134919..135578)
FT                   /locus_tag="PB2503_01162"
FT   CDS_pept        complement(134919..135578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01162"
FT                   /product="protein-L-isoaspartate O-methyltransferase,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01162"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08312"
FT                   /db_xref="GOA:E0TBA8"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA8"
FT                   /protein_id="ADM08312.1"
FT                   /translation="MMDTIEARKHMVDSQVRPNDVTDPALVRAMSTVPREAFVPTNRRS
FT                   LAYVEKDVPLFDGRWLLKARDFSKLVHGATIQPGDLVLDIGCGYGYSSAVISFLAGVVV
FT                   GLEADDRPIERATETCRTHGYDTVAFVQGTLAEGCPKQGPYDVIVIEGGIETLPDTLFA
FT                   QLKPNGGRLVAIMCEDGVGHATLWTRHGEKRGHRILFEAYPAGILPGFEKERAFVF"
FT   gene            135797..135870
FT                   /locus_tag="PB2503_t07274"
FT   tRNA            135797..135870
FT                   /locus_tag="PB2503_t07274"
FT                   /product="tRNA-Cys"
FT   gene            136181..137716
FT                   /locus_tag="PB2503_01167"
FT   CDS_pept        136181..137716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01167"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01167"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08313"
FT                   /db_xref="GOA:E0TBA9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBA9"
FT                   /protein_id="ADM08313.1"
FT                   /translation="MVSGAGERCRFGAVWPGTAALLMSVAACATVPAEQALDGISTPPS
FT                   WTALTDDAPAQAVTENWLADLGDARADAVVAEALARNKDLENSASQVGAILANARVTRA
FT                   SLLPQAQFGFTASSVRTPAGDPQFNPETGEFEGGGEASSSDSYRLSTSLSWELDVWGRL
FT                   TDQTRAAYLDVEAARLDFAAAQLSLAGAAVQGLYGLTAATLQRQLSERDVETGENNLRV
FT                   IERRYERGISTSLDVRLARSSLAQSRANLAQRRQTEIAAARRLETLLGRYPAGQMQGLG
FT                   TLPGLPTILDEDGAITGVGEPGWLLVRRPDILAAEADIEASGLRVAAARKAFLPSLSLS
FT                   ASAQSLVADSYDDVSYDPDDLIANLVGNLVQPLFQGGRLRANEKAREFQLKSSLAQYGQ
FT                   TVLSAYEEVENALTAEHLLSTQYTAQALALEEAKAAEALTVRQYLAGTATIFDLINAQQ
FT                   RAISSESQFITAAEARLSNRIDLYLALGAPFHPQTDPDLIAFDQPIGSSKEGS"
FT   gene            137716..138981
FT                   /locus_tag="PB2503_01172"
FT   CDS_pept        137716..138981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01172"
FT                   /product="possible putitive HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01172"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08314"
FT                   /db_xref="GOA:E0TBB0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB0"
FT                   /protein_id="ADM08314.1"
FT                   /translation="MIRKITVIFGNLAAVLVVVAIFAVILGFLKAGQPKAERQAPTAFD
FT                   PTVFVEEVAFGEAKLNVAAQGEVTPRQDISLVTQVSGKILSVSPDFAPGGAVTAGQELV
FT                   KIEDSDYRLAVSRAQAEVAQARTELEIERAESALAQQDYQDLLGDTGSGPSDLTLRRPQ
FT                   LARAEANYQAALANLEEARLNIKRTTVTAPFSGRIRSIAANTGQFVNAGASLGQIFSTE
FT                   IAEIRLPLSDSDLAKLGISLAFDSDDDRPKVTLSTIVGGRLHRWEGQIVRVDAAIDPTT
FT                   RQVAAIAQVPDPYGRSADGGTPLAIGLFVDALIEGPRVERAVTLPRVAIQEENTVYVLD
FT                   EDNVLTAQPVDIAAFTDQGAIITGGLSEGQRVVVSRAAVPAGTTVRPLMRGRDTAALGS
FT                   LSGSSEGELASVPGTSGGRGAP"
FT   gene            138978..142157
FT                   /locus_tag="PB2503_01177"
FT   CDS_pept        138978..142157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01177"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01177"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08315"
FT                   /db_xref="GOA:E0TBB1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB1"
FT                   /protein_id="ADM08315.1"
FT                   /translation="MNGFVAWWARNSVAANLLMVLILVAGMATFLFQIEREVFPTASLD
FT                   QVNVSVSWPGASPRDVEEQIVLRIEEAVSGLDNVKEISAQAREGSAQVTVEMEDGADYD
FT                   SFLNLVKARVDGVSNLPPSSFPPVVSRPTADTPITFVSVTGDPAQISEVELNRLARRYR
FT                   DELAQIPFSSPLIEVQGYQEEEVAVEITESALRRYGLTFDEVAAAIGSTSVNRSMGEIR
FT                   TTTGNIPIATRQLADTADEFEALVIRRNQDGSVVRVGDVATVTDGFAERNSIFRIDGKP
FT                   ARLIEVLQPETVNIVNTSRAISDWIDEKQSSLPPGVELKEQYTLAELYFGRMKLVSENA
FT                   VAGLILVLIILFLFLRPTVAIWVSAGIGISFIGTFIFLPMVDVSLNMLSLFAMLLVIGI
FT                   VVDDALVVGESIHRQTEIGKQGLDAAVLGTQIVLKPVVFAVLTTMIAFSPFLLIGGVWG
FT                   DFTKHIAWTIILALTFSLIESFLILPAHLAHLSKPKSGGLLSFQGKIADALVTFGDMIY
FT                   RPVLQLALASRYVTVAIFLGLFAVSVALLQLGYVKFQFQPDVEQRLIMLTVDMQSATPM
FT                   SRTEQVLEQVETAIEQLDQELLDRNGQDTVLSATVAAWPGWINVTLIMSPSDARDQTLG
FT                   TISERLRTLIGPVPDSEDISLSTNFANDGGDRFIVGLQSADIDELSAAVTEVKAFIGQF
FT                   GELYDVGDSLQSAQDELVFELKPGAERFGLSIGEVSRQVRQAFYGEEAQRLPRNGQDVR
FT                   VMVRYPLETRENFESLSSMRIRLADGREIPLSAVADYRYGPAVRRIDRVDRERSVRVWS
FT                   RVREGADAGPIRADFYSTFVPQLLAKYPSVEIKRRGNDEEQREFQQNVTVLYGLALFCM
FT                   YMLLAIAFSSYFQPLMIMSAIPFGFMGALFGHLLLGENFAMFSIFGICAAGGVVVNDNL
FT                   VLVDYVNRLRREGVGAAAALVEAGVVRFRPILLTSVTTFVGLVPILLEDSYDAKFLRPM
FT                   VIALAFGVLFALFVTLIFVPALYAVGVDIARFYRGLWTGEDQPRLGHEGGLSGPTPHHP
FT                   EIDDDRLHPAE"
FT   gene            142348..142422
FT                   /locus_tag="PB2503_t07276"
FT   tRNA            142348..142422
FT                   /locus_tag="PB2503_t07276"
FT                   /product="tRNA-Trp"
FT   gene            142793..144217
FT                   /locus_tag="PB2503_01182"
FT   CDS_pept        142793..144217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01182"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01182"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08316"
FT                   /db_xref="GOA:E0TBB2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB2"
FT                   /protein_id="ADM08316.1"
FT                   /translation="MLELAVSKSEVSVSERLDTILEKQQAACRRQRVLSADQRRDAIAR
FT                   VKKIVTHHKDALIEAVNRDFGHRSRMETELCELMLVATAADHARSHVKKWMKPRRRGVN
FT                   LTSLPGSAWVQHEPLGVLGIISPWNYPLLLTLSPLIDALAAGNRVMIKPSELTPQTSAL
FT                   MAQLIETYFDEEEVAVVTGGIDIGAYFSTMPFDHLLFTGSTSIGRRIALAAAENLTPTT
FT                   LELGGKSPAIVCDDYSMDKAVRSIALGKFINAGQTCIAPDYVLVPKGTGTAFAEALIAE
FT                   VKRGIPDLASETYTGIVNERHLERLEQIVTEAARLGGKVLTAGQAPVGKMSPTVILNPP
FT                   NGVAILEEEIFGPVLPIVEYSDLDDALRFINDRTHPLALYVFTKNKSREKQVLSGAISG
FT                   GVSVNSTLLHLVQHNLPFGGVGHSGSGAYHGEDGFKRFSHARSVFKVGPLNSFEMLGPP
FT                   FGRLAKLTTNFFLRKS"
FT   gene            complement(144338..145003)
FT                   /locus_tag="PB2503_01187"
FT   CDS_pept        complement(144338..145003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01187"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01187"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08317"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB3"
FT                   /protein_id="ADM08317.1"
FT                   /translation="MLEGKSVVITGAGGALGRAAVKAVEANGGWPFLVDRTLTELSDRE
FT                   RMAELDVTDDAAVAALAARVETVDAVFAIAGGFDMGERLSDPASDRWDAMMRANVDTCR
FT                   VVMRHFLPRLRERGGAFVTVGAYAALSGQAEMGAYIAAKSVVMRMTETAAAEERLHGVN
FT                   VNAVLPTIIDTPGNRAAMPDADWGKWVSPDRLARTMCFLASEAAADIHGALLPVRALS"
FT   gene            complement(145040..146080)
FT                   /locus_tag="PB2503_01192"
FT   CDS_pept        complement(145040..146080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01192"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08318"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB4"
FT                   /protein_id="ADM08318.1"
FT                   /translation="MIFDPLILGGRTGTPSVATAGSMIRIGQTLFLAPALGAFVDRLVL
FT                   SPGGDRFHRHKRYDLSTVFSFPSVTGKGVRLAGLSIADGYLWVCATQSLRRPSGEDGDT
FT                   PLTDLHWCADEAFFGRVPLLEREKGVFEVVGAVAPFGFPLRQAASIPMEEGRDVIRQRL
FT                   ASHPLLTPFAGLPEGDNGLAVGGVMMEPSSSSVIFALKGPVIDGKAILVRWPIAEKAEG
FT                   RLKFPKEGERHPDILTCDLGGGGIHAMSFLRDRLYFLSGPVVSGPLGRDIWSCRWSPTA
FT                   NAPSPTDFRHHHSLADHGGPRRACGLAAEMPLPDRIRLLISYGATLPLADNAHEISVEA
FT                   VELPLP"
FT   gene            complement(146119..146442)
FT                   /locus_tag="PB2503_01197"
FT   CDS_pept        complement(146119..146442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01197"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08319"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB5"
FT                   /protein_id="ADM08319.1"
FT                   /translation="MIVATTEGVAGREVTEVKGVVAGEAILGVNIFRDLFAGLRDIIGG
FT                   RSGGYQKALREARDHAMADMVEEALQLGADAVVGIDIDYEAVDTNKGSMLMVSCNGTAV
FT                   SLR"
FT   gene            complement(146456..146971)
FT                   /locus_tag="PB2503_01202"
FT   CDS_pept        complement(146456..146971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01202"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08320"
FT                   /db_xref="GOA:E0TBB6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB6"
FT                   /protein_id="ADM08320.1"
FT                   /translation="MLLHPGRKAPSLDIPTLKGDHWSLDRRTPDAMTIILVYRGLHCPA
FT                   CKEQLEKLNKMIGRFADLGAEIFALSMDSRERAQQTAEEWAIDDVPLGYGLSAERATDW
FT                   GLFLSTAIKEEEPAIFAEPGIFMIKPDGTLFAAYLQSVPFARPTLDDLLSGLEFVIDND
FT                   YPARGIER"
FT   gene            complement(147281..149944)
FT                   /locus_tag="PB2503_01207"
FT   CDS_pept        complement(147281..149944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01207"
FT                   /product="endopeptidase Clp: ATP-binding subunit B, clpB"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01207"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08321"
FT                   /db_xref="GOA:E0TBB7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB7"
FT                   /protein_id="ADM08321.1"
FT                   /translation="MNFDKYTDRAKGLVQAAQTIAIRENHQQITPFHVLKALLDDSEGL
FT                   AANLMRRAGGDPDLALTAVDQALAKLPTVQGANAQVYMAQPTARIFTQAEDIAKKAGDS
FT                   YVTAERLLVALALEGETAATLKKAGLSPQSLNTAINEIRKGRTADNANAEQGYDALKRY
FT                   ARDLTDAAREGKLDPIIGRDEEIRRAMQILSRRTKNNPVLIGEPGVGKTAIAEGLALRI
FT                   VNGDVPESLKDKRLLALDLGSLIAGAKYRGEFEERLKAVLSETTSAEGQIILFIDEMHT
FT                   LVGAGKTDGAMDASNLLKPALARGELHCIGATTLDEYRKYVEKDAALARRFQAVFVSEP
FT                   TVADTISILRGLKEKYELHHGVRIADSAIVSAATLSNRYITDRFLPDKAIDLVDEAASR
FT                   LRMAVDSKPEELDALDRQIIQMKIEREALLKEDDTASKDRLTDLEKGLAALEERSAELT
FT                   AAWQAEKEALASTTSVKEELDRARQDLVDAERRGDLAKASELKYGQIPALERRLEEAEG
FT                   RQDADGVNSGLVQEVVDSETIAQVVSKWTGIPVDKMLEGERDKLLRMEEVLHSRVIGQE
FT                   EAVTAVSAAVRRARAGLQDPNRPLGSFLFLGPTGVGKTELTKALAAFLFDDDQAIARID
FT                   MSEFMEKHAVSRLIGAPPGYVGYEEGGVLTEAVRRRPYQVILFDEVEKAHPDVFNILLQ
FT                   VLDDGRLTDGQGRVVDFKNTIIILTSNLGAEYMTGLAEGQTVETVREQVMAAVRSAFRP
FT                   EFLNRLDEIILFSRLERDQMGGIVDIQIARLQSLLDDRKIVIEIDDAARQWLAQSGYDP
FT                   AFGARPLKRVIQKAVQDPLAERLLAGRISDGATLHLSADDTGLILDGEHLTSRKAFSLG
FT                   TVPTSDAGSPPTHMLN"
FT   gene            150141..150287
FT                   /locus_tag="PB2503_01212"
FT   CDS_pept        150141..150287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01212"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08322"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB8"
FT                   /protein_id="ADM08322.1"
FT                   /translation="MPLEFAFIAGTVILALGLAYGVARTRARTEDEIALTEQATKDLYK
FT                   RRS"
FT   gene            150371..151870
FT                   /locus_tag="PB2503_01217"
FT   CDS_pept        150371..151870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01217"
FT                   /product="putative phosphoglucomutase phosphomannomutase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01217"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08323"
FT                   /db_xref="GOA:E0TBB9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBB9"
FT                   /protein_id="ADM08323.1"
FT                   /translation="MQDLMLPKPLADLAPNTFEYETLPKVKATGFREYDARWLFEKEIN
FT                   LLGIQSLGAGLGTLIHELGKRPDIVVGHDFRSYSASIKQALIVGLMGAGVRVHDIGLAV
FT                   SPMAYFAQFDLDVPCVAMVTASHNENGWTGVKMGVDAPLTFGPDEMGRLKEIVLSGQTK
FT                   AREGGGYRYVEGVRERYIADLVKDVKIARPLKVIAACGNGTAGAFAPEALSRLGVEVIP
FT                   MDDELDHTFPKYNPNPEDMKMLHAMRDAVLTHKADLALGFDGDGDRCGVVDNRGEEIFA
FT                   DKIGVMLARDLSSRHDNAVFVVDVKSTGLFTADPVLQKQGATTHYWKTGHSYIKRHTTD
FT                   LNAMAGFEKSGHFFFREPYGRGYDDGLVAAIAILKMLDNNPEKSLAELREDLPTTYQSP
FT                   TMSPHCDDDKKYGIVEKIVTHFEGQKELIGQKVSDVNTVNGVRVTVEDGTWGLVRASSN
FT                   KPELVVVVESPVSEENRNKMFAEIEQVMAGYPEIGAFNQKL"
FT   gene            151886..152437
FT                   /locus_tag="PB2503_01222"
FT   CDS_pept        151886..152437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01222"
FT                   /product="Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01222"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08324"
FT                   /db_xref="GOA:E0TBC0"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC0"
FT                   /protein_id="ADM08324.1"
FT                   /translation="MTDRPFDSIPLRTIAGDPLSLADFAGKVILIVNVASKCGLTPQYA
FT                   ALQALYEAKKDQGLVILGVPANDFAGQEPGTDEEIQTFCATTYDVDFPLLSKAVVTGPS
FT                   KHPLYAALTDAQPVKTGDADGFRAKLRSFGSEPTEDPEVLWNFEKFLIGKEGKVIGRFV
FT                   PTTAPDDPALISAIDAALAA"
FT   gene            complement(152508..153455)
FT                   /locus_tag="PB2503_01227"
FT   CDS_pept        complement(152508..153455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01227"
FT                   /product="possible isomerase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01227"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08325"
FT                   /db_xref="GOA:E0TBC1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC1"
FT                   /protein_id="ADM08325.1"
FT                   /translation="MVKIRRRHGQSGWNGPSLVQRFEVAAEDDDRQSVWRVAGRDEVPD
FT                   WLLSLEASMPPAEGRQLPFAPRSFRDCMLFRQHWIDSSRGFTKRFLPRLFPLTQIYEAI
FT                   TRHPFPAFTPSPLFERQPLFYFGNHSTIIASGTPIPWPRYASVLDYELELGVVLSAPLL
FT                   NASVEDARAAIGGFVLVNDLTCRNVQRAEMQTGLGPQKAKSFGSSMSDSLVTSEAIWPQ
FT                   IDRLTGRVEINGDIVAEVSSVGMEHKIDEVLAYLSVDEPLYPGELIATGTLPGGSGMEN
FT                   GRTLRVGDRLRLVLDGVGEVEHDIGPMRDDALTA"
FT   gene            complement(153629..154609)
FT                   /locus_tag="PB2503_01232"
FT   CDS_pept        complement(153629..154609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01232"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01232"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08326"
FT                   /db_xref="GOA:E0TBC2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC2"
FT                   /protein_id="ADM08326.1"
FT                   /translation="MKSPVTVTVTGAAGQIGYALLFRIASGDMLGKDQPVILNLLEITP
FT                   AMGALEGVAMELNDCAFPLLQGLNPTDDAERAFDKCDYGLLVGAMPRKQGMERKDLLSA
FT                   NGGIFGPQGKALNKGASRDVKVLVVGNPANTNALIASANAPDLDPSCFNAMMRLDHNRA
FT                   ISQLAEKTGAATTDISGVTIWGNHSSTQFPDLYHAKVGGAEALSKIDEEWYKDDFIPTV
FT                   QQRGAAIIKARGASSAASAASAAIDHMRNWALGTEGSEWVSMAVPADGSYGIEPGIMFG
FT                   YPCTCANGKYEIVQGLDLNDFAKEKIAATEAELREERAAVEHLLS"
FT   gene            complement(154726..155361)
FT                   /locus_tag="PB2503_01237"
FT   CDS_pept        complement(154726..155361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01237"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01237"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08327"
FT                   /db_xref="GOA:E0TBC3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC3"
FT                   /protein_id="ADM08327.1"
FT                   /translation="MALDFYTNPMSRGQIVRWMLEESGLPYEEKIVAYGPEMKGENYRQ
FT                   INPMGKVPAIVHEGRIVTECAAICVYLAEMAQEADLAPHPDERADYYRWIFFAAGPVEA
FT                   AVTTRAMGFSPQPDQEVMAGFGNYDLTMSVLEGALSGRDYLCGARFTAADVYVGSQVDW
FT                   GLTFGTIPSRPAFDTYAARLRDRPAYKRAKARDQALIEAQNQAQGPQN"
FT   gene            complement(155429..156769)
FT                   /locus_tag="PB2503_01242"
FT   CDS_pept        complement(155429..156769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01242"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01242"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08328"
FT                   /db_xref="GOA:E0TBC4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023716"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC4"
FT                   /protein_id="ADM08328.1"
FT                   /translation="MKLSRTYLPLLKETPAEAVIASHRLMLRSGMVRQQAAGIYAWLPL
FT                   GLKVLKKVEAIVREEQERAGVAELLMPTIQPASLWHQSGRYDAYGPEMLRLKDRHGRDM
FT                   LYGPTNEEMITELVRAGIKSYKELPKTLFHIQWKFRDEVRPRFGVMRGREFLMKDAYSF
FT                   DLSPEAARRSYLRFFAAYLRTFARLGVKAIPVRADTGPIGGKLSHEFVVLAETGESEVF
FT                   TAKGLVEKTPPPTSLDYDGDLEPLFAEWTGTYAATDEMHDEAAFLALPEDQRLQARGIE
FT                   VGHIFYFGTKYSEPMQFAVEGPDGRAFVEMGSYGIGVSRLVGALIEAHHDDQGCRWPVP
FT                   VAPYEVGLVNLKTGHDGTDGACHRLYDEAVAAGLDVLLDDSGDRAGEKFARMDLIGLPL
FT                   IVTIGPRGVEAGQAEVKDRRTGAKQEVPLTGLVDYLRSAILPQRRLA"
FT   gene            156963..157547
FT                   /locus_tag="PB2503_01247"
FT   CDS_pept        156963..157547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01247"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08329"
FT                   /db_xref="GOA:E0TBC5"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC5"
FT                   /protein_id="ADM08329.1"
FT                   /translation="MTHAAPEDRRSHRRLPLRSAARFLLPEYGESQALVTNVSLSGLAL
FT                   KSPSRPRLGVPLIVYVDALGRLEAEVVRHLSDGFALVFKFTKEKTRRIARKILAFALNQ
FT                   RRGSGLASPTLARATSPIRYEDGREEACKLRDFSILGAIVESERRPFLGATVIVHGRLE
FT                   ATVVRHLNDGYAVEFSQYWQSIPKFAQRSLA"
FT   gene            157653..158627
FT                   /locus_tag="PB2503_01252"
FT   CDS_pept        157653..158627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01252"
FT                   /product="putative response regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01252"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08330"
FT                   /db_xref="GOA:E0TBC6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC6"
FT                   /protein_id="ADM08330.1"
FT                   /translation="MHNDMLTMSRSAPKPTSIPNSDQQRSAPRALVLEDDGFDAAVTRE
FT                   LLEKFCTRKYQVTVASSVQESIRHLSREVFSVALVDMNVIDSKGLETVQDIVRSSSDTP
FT                   IVVLTGDEDIDTATEALRLGAQDYIPKSQLDNRTLQRTIEYAIQRKAKETELTMRAYYD
FT                   GLTGLANRAHLYERWNRSLARTERSGKDAGLMIADLDRFKTINDHYGHDAGDDLLKHFA
FT                   SVLLDSVRESDVVARLGGDEFIVVLESLQNKDELDRVRQAIFDNIGGGFNYRGQVIPYT
FT                   VSIGGTLTSPKDQEDLLAVIKRADIEMYEFKASSRVAAKKIDN"
FT   gene            complement(158872..162006)
FT                   /locus_tag="PB2503_01257"
FT   CDS_pept        complement(158872..162006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01257"
FT                   /product="nineteen domain light and oxygen sensing his
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01257"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08331"
FT                   /db_xref="GOA:E0TBC7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC7"
FT                   /protein_id="ADM08331.1"
FT                   /translation="MSNTVVDFGQWLSEHNQSERSLPRCAVLHCTADCDQVLAAGNWLD
FT                   LIGHDLKLGLSLTEFCSRYVHEEDGAILQQLAGEGKKSCGRVVRLRQQDGRWRPLHTTA
FT                   TTLKPSEEGMPAVLSFAFVETVVDKSVIDDLSLQRRLLELVEKYSRVGHWHVDLQSGSV
FT                   FWSDEVCRIHGVPPGYHPSLSEGIDFYHPEDRDRVDAYVREAQRKGKPFAFDLRIIRRD
FT                   GEVRVVRSRGICTTDAEDRATGMFGTFQDVTEDVAHQQQLKATSVLLETILDANHNGYW
FT                   EWFIAEEVEETSDQFWRLIGYGGEEDAARPSSWRALLDRTTLAQVDEAFADYLRHCTGK
FT                   SFSVEIPFPHKEGHTVWILRQGKVVDWTPDGAPRRAVGTFTDISDEVENRRKVAWLETR
FT                   FELASQAAKVGIWEVDPATHQVKWSDHLLPLLGEAPGACDPITRLHPVDRAAFDRFVDR
FT                   LKMGEGEETLICRFQRTDGTYADIKLTGGRVEKEQYIVFAGTFQDVTESLRTERTKNDL
FT                   WTTLKSETLDFPQKMRCLLKQASDYLGLETGIISHIDGPNYRVVEAVTTGEAIPQGSLL
FT                   PFETTYCYHTYNKTEVVAYHKAGETSLQSHPCYQIHGLESYIGCALIVDGVRFGTINFS
FT                   SHDARGGPFTQPERDLVALLAQWVGYEIGLHQSMEALRESQQRFELAAKGSSVGIWEFK
FT                   LAQPNEIWCSEHFLENLGLPTYPRELKRTDFHDLIHPNDLEMARSALNNHLEFGQPFSI
FT                   EYRLRHATKGYQWMMTTGQAQWDECGKPIRVIGSTTNINRRRLMEDEIRKRTKWLEQTN
FT                   QDLDHFAYIASHDLRAPLRGMDNVAQWIEEDLENGQIDDAKGKLLLLRGRVGRMNRLLT
FT                   DVLAYSRAGKLDGDPEPVDMGTMLADIATWTTEGTSARVEWGEGLPVIETIPTLIEQIF
FT                   TNLIGNAIKHHDGTDPTVTVNYLDEGEQHHFIVEDDGPGVPQSVQPRIFKMFQTFGQPG
FT                   TTEKSSGIGLAIVKKLVESVGGHLWILSPVTDRGSAFHVTLPKVMIQRRSTAEVH"
FT   gene            complement(162016..162738)
FT                   /locus_tag="PB2503_01262"
FT   CDS_pept        complement(162016..162738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01262"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01262"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08332"
FT                   /db_xref="GOA:E0TBC8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC8"
FT                   /protein_id="ADM08332.1"
FT                   /translation="MVEPVRNQKRKNTAAATRQVTVSIDHAEDQMVLETVFLQASAPVP
FT                   SRPALAPVSSAEITEHRPYALAPQETFPVAPLSTVFVIDDDELDILMYERVFQRSAAVE
FT                   RAVNFSFAQSALEVLDSGERPELIFLDINMPGMSGFDFLRAIEDSPTLDLEMFPTVIMS
FT                   TSDLAEDREQARSFDNVIAYFTKPPCVSMIRLLTCCTRASREEREALSNVLFSKRSVID
FT                   LRAVEDAIQQLLGPSTTA"
FT   gene            complement(162928..164202)
FT                   /locus_tag="PB2503_01267"
FT   CDS_pept        complement(162928..164202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01267"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01267"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08333"
FT                   /db_xref="GOA:E0TBC9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBC9"
FT                   /protein_id="ADM08333.1"
FT                   /translation="MTDTPSLYSFSARDDMHDLRMSEAALPLLEKVKSFIGEIVDPMSE
FT                   AFEKAGQNRPDRWAYTDEQLALLEGAKDEAKARGLWNFFLPDAATGEGLSNLDYAYIAI
FT                   ELGKNFLASETMNCSAPDTGNMEVLERVGTAEQKAQWLTPLLEGKIRSCFGMTEPGQAS
FT                   SDARNISTRAELDGDEWVINGEKYWISGAGDPRCKVMICMVKTSPEAPPHQQQSQILVP
FT                   MEAGGLEIVGPMTVFGHDDAPHGHMHIRLKDVRVPKENMLLGEGRGFEISQLRLGPGRI
FT                   HHCMRAIGQAEKALELMVRRGVTREAFGKPLIKLGKNLEIVSRARIDIEAMRLIVLKAA
FT                   RAMDVQGNREARVWISMAKAMVPETVCRILDEAIQLHGGTGVSDWTPLAGMYAAARTLR
FT                   FADGPDEVHHMVVGRAETMSTMGAT"
FT   gene            164423..166000
FT                   /locus_tag="PB2503_01272"
FT   CDS_pept        164423..166000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01272"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01272"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08334"
FT                   /db_xref="GOA:E0TBD0"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBD0"
FT                   /protein_id="ADM08334.1"
FT                   /translation="MDGSAFPSPQEPGGGRPEGDEGQYDVVIVGAGISGINAAYRLTES
FT                   DPTLTYKIFEGRERLGGTWDLFKYPGIRCDSEMSTLAFPFRPWEEKSLIGSGYEIRDYL
FT                   EDTARENGIYPRIEFQTYVKSAAWSSEENLWTVKIVNAAGTERTVKGRYIYLGTGYYDY
FT                   GSGYTPDFPGLESFGGQMIHPQHWPEDLPLKDKKAVIIGSGATAITLVPAMADEGAEVT
FT                   MLQRSPTYVIAMPSSAAPARALRAVFGRNLGNKIERWRSHFLGDTFYKASKAFPGLIRN
FT                   ILQRRAQSLLGKNVSVDPHFTPKYNPWDQRLCLDPDAKLFKTLRKGKAKVVTDHIERFD
FT                   ETGIQLKSGDHLDADIVVSATGLNVKMFGDIDLSVDGRPIDPADHFVYRGMMLDGVPNF
FT                   FLAIGYVNASWTLKVDLTAQLAASVIGRAKAGGHQRVAAIPLSDMGKESPLLDLTSGYV
FT                   QRALERLPRQGAEEPWVVHQDFKKDIKSTREGMKGDEAVKFDPSPDQLKPFQPRTPSAT
FT                   APELQAAE"
FT   gene            complement(166212..167714)
FT                   /locus_tag="PB2503_01277"
FT   CDS_pept        complement(166212..167714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01277"
FT                   /product="Flavin-containing monooxygenase FMO"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01277"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08335"
FT                   /db_xref="GOA:E0TBD1"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBD1"
FT                   /protein_id="ADM08335.1"
FT                   /translation="MSVTPIHKKQIYDVLIFGAGVSGIGCAATLRQKSPEKTWTILEMR
FT                   HDLGGTWDLFKYPGIRSDSDLYTFSYEFKPWDRKRSIARGDEIKDYLDDTAKEFDVKDH
FT                   IQFHTKILSCSWDSQQALWTVRVENTKTGEQSDVFGRWIFSGTGYYDYDKGYRPSFPNE
FT                   DAYKGEIIHPQHWPEDLDYSGKRIAVIGSGATAVTLLPSLAEKAAHVIQVQRTPTYVLP
FT                   VPQVDPWQYLFRPFVSKNTLHRLMRAKNILRQKLLWGASRRFPRMMRQFIRLVNKVYLP
FT                   SHYPVDTHFNPPYDPWDQRLCAVPDGDLYKSLRKGECSIVTGTIARFTEKGIEMSSGET
FT                   VEADIIVTATGLNIKLLGGVTYTVDGEEIDWSQRVVFKGMMYNGIPNFVMALGYTQSSW
FT                   TLKVGLLCEYLCRLFAEMDRRGMAVCTPELPDRPMELRPLLDFGAGYVRRAIDKMPRQG
FT                   DAFPWEMTFNYSEDAEMMKEGEVVAPELRLSPLPEALAYAAE"
FT   gene            167803..169014
FT                   /locus_tag="PB2503_01282"
FT   CDS_pept        167803..169014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01282"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08336"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBD2"
FT                   /protein_id="ADM08336.1"
FT                   /translation="MPITPDRLAYLMREAATRARLNPDKSLKMIDDAVLNAIDQTQDPL
FT                   LVAQIRLANRLNMDYWLNRAFQAPEKIPEPNLSPEILRSVHENARVGLGETALEAFRAG
FT                   QNAAFMIWMEVVFELTDDPEELKAVLDHSLRSISSFVEETARAIRIENAKGLEDAAQGS
FT                   PAQRRVLVERLLEGETFDAPLAARRLGYRLDQRHQAVIFWIDRMEGDPDILADFATRLT
FT                   TLTPGKSILRIDEDKSRLWLWFTDKIDSKMLASLRPETVYVAIGPVLSGVEGFRRSHLD
FT                   ARTAERLIAEGPGDRRIATYEDTRLAALMGTNSALRDQFLEEVLGPLSTAPPHFAQSLR
FT                   AYFLHGENVSRTAEALAIHRNTLMRHLEGAEDLLPRPLSEARIEVAAALEALHWRRRDG
FT                   SAAA"
FT   gene            complement(169118..169192)
FT                   /locus_tag="PB2503_t07312"
FT   tRNA            complement(169118..169192)
FT                   /locus_tag="PB2503_t07312"
FT                   /product="tRNA-Val"
FT   gene            complement(169276..169638)
FT                   /locus_tag="PB2503_01287"
FT   CDS_pept        complement(169276..169638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01287"
FT                   /product="chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01287"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08337"
FT                   /db_xref="GOA:E0TBG2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG2"
FT                   /protein_id="ADM08337.1"
FT                   /translation="MAAILLAEDDDSMRGFLKKALEKAGHIVVDAAQGDDALNELQVRE
FT                   FDLLLTDIVMPIMDGIELARRATDIDPDMKIMFITGFAAVALNPANKAPAEAKVLSKPF
FT                   HLRDLVNEVDRMLAAA"
FT   gene            169776..170654
FT                   /locus_tag="PB2503_01292"
FT   CDS_pept        169776..170654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01292"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08338"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG3"
FT                   /protein_id="ADM08338.1"
FT                   /translation="MVAKIVKPSFPGHAIAIPDLWSAPFVFASPHSGRHYPQRFLSMSA
FT                   LDLRDLRRSEDAYVDLLLPKASDTGVPVLTARFPRAFVDVNRSPREIDPTVFTSPPYDD
FT                   LDTQSPRVAAGFGLIPSRAATGADIYTRLLPAQEGRSRMDRCYTPYHNALSELLGLCRH
FT                   RFGHAILVDWHSMPSMTLGREHLPDVILGDLHGQACTADLRDVWEQGFQSFGFSVGRNL
FT                   PYAGGYVTRRYGRPAEGIEAIQIEINRRLYLDEERTTRNASRHRALQARLAAVISTVIG
FT                   AYETPLQWAAE"
FT   gene            171235..171513
FT                   /locus_tag="PB2503_12544"
FT   CDS_pept        171235..171513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_12544"
FT                   /product="transposase IS3/IS911-family, orfA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_12544"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08339"
FT                   /db_xref="GOA:E0TBG4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG4"
FT                   /protein_id="ADM08339.1"
FT                   /translation="MGRKRRTAEEIIGHLREVEVRLAKGETIGIACRAIGVTEQTYYRW
FT                   RREYGGLKVDQAKRLKELEKENQRLRKAVSDLTLDKLILSEAAKGNF"
FT   gene            173197..175014
FT                   /locus_tag="PB2503_01307"
FT   CDS_pept        173197..175014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01307"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08340"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG5"
FT                   /protein_id="ADM08340.1"
FT                   /translation="MSVQRDDLLRRHDIYALGCFEKKKTVYTQQARALTLIHALFKAGK
FT                   IAKGTKIGIVGGGISGIAAAIAAKKVGARVVVVEKEENLIPIQRDCSHRYLHPHAYDWP
FT                   AAWCNENNSGLPIDELNWEAGTAKEVTETLEDKFKKFVNKSNETGDLKEITFYTCWPAR
FT                   MLLFDRVNKKHVLSKRAFDRDGENWRLFERDPSWSGVVDECTPISDEFRAEREQWKSAA
FT                   SKLIRRIRHGDISLPPPYLSPKGRNGINGQTPIFWNGQEHFTFKGKEISAKAFPDDDIN
FT                   PDFIVDCDILIFATGFGIEDPRDSILNDLKNHFGHKKEFDEIVEKRINKLPLKNNGYWE
FT                   KDRINEEKSLTNTIHETDIKENTHDKPPKLYVVSGSGDGALIDILRLLILDFTGPEYHR
FT                   DLLDKLNALLFPRQAVGVWLSQKDVLVYAEALRRLFNSDDFKRTEGETDRLSMIGRTMA
FT                   GFDIDAFLDHFSINLADAEVYNVSIDPQPFWTPASVAHRLLVWCLHKKGRVRFVRGRVI
FT                   RYADKRSAIQRTVTGKWRDVGNSAIVARHGVARQSEAFLRIQGVLINTTRTPGEVAADG
FT                   RRLVSLLRLSDRLHPETEKFFRHTIKHLR"
FT   gene            175437..176642
FT                   /locus_tag="PB2503_01312"
FT   CDS_pept        175437..176642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01312"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08341"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG6"
FT                   /protein_id="ADM08341.1"
FT                   /translation="MTDQENMPQGRSHRIKDLGGRVRSLTRARQKFEMPNAESPNPQSG
FT                   LKIVIATDAWKPQLNGVVTTLDTLGRILTKFGNEVLYITPQDFKSIPMPTYSEIRLSLF
FT                   PNRKVASMLNKFKPDAIHIATEGPIGRATRRFCRRRKYPYTTSFHTRFAEYAHERTGFP
FT                   ISWGYALLKDFHKHGEAMMVATPGLIEELSGRGFENMRLWERGVDTDQFRPLDSDVLKD
FT                   LPRPIFTYVGRIAVEKTLEDFLDLDLPGSKVIVGAGPQEAELRQKYPAVHFVGKHFGDD
FT                   LVKYYSASDVFVFPSRTDTFGLVNVEALACGVPVASYPVRGPLEILADAPPGCGCLDED
FT                   LKTACMTALETRDPEACRAHALTFSWDAAARQFIANLEIPGFDDQFWLRSAKMIEDPIL
FT                   PT"
FT   gene            176747..177841
FT                   /locus_tag="PB2503_01317"
FT   CDS_pept        176747..177841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01317"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01317"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08342"
FT                   /db_xref="GOA:E0TBG7"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG7"
FT                   /protein_id="ADM08342.1"
FT                   /translation="MSSGPNSPSNIHIALDVMGGDAGPDVMLQGLRQARETGFDAEVTL
FT                   HGRQADIEAALEAANITDRVPAIAPAEDVVTMEDKPTDALRRRRGSSMWQAIAQVKEGN
FT                   AKAVVSSGNTGALMAMSVLQLRKIEGIDRPAIGALWPTVSSRCVVLDVGANVEVSANQL
FT                   VQFAIMGEAYARALFGHDRPSVGLLNVGAEELKGHGLIQTAAKILREADPEMAFIGFVE
FT                   GNDISKGVADVVVTDGFSGNIALKTAEGTARMVGGWVKDTLTANLRAKMGAALMMGALK
FT                   DLKQKMNPSRANGAPLLGVNGLVIKSHGGADADGVAAALMTALALAKHPYLEEIQRTVA
FT                   KVNRRVESGAVADLDGHDLAKAAQ"
FT   gene            177838..178821
FT                   /locus_tag="PB2503_01322"
FT   CDS_pept        177838..178821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01322"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01322"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08343"
FT                   /db_xref="GOA:E0TBG8"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG8"
FT                   /protein_id="ADM08343.1"
FT                   /translation="MTAALPFRPLYRGCGAALPDRILTNAELSTRVETSDEWIRSRTGI
FT                   QERRLAGPEETTADLAERAAQKALSDAGMSADDIDLLVLATATPDLTFPSTATIVQGRL
FT                   GMTKGAAFDVHAVCTGFVYALATASNFLSCGQHRRALVIGAETFSRLLDWTDRTTCVLF
FT                   GDGAGAMVLEAVPTETAGDRGVLSTYLCSDGRLTDLLYVDGGPSRTGTVGHLRMQGNKV
FT                   FKAAVIRIADAMAKAAERADIPLTEIDWFVPHQANERIIGGVVDRLNLDRNRVVSTIAR
FT                   HGNTSAASIPLAFETARRDGRLKDGDLVAIEGMGGGLTWGAGLMRL"
FT   gene            178910..179248
FT                   /locus_tag="PB2503_01327"
FT   CDS_pept        178910..179248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01327"
FT                   /product="integration host factor alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01327"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08344"
FT                   /db_xref="GOA:E0TBG9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBG9"
FT                   /protein_id="ADM08344.1"
FT                   /translation="MTKTHTRADLCDTVYENVGLSRQECGELIESVLEKIAQHLEEGEQ
FT                   VKLSSFGTFQIREKNERIGRNPKTGEQVAITPRRVLTFRASHVLKDRVDDGHKGGHKGS
FT                   HKNGGQAE"
FT   gene            179245..179694
FT                   /locus_tag="PB2503_01332"
FT   CDS_pept        179245..179694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01332"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08345"
FT                   /db_xref="GOA:E0TBH0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH0"
FT                   /protein_id="ADM08345.1"
FT                   /translation="MTKAPDAFRTISEASEELGLAQHVLRHWEDMFGAIRPMRRAGGRR
FT                   FYRPQDLHLIYGVKILIHEKGFTTKGVQRIFAEKGASHITDIGKRALEGAPESAATTPE
FT                   TVSLSHESLTLVLNRVRSARHALSTMRRGAERESSDATALPTNTA"
FT   gene            179752..179828
FT                   /locus_tag="PB2503_t07278"
FT   tRNA            179752..179828
FT                   /locus_tag="PB2503_t07278"
FT                   /product="tRNA-Pro"
FT   gene            complement(180094..180543)
FT                   /locus_tag="PB2503_01337"
FT   CDS_pept        complement(180094..180543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01337"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08346"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH1"
FT                   /protein_id="ADM08346.1"
FT                   /translation="MPRHLIAALTALCVLCFGVAAAQSSPFFTGRLSNVAVGGYDPVSY
FT                   FDGTPQRGDRQISRTYRGAAFRFANQENLERFSADPEAYVPQYGGYCAWAVAQGSLSKG
FT                   DPRYWAIVGGKLYLNYDEGVQALWDRDRAGLIETADANWPEILDR"
FT   gene            complement(180611..182278)
FT                   /locus_tag="PB2503_01342"
FT   CDS_pept        complement(180611..182278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01342"
FT                   /product="NAD(+) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01342"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08347"
FT                   /db_xref="GOA:E0TBH2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH2"
FT                   /protein_id="ADM08347.1"
FT                   /translation="MTTGRLSIALAVLNPTVGDVAGNIERIKAAHKEATDCDLVVCSEL
FT                   CVSGYPPEDLVLHAPYAIRCREAVDALAQVTADGPALVVGTPWPAEGRQRKPYNASVLL
FT                   ADGKVQTVAYKRYLPEYGVFDEPRTFSASTAIPDLGIVAGVRLGLMTCEDMWYPTPAAD
FT                   LAERGAEIFVAPHGSPFRLTAHAERLFHAKARVRETGRPLVFTNQVGGQDELVFDGGAF
FT                   AVDRDEGVYRGPLFARGITRTVWRRDEAGHLRFETGPSEDWPVEEPLIYPALVTGTRDY
FT                   VRKSGFSSVVLGLSGGIDSAMVAAIAVDALGPDNVRCVMLPSRYTSTESLDDAAACAKA
FT                   LGVTLDRVEIEPMIAVFTDSLAPLFAGRSADVTEENLQSRIRGTALMALSNKFGCLLLS
FT                   TGNKSEMATGYATLYGDMNGAYNPLKDVYKSVVFRLARWRNANHPSGGLGPRGEVIPER
FT                   IITKPPSAELRADQRDDQSLPAYDILDDILSGLVEEDLSPKAVAARGHDPALVTKVRRL
FT                   LLLSEYKRRQAPPGPKITVRNFGRDRRYPLLNRWGANE"
FT   gene            complement(182280..183455)
FT                   /locus_tag="PB2503_01347"
FT   CDS_pept        complement(182280..183455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01347"
FT                   /product="DegT/DnrJ/EryC1/StrS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01347"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08348"
FT                   /db_xref="GOA:E0TBH3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH3"
FT                   /protein_id="ADM08348.1"
FT                   /translation="MNGVANLALERETRVGTIAFIDLKAQQKLIRERIEKRLLDVLDHG
FT                   RYIAGPEIDELEKTLADKVGVQHCIACSSGTDALLIPMMGLKLQPTDAVFIPAFTYNAT
FT                   ANAVLVAGGRPVFVDIDPSTLNMCPNDLDRRIDEAKQAGLTPRVVCPVDLFGAPADYMT
FT                   IGTIAASHGLTLFADGAQSFGGKHQGSWVGAIASVTGCSFFPGKSLGAYGDGGATFTDD
FT                   DEMAELCRSIRWHGTDNDRAISVRVGINGRMASLQAAVLLEKEAIFWDELKRRHEIAAI
FT                   YASDLDGFATPQEIPPGIESGYGYYTIRTVQRDAIREAMTKIGVPTAIYYKTPLHKMPA
FT                   FAHLAPEGGLPGCEAAAGQVLSLPMHPYLTDDQAHFVCDAFKAAKKEVCGG"
FT   gene            complement(183452..184396)
FT                   /locus_tag="PB2503_01352"
FT   CDS_pept        complement(183452..184396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01352"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01352"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08349"
FT                   /db_xref="GOA:E0TBH4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH4"
FT                   /protein_id="ADM08349.1"
FT                   /translation="MTDKLRAGVAGAGVFGGYHANKYLEVDGADLVGIFDADPQRAAKA
FT                   AAERGVTPYAAFDDFLAAVDILTVATPATTHSALVEQALSAGRHVLVEKPIALDLAAAD
FT                   GLITLAERNELILQVGHQERYVADAFGLFERGIPNRVRSRRLNNYSGRAMDVSIVFDLM
FT                   IHDLDLLAILTGTHEARIVNIEAKAVHGTLADFVRVDLQLAGGLEAELSASRLEQRPVR
FT                   DLFLDYGEGSVLLDFLTRTFENTTDQPLGIDLSAATLPLAYRDPLRFGTEAFVAAVTTG
FT                   QEPTVGGRAGRRALALAVEIERAANEIVRGGRP"
FT   gene            complement(184453..185829)
FT                   /locus_tag="PB2503_01357"
FT   CDS_pept        complement(184453..185829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01357"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   class II"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01357"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08350"
FT                   /db_xref="GOA:E0TBH5"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH5"
FT                   /protein_id="ADM08350.1"
FT                   /translation="MMWTPDSWRVKPAKHIPDDYPDPEALAAVEQELSRFPPLVFAGEV
FT                   RTLRRRLADVSAGKAFLLQGGDCAESFKEFHPNNIRDTFRVLLQMSVALTYGAAMPVVK
FT                   VGRIAGQFAKPRSSPTEDSGGVTLPSYRGDNINGMAFDETSRVPDPRRLQQAYGQAAAT
FT                   LNLLRALAKGGYADLRNVHRWMLEFTNEPQGVRFRALADRISEAMAFMEACGITGSGDE
FT                   SVSETEFYTSHEGLLLGYEQAMTREDSTSGDWYDTSAHMIWIGDRTRQPDGAHVEFCRG
FT                   VQNPIGIKCGPTLEPDDLIALIDILNPDNKAGRLVLISRFGANKVGDGLPRLIRRVEEE
FT                   GRHVVWSSDPMHGNTQKAQSGYKTRAFDNIAAEITQFFDICRSEGAHPGGVHFEMTGQD
FT                   VTECIGGGQAISEENLSLRYHTHCDPRLNASQSLELAFILAEKLREDRQSAEIGSSTAP
FT                   "
FT   gene            186007..187350
FT                   /locus_tag="PB2503_01362"
FT   CDS_pept        186007..187350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01362"
FT                   /product="Zn-dependent hydrolase, glyoxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01362"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08351"
FT                   /db_xref="GOA:E0TBH6"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH6"
FT                   /protein_id="ADM08351.1"
FT                   /translation="MSPILAALFATTALTVHPATLHPAAQEAAQGQGSQTTPATPESEL
FT                   RDLGDGLYMITGEGGNIMVSTGADGAFVIDDQFDRLAEKNLALIEEVSEEPIVFVLNTH
FT                   YHGDHTGGNLAFYNAGATIIAHENVRRRLAEAADKEDGALPVITFSENVTFHWNDQSIR
FT                   VMHVPNAHTDGDSFVFLPQANVIHSGDLVFSSMYPYIDVEAGGSVDGMLSGLNRIRQLA
FT                   NSETQIVPGHGPLSDEDDVTAQIDLLRTARRLVREQMMEGHDVEAVVEADPLADYNEDW
FT                   AWRFVSGEKMVRQLFADLMATDTDAKAAVEAGSTADAAETTASAEPPEETAAAEETEEA
FT                   PETEETAAPAADDASAADAPVPANRDAALDAAVADTSDTSDAPEEENTEDGLGLQDRLE
FT                   DAQNAAQAAAAAARRRAEQAIDAVRGSGAEEEAASAEENADPDASDAE"
FT   gene            187431..187763
FT                   /locus_tag="PB2503_01367"
FT   CDS_pept        187431..187763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01367"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01367"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08352"
FT                   /db_xref="GOA:E0TBH7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH7"
FT                   /protein_id="ADM08352.1"
FT                   /translation="MRLPDLTTPSLRLDRWLWHARIFKTRALAARIVSQKGARVTRAGK
FT                   TQKTTKPSFAIRPGDTLAIVQAQRAIILEVVALGDRRGPAREAQTLYRISDDSPATQGN
FT                   GRTFPC"
FT   gene            187757..188209
FT                   /locus_tag="PB2503_01372"
FT   CDS_pept        187757..188209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01372"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08353"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH8"
FT                   /protein_id="ADM08353.1"
FT                   /translation="MLNRLFAAFQGAPQDETAAPQMEPAIAALLVEAARADDIYTEDEK
FT                   HLIDTLLSKRFALSADAAADLRARAEIAQAEANDLYGFSHIVKSELDREGKMSLVEDLW
FT                   RIVLSDGDRDPHEEMLIRRLVGLIYLEDRDSALARQRAEKALESGQ"
FT   gene            188230..190335
FT                   /locus_tag="PB2503_01377"
FT   CDS_pept        188230..190335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01377"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01377"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08354"
FT                   /db_xref="GOA:E0TBH9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBH9"
FT                   /protein_id="ADM08354.1"
FT                   /translation="MRPAELNRYFADLTSLPGVGPKTAALLQKVAGPRIIDLLLTGPTG
FT                   LIDRSYRPKVGEAILGRVATVTVTVTAHTPPPTGRRLIPYRILTADDTGYLTLVFFRAK
FT                   REWLETRYPVGTSLTVSGTIDDYGGARQMTHPDYMLRPDHDETLPEVEPVYPLTAGLTL
FT                   PTYRRAVAAALRRVAPLAEWRAPPLEGDGAPPLPDWADAVRTLHAPQSERDLSPSSPAR
FT                   RRLAADELLSNQLALSLIRHRRQQIAGRALPGDPTLMEGGRAALPFRLTAAQDQALAEI
FT                   VADMQSPARMVRLLQGDVGSGKTMVAFFALLQAIGSGVQGALMAPTEILALQHEETLRP
FT                   LCDRLGLSLVTLLGRDKGPERAAKRRGVAEGYVPLVIGTHALLSEDVVFRDLGLIVVDE
FT                   QHRFGVTQRLSLQEKGRRADILVMTATPIPRSLALTTYGDMSVSQIREKPPGRKPVATR
FT                   ALPTTRLDEVMSAIGRAAARGDQIYWVCPLVEENDQLALTSVTERAASLADATGLDIAA
FT                   VHGRMSPQEKDAVVARFARGDADVLVATTVIEVGVNTPNATIMVIEHAERFGLAQLHQL
FT                   RGRVGRGDKPSSCLLLYSTGDGEQLGKTAKARLNTLRETEDGFVIAEADLALRGPGDAL
FT                   GTAQSGQARFRFGDLSAHKDVLEWAHQEAADIVRHDPYLDTKRGAALRTLLYLFGQDEA
FT                   ARRLRSG"
FT   gene            complement(190379..191116)
FT                   /locus_tag="PB2503_01382"
FT   CDS_pept        complement(190379..191116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01382"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08355"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI0"
FT                   /protein_id="ADM08355.1"
FT                   /translation="MRVLVSAIASAAILSPAAYASVVYNYTVEDTSQKTDVGAIEYVSI
FT                   SYDTSDRLSFEASLGPTPSRNDVPEFGWFVVSPGPMPSAVDDQLAIFYMDFAGRDLYAY
FT                   RYEGKNGQVDSGSGSYFDRDNYITTYKNVLDVDYDGLFSQRRGVTVSFNDLDVSALAPG
FT                   VFGSEWTGVSFEDEIGVWLHFSSLDVFRTDGDLIEAFRPDAQSWFDTENQTTTHVSEPL
FT                   GLALTGFGLAGGAIAWRRRQKRA"
FT   gene            complement(191210..191998)
FT                   /locus_tag="PB2503_01387"
FT   CDS_pept        complement(191210..191998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01387"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08356"
FT                   /db_xref="GOA:E0TBI1"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI1"
FT                   /protein_id="ADM08356.1"
FT                   /translation="MPHLPKPGPFASLRNSFLTGVVISAPLFITFAVLYWFITGPLRRL
FT                   DGFVRNNIPQQFLPEDISILPGLGVLIAVIFLTVLGIIGKNFIGRSLIGFGERAVDSVP
FT                   IVRSLYGFFKNVFEMALQQSEQSFKEVALIEYPRPGLWTLCFVVTSTKGEVRHALADRG
FT                   EDMTNVFVPTTPNPTSGFLLFVPRSELRILDMSVEDGAKKIFSAGLVAPNFDVTSMEGQ
FT                   ERSAPEEGNGGKTFSLFGRKQVDEGQTDPKKPTKKSVASS"
FT   gene            complement(192106..193518)
FT                   /locus_tag="PB2503_01392"
FT   CDS_pept        complement(192106..193518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01392"
FT                   /product="nitrogen regulation protein NtrX"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01392"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08357"
FT                   /db_xref="GOA:E0TBI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI2"
FT                   /protein_id="ADM08357.1"
FT                   /translation="MSIDILIVDDERDIRDLIAGILEDEGFTPRTASDSDAVFAALRER
FT                   CPALVILDIWLQGSSMDGLDILDALKQLYPDMPVIIISGHGNIETAIAAIRRGAYDFLE
FT                   KPFNAEKLILTIGRALEASSLRTENDSLRSKAADEALRGQSTAIQQFRQALFKVAEARS
FT                   RVLIEGEVGSGRETAAREIHRLSPRRDRPFVVVSAATIKPDTMEEVLFGSTAPDGTPKT
FT                   IGVFERAHGGTLLIDEVGEMSLSTQAKVLRVLVDQRFTRLGGAAPVAIDTRIISTTSRN
FT                   LLSDGGEGGFRADLFHRLAVVHLKLPPLRQRPDDVPELVQYLLTMIAEGAGRPLPQISH
FT                   EAITALQAYDWPGNVRQLRNALERSILLRAGEDKEPMGIADLPEEIVRGGATLSAGTGL
FT                   EQVISLPLRQAREQFEREYLAAQIARFAGNISRTASFIGMERSALHRKLKALGISGNGK
FT                   TTRHQSADLSEQ"
FT   gene            complement(193523..195808)
FT                   /locus_tag="PB2503_01397"
FT   CDS_pept        complement(193523..195808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01397"
FT                   /product="putative nitrogen regulation transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01397"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08358"
FT                   /db_xref="GOA:E0TBI3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI3"
FT                   /protein_id="ADM08358.1"
FT                   /translation="MISSPDRYLPTTGAETTASPRGGGAVSRLPHLRSRLTPVALAGAA
FT                   ILVFILTAYGLSNVVEGVSAPVRGLFGLVAVGAMGLSVLVLARLVEVFVEDRGHLRGAR
FT                   LQKRFVALLLGVAVVPAMAAFVLAGTVLKTFSEEFFVERVTAANAVARDFANGYFTAES
FT                   RKIGPQVVQLAADLALQARAGLDPETQPIGFRKYLLGQAILRDFTAVTILDRDLNVIVQ
FT                   VNRRSGQPFRLPPLRYFEDVSTPGAIPFKYDAHDKRVFDAAYALLYSPQDQFIVAYKAE
FT                   NAALAEQLLRVRNFRDETIGIRQRLEKLTGTFTIGFGLVMILLLLTAMWIGIMVANGII
FT                   RPVRQLATAAEAVSRGHLVRHPDLETAQGELGELGRIFNDMTEKLALQRRELLLANRQS
FT                   QARRRFIETVVSGVPSGVLNVRREGTIALSNPSADAILSPEGEALTGRQLLDVAPELAP
FT                   FFEETSPLAGREAQNQIEINRRGQTRIINVQVRPDDKDRPRGTLITLDDITELVAAQRN
FT                   AAWGEVARRIAHEIKNPLTPIQLSAERLKRRYGDKIGEDREVFEACTDTIVRHVGDIGR
FT                   MVAEFSSFARMPAPVLSECDMRETVRAAAETFAIAYPTISFRYILPDGPVPMRCDSRLM
FT                   RQAIMNLVKNGVEAITEDEGSGKKKGEMIVSLEEGETNVVISITDNGRGLPQKDRARLT
FT                   DPYMTTRVKGTGLGLAIVRKAVEEHSGQFSLIDRGAEDGAPGAVARIVLPKRSSYEQGD
FT                   EPPTRQAV"
FT   gene            complement(195865..196971)
FT                   /locus_tag="PB2503_01402"
FT   CDS_pept        complement(195865..196971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01402"
FT                   /product="dihydrouridine synthase TIM-barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01402"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08359"
FT                   /db_xref="GOA:E0TBI4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI4"
FT                   /protein_id="ADM08359.1"
FT                   /translation="MGQRANGPVAAASPVLAPLSIGPHPLERPVILAPMSGITDLPFRR
FT                   AALRAGAPLVVSEMVASEEWVRERPDVALRAALPTGDSLNVIQLAGREARWMREGAAKA
FT                   EALGADIIDINMGCPARKVTGLLSGSALMRDVDHALSLIKATLSGTSRPVTLKMRLGWD
FT                   HGHLNAPEIAKGAADAGVAVITVHGRTRQQFYKGTADWRAVRATVEAVSVPVIVNGDIV
FT                   DDVTARAALAQSGAAGVMIGRAAEGRPWLPAALAEALASGTPMIAPSFVDQIQGVRRLY
FT                   DETLSHYAAGHGRSAAQGRQLGARMARKHLAAFIDGAPAPWSSAARREWRRVLCAENDP
FT                   TRVVDLLSQLADGPVPPVGTQSVAFVAA"
FT   gene            complement(196973..197440)
FT                   /locus_tag="PB2503_01407"
FT   CDS_pept        complement(196973..197440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01407"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08360"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI5"
FT                   /protein_id="ADM08360.1"
FT                   /translation="MGDWPGGMPPFLARVEGGEFEGWYTLVDAPNFAQFAGPFYFSFDE
FT                   EDNAPVAAMALAAHHQNLGGTGHGGALMTFVDMAAFHTITPEVPDWKAVTVGVSCDFVG
FT                   AGPIGGVLRCKGEILRAGGRSLFTRGLVTAAGAPVLNWSAHLMRMPTKGRG"
FT   gene            complement(197498..199177)
FT                   /locus_tag="PB2503_01412"
FT   CDS_pept        complement(197498..199177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01412"
FT                   /product="electrotransfer ubiquinone oxidoreductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01412"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08361"
FT                   /db_xref="GOA:E0TBI6"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI6"
FT                   /protein_id="ADM08361.1"
FT                   /translation="MFDDTPVERESMEFDVVIVGAGPAGLCAAIRLKQLEQEKGGDLSV
FT                   VVVEKGSEVGAHILSGAVLDPKALDELLPDWRDDAECPIDTPVTDEKFLYLGSAGSMPL
FT                   PIWAMPKMIKNHGCYAVSMGSVCRWLAEKAEAMGVEIYPMMAASQLIRTEDGAIAGVIV
FT                   GEVGIGRDGEKKDSYEPGMELRGKYTLLAEGVRGSLSKQVISEFGLDKNAEPQKYGIGI
FT                   KELWKVPDEKFHKGLVQHTFGWPLPNDAGGGSWMYHFGDNFVSIGFVVHLNYKNPYLAP
FT                   YQEFQRFKTHPEVRPFLEGGERVAYGARAITEGGFQSVPELTFPGGALIGCSAGFVNVP
FT                   RIKGNHNAMKTGMMAAEAAFEAVSEERKADRLVAYQTAYDNSWVRDELYKVRNAKPLWS
FT                   KYGTFLGALVLNGLELSLTTRTGGFSLFGTLKHGKTDAESLEKASKHKPIDYPKPDGVL
FT                   TFDKLTNVSFSATNHEEDQPIHLKLKDPSMMTQIQLPEFAGPSARYCPAGVYEYVEDGG
FT                   ETKFQINAQNCVHCKTCDIKDPMQNIVWTTPEGGGGPNYPNM"
FT   gene            199433..200332
FT                   /locus_tag="PB2503_01417"
FT   CDS_pept        199433..200332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01417"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08362"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI7"
FT                   /protein_id="ADM08362.1"
FT                   /translation="MSAPPSSAPPSSSLASSARVSLDRATALALLAWYRASGVDTAESA
FT                   EPSDMRDWPTHGFPVPRALAGGERRPPLPPGNEVAPTAKPPSSAGGSDEAVMAATALAE
FT                   ATTTLPALADAIAGFDGCPLKAAARRTVVYDGVIGARLLIIGEGPGRDEDRIGKPFVGK
FT                   AGGLLDLMLHAIGYSRTEADGRGDVLITNAVYWRPPGNRAPTGEEQAICLPFLRRFITL
FT                   AAPEVIILMGNVSTQALYPGAPGITRTRGSWREWPLSDGRQAAVLPMFHPAFLLRAPAQ
FT                   KRLAWADLRAVAARLAAS"
FT   gene            200477..202201
FT                   /locus_tag="PB2503_01422"
FT   CDS_pept        200477..202201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01422"
FT                   /product="transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01422"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08363"
FT                   /db_xref="GOA:E0TBI8"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI8"
FT                   /protein_id="ADM08363.1"
FT                   /translation="MLAGIAIGLSCGLSGALSAAAAPHTPLSNADAARYEKIFALQADA
FT                   KWTEADRLIAALDNDILLGYVLEQRYFHPTAYRSSYPELKRWLSAYADHPTADRVYDLA
FT                   MKRRTGAPPRRPQARPWRSRAQVPLPPALLTDYRETPIDRGRVDTIERHLRALCRQGKP
FT                   AEALNYLMAPAQFNDLTATQTDRVRGWIAAAFYYDGQLTRAAQVAQQATQRSGDDAILS
FT                   HWILGLIHMRRDDPATAFGHFAAQARSPYQEDSLRAAAAFWAARSALRSGYTGQVTDHL
FT                   SLGAAYPFTFYGQLSLAMLGLESGIDWSIPPLTQRQFDQLVAKNRRVERAAALAQVGRR
FT                   DEAETELKWAQGELSAADDLALLSLAQAARLPNAQLLIAHQAAAETPANAHLRGGLFPA
FT                   PPFAPSNGFEVDRAVLFGLIRQESKFLPHASSRVGARGLMQLMPRTASYVADKANLSAV
FT                   HASERLLDPGYNMQLGQSYVRDLLETYHGGTGDLIGMALSYNWGPGNYARWKTATGIDD
FT                   PLLMIESVPNDEARHFVETVLTNFWLYRDRFGEAAPSRDSLAAGGDAVYVSVAQAGR"
FT   gene            202267..202343
FT                   /locus_tag="PB2503_t07280"
FT   tRNA            202267..202343
FT                   /locus_tag="PB2503_t07280"
FT                   /product="tRNA-Pro"
FT   gene            202462..202767
FT                   /locus_tag="PB2503_01427"
FT   CDS_pept        202462..202767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01427"
FT                   /product="NADH-ubiquinone oxidoreductase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01427"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08364"
FT                   /db_xref="GOA:E0TBI9"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBI9"
FT                   /protein_id="ADM08364.1"
FT                   /translation="MLARIYRPSRTAMQSGKRKTELWVLEFEGRSPRKTDPLMGWTSSA
FT                   DTLGQVKMTFDTKEAAIAYAKEQRLPYQVLEKPDQAPVPKSYADNFAFRRRTPWTH"
FT   gene            complement(202784..203788)
FT                   /locus_tag="PB2503_01432"
FT   CDS_pept        complement(202784..203788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01432"
FT                   /product="arginine/ornithine N-succinyltransferase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01432"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08365"
FT                   /db_xref="GOA:E0TBJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ0"
FT                   /protein_id="ADM08365.1"
FT                   /translation="MTSSVITLRPVRDGDEAALLALARASGGGMTSLPEDGDALTARVE
FT                   RSVQGLQRLAGRGGAGEPPLSLYLLAEREGVPLGSVALFALSGSGGPFVTYRLATAPQA
FT                   FPALGKAFAHEILEVSTAHRTSSELAALFVSPAGRGLSLGRALVTAAIAFCRHHREAFA
FT                   DILMAEMRGWVGPSGDRPFWDDIVMPFFGMSFLEADHLNATAGNAFIEALLPAHPLYLS
FT                   LLPPRVREIVGVPHPDGRAALALLQQEGLSTDGHFDPFDLGPCLSAPLDDLAARQERAL
FT                   AAGANRTDGGRGRGLWVEGRGAEFRCRLVPQGGTTAAGAGASHPGAPEWLPFD"
FT   gene            complement(203848..203924)
FT                   /locus_tag="PB2503_t07310"
FT   tRNA            complement(203848..203924)
FT                   /locus_tag="PB2503_t07310"
FT                   /product="tRNA-Arg"
FT   gene            complement(203937..204878)
FT                   /locus_tag="PB2503_01437"
FT   CDS_pept        complement(203937..204878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01437"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01437"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08366"
FT                   /db_xref="GOA:E0TBJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ1"
FT                   /protein_id="ADM08366.1"
FT                   /translation="MRIEHPAAGLWPSLALASVAALWGATFLLTQMGMDGAGPFSIVAL
FT                   RFGAAALILAALRPQQIRRITFYELKAGILLAAVALVGYGAQAVALQTAPSARVAFLAA
FT                   LYVPIVPVIGLVVWRRPVAAPVFIGALLALGGIVAMSHGGAHLGLSATDGLAALSAVSI
FT                   AAEVFLLGLVMRRADPLRVSFVLVLAIALMAGGVASLSGEAAPRWDGSLLTVVAIFGIG
FT                   TAYSQTIMGWGQARISPERASLLYATEPLWAGALGLAVGEALGTGDIVGGALIVMAVGI
FT                   SAMRRLPALPLPLRRSLRANRQSLLETGNGAR"
FT   gene            205005..205493
FT                   /locus_tag="PB2503_01442"
FT   CDS_pept        205005..205493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01442"
FT                   /product="transcriptional regulator, AsnC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01442"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08367"
FT                   /db_xref="GOA:E0TBJ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ2"
FT                   /protein_id="ADM08367.1"
FT                   /translation="MPAERSLDRIDRAILAELQHDGRLTNQRLAEKVALSPSACLARVK
FT                   RLEAAGVIRGYTARVAPSALGLPVTVFAELTLATHDLRRVRAVEVALRAMPEVVEALQV
FT                   SGSYDYLVRFVVSDMDRWSVLADSLFDGDLPLQKIVTVVMMKEIKSGGMLPMDTGALP"
FT   gene            205659..207281
FT                   /locus_tag="PB2503_01447"
FT   CDS_pept        205659..207281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01447"
FT                   /product="sulfate transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01447"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08368"
FT                   /db_xref="GOA:E0TBJ3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ3"
FT                   /protein_id="ADM08368.1"
FT                   /translation="MIQSGFAALADRLSAVTRTRPSDLDSGQIRIELLSGLTVALALVP
FT                   EAVAFAFVAGVHPLVGLYAAFMVGLITAIFGGRPGMISGATGALAVVMVSLVAEHGVEY
FT                   LFATVILMGVLQIVVGALRWGKFIRLVPHPVMLGFVNGLAIVIFMAQLGQFQVPGTAEA
FT                   SGHGMSGGEWLSGLPLAIMLGLVGLTMVIIWGLPKLTTVIPAPLAGIGITAILVILVGI
FT                   ETPRVGDLASIEGGLPSFHIPAVPFTWETLEIILPYAVVLGLIGLIESLLTLNLVGEIT
FT                   QQRGGASKECVAQGMANTATGLFGGMGGCAMIGQSMINVRSGGRMRLSGIAAALFLLSF
FT                   ILFAAPLIEQIPLAALVGVMFMVVIGTFAWHSFRILPKIPRTDALVVVLVTVVTVWQDL
FT                   AVAVVVGVIVSALAYAWNNARRMHANIVDQPTGRVYKLEGPLFFGSADGFRDLFTPQDD
FT                   PENVVIDFARSRVVDGSALQAIEDVAAKYEAAGKHLQLRHLSHDCHQLLRKAEQLIVDA
FT                   DDDPEYGIAVDYSVRTGAMGGGH"
FT   gene            207318..208241
FT                   /locus_tag="PB2503_01452"
FT   CDS_pept        207318..208241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01452"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08369"
FT                   /db_xref="GOA:E0TBJ4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ4"
FT                   /protein_id="ADM08369.1"
FT                   /translation="MAQAPVIKALDLPAFLLLLFLSLLWGGSFFFVEVALTAFSPLTIV
FT                   ALRVSLAAVILWLWVVLRRMPVPRSAGIWAAFAVMGVANNAIPFILIVWGQTTISSGLA
FT                   AVLNATTPFFTILLAGLLLPDERLTLRKLLGVAVGLSGVAVMIGPTALQGLGGALWGQI
FT                   AILGGTFSYACASVFGRRFAAMGVRPTVTAAGQVTMSSLLLLPLALKVDGSFGQSVPGW
FT                   GPVLSIIGIASLSTALAFIIYFHLLSTVGATNLVLVTFLIPISAIILGLLFLGEALTAP
FT                   QIMGMAIIGIGLSLIDGRLYRRQKVV"
FT   gene            complement(208262..210574)
FT                   /locus_tag="PB2503_01457"
FT   CDS_pept        complement(208262..210574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01457"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01457"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08370"
FT                   /db_xref="GOA:E0TBJ5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ5"
FT                   /protein_id="ADM08370.1"
FT                   /translation="MYIGDTDDGSGLHHMVYEVVDNAIDEALAGYCDTVTVALNADGSV
FT                   SVSDNGRGIPTEIHTGEGVSAAQVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSD
FT                   WLELVIYRGGKRHQMRFENGDPVDDLAVMGETDKSGTEVTFHPSADIFAITDFDFETLE
FT                   KRLRELAFLNSGVKIVLTDRRHVDPVVEELYYEGGLEAFVRYLDNAKSAIMGAPISFST
FT                   EKDGLVVDVAMWWNDSYHEKVLCFTNNIPQRDGGTHLAGFRAALTRVVNSYAQSSGLLK
FT                   KEKVSLSGDDAREGLTCVLSVKVPDPKFSSQTKDKLVSSEVRPVVESAVGEALNIWFEE
FT                   NPGDGKRVAQKVVEAAAAREAARRARELTRRKGALDISSLPGKLADCQERDPAKSELFL
FT                   VEGDSAGGSAKQARNRENQAILPLKGKILNVERARFDKMLSSQEVGTLITALGTGIGKD
FT                   DFNIDKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEIVRRGYLYIAQPPLYKVSRG
FT                   KSEQYLIDESALAEHLYSEGMDGAKLRLGSGEERAGQDFAAVVTAARASMQAVAAFPDR
FT                   FPRKVIVQTALSGLMGGTPLTEALTQKLIDRLDMTSEEYERGWAVTIEGGDGLVISRTL
FT                   RGVEERHHLTGNILQSGDARRLANAIAPLVPVFEQPAFLLRKDDELVVFGPGRLLDAIR
FT                   EAGQKGISVQRYKGLGEMNPEQLWETTLDANARQLLRVEIEEADQADDIFSRLMGDVVE
FT                   PRREFIQENALAAELDI"
FT   gene            complement(210830..211957)
FT                   /locus_tag="PB2503_01462"
FT   CDS_pept        complement(210830..211957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01462"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01462"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08371"
FT                   /db_xref="GOA:E0TBJ6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ6"
FT                   /protein_id="ADM08371.1"
FT                   /translation="MTITQDRVTRLALSSFRSYRSAEWRFEKRQTAFYGPNGAGKTNIL
FT                   EALSLMGPGRGLRRAALGDLTRQGSDGGWGIGVDLGTGEGRRRLALRAEGVPLKRHVQV
FT                   DGEPVRSTGTLLDSVRFQWLTPAQDRLFTDSPGERRRFLDRMVLARCPSHGRDTLTFEN
FT                   ALRQRQAALEAGWPPAILEPLEAQMAEAGIAIDEARRQTLAALQVNYERVQETAFPRAG
FT                   LSLSGPFEDIAGIPTLAARRESYADLLERGRRRDREAGRTLLGPHRSDLEVVHLGKDQP
FT                   ARLCSTGEQKALLIGLVLAHATASLAATQAPLVLLLDEVAAHLDEDRRAALAAMLDQLA
FT                   ICVFMTGTDRALFDAWGDRVDRLHVDGRNTVPGSE"
FT   gene            complement(211954..213075)
FT                   /locus_tag="PB2503_01467"
FT   CDS_pept        complement(211954..213075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01467"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01467"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08372"
FT                   /db_xref="GOA:E0TBJ7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ7"
FT                   /protein_id="ADM08372.1"
FT                   /translation="MQVTIERATLLKALHHTQSVVERRNTIPILSNVLMRAQGGSLALT
FT                   ATDLDIEIAETVPAEIAEEGGVTASAVTLYDIVKRLPDGGQISLNKSSGSSRLMLKSGR
FT                   SEFQLSILPDDDFPTLSDEAAGATFTISADALGRLLDRTRFAMSQEETRYYLNGVYLHA
FT                   LTEGEGAPSLRAVATDGHRLARLDSPLPPGAEAIPGVIIPRKAVLELRRLLDDADGDVA
FT                   VTVTPAKIRFAFGDIVLVSKLIDGTFPDYQRVIPSGNDRVMKVDNDAFRRAVDRVSTVS
FT                   ADKTRSVKLSLTEDQLTLLVNNPETGSATDELSVDFKSTDLEVGFNARYLLDIADQISG
FT                   ETAVFHFADAASPTLVTDEEDEGALYVLMPLRV"
FT   gene            complement(213177..214688)
FT                   /locus_tag="PB2503_01472"
FT   CDS_pept        complement(213177..214688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01472"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01472"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08373"
FT                   /db_xref="GOA:E0TBJ8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ8"
FT                   /protein_id="ADM08373.1"
FT                   /translation="MSTDDQELCFAAFKRGLETRFGEMTYKSYFAGLTLRDWTEQRAVI
FT                   ATDNRYQAERITHWYADEFISTWDVHCGRVEEIELTGGAGMRSVITKSKASRSAGARPS
FT                   VQLSVARRADRAVSRPVTPQLPPRKSMATSPVAKETDRHTATEPTTSEGEGSERFNDNF
FT                   NVSQTFESFSVNDTNRMAVLAIEQIIEGAGSPVTYIYGGVGRGKSHLLSAAANQFLRRY
FT                   PGRRLIFLTYDSLVADVSDAIVSRSLKELRAHLRDTDLLIFDDVHMLRGRKRTQEELAC
FT                   LIERLEQMGKPILVTGAVSPKELAETGILCRLTDRLGGGARVPLNRPDYDLRLKIAQRC
FT                   SDVFTLRTGLQMPRRHIEYIARKSEGCVRELLGAMRFYELSVQLDPTVLSKDDQETQAH
FT                   LAQVLKSRRRETTLDDVFDVTADQFGVGKDDLRGKSRKRYLVHARHAFALAARRLTDAP
FT                   LAAIGGMLQRDHTTVINSITKGEILAESDQAFGEKISKIFEAFEQ"
FT   gene            complement(215313..215579)
FT                   /locus_tag="PB2503_01477"
FT   CDS_pept        complement(215313..215579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01477"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08374"
FT                   /db_xref="GOA:E0TBJ9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBJ9"
FT                   /protein_id="ADM08374.1"
FT                   /translation="MANTSSAKKMVRKIERRTAVNKSRRSRVRTFLRRVEEAIANGDAA
FT                   AASSAFAEATSEVQRAVSHGIIHKNTASRKLSRLSGRIKAIAA"
FT   gene            complement(215641..216501)
FT                   /locus_tag="PB2503_01482"
FT   CDS_pept        complement(215641..216501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01482"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01482"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08375"
FT                   /db_xref="GOA:E0TBK0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK0"
FT                   /protein_id="ADM08375.1"
FT                   /translation="MPELPEVETVRRGLAPSMAGAMIERVELRRPDLRFPFPNGFSQRL
FT                   EGNRILSVDRRGKYLTLPLSTGETLIMHLGMSGRFLVSGERAPGRFYHASAGDVAHTHV
FT                   RFTLQIPAEGRGHVAYADPRRFGFMDLVASGELATCRHFAQMGPEPLSEAFTPDHLVAE
FT                   ARGRRTPLKSFLLDQSTVAGLGNIYVCEALWRARLSPRRLAASLGPKRATRLVAAIQDA
FT                   LEDAIEAGGSTLRDYHAADGAMGYFQHRFDVYDREGEPCRQCGRSISRFAQSGRSTFSC
FT                   TTCQR"
FT   gene            complement(216574..216987)
FT                   /locus_tag="PB2503_01487"
FT   CDS_pept        complement(216574..216987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01487"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08376"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK1"
FT                   /protein_id="ADM08376.1"
FT                   /translation="MRLRRLIGLTVGAVAVSGTAVAEDRPYEVLAATLDGRVTMAIVDR
FT                   QGAAIAIEIGDDRPEIIQGLAAGAILSDLREIVSGEGDRQYTVSSGIASSVVRLNGDIQ
FT                   TGRATPAEAARLIDDLPGLTITQKGQLKAILSL"
FT   gene            217228..218910
FT                   /locus_tag="PB2503_01492"
FT   CDS_pept        217228..218910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01492"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08377"
FT                   /db_xref="GOA:E0TBK2"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK2"
FT                   /protein_id="ADM08377.1"
FT                   /translation="MRAVRAVFIGAAALLTFPFAGCSSGGGGGGDDGVATSPTPMDDGG
FT                   SGGSSPPLSAGDPQWRAGEYPPADDFKDRCAAPRSGVDSEGNVFPDQPGSLRDEQFWLR
FT                   SWTHETYLFNDEVIDRDPADFPSAAAYFDVLKTEETFRPGKPKDEFHFSQPTADYLDSR
FT                   NAVASIGYGAAITVVRPTPPREIRITATQERAPTAFVPGAQLVAVDGIDLVHGITTEAE
FT                   RRTALAALYPRAAGEVHHFHLRVPGEAALRTVTAQAIPVKGGAVDDLQTFATTEGRTGY
FT                   IRIGTFGTYQAERDIFDAMSTLEAADIEELILDLRYNTGGILAIASQLSYMIAGTSRTR
FT                   DKVFEGFRFNDDAGELNPTTGDPNTPFPFYDTGLGFSLTATTALPTLNNLDRVVILTSG
FT                   ETCSASESVLNGLRGIDFPIVVIGGGTCGKPFGFFPTDNCGTTYFTLQFEGINDKGQGG
FT                   YIDGFIPADSPAPYGERLPGCAIEAAPSDPIGEAGDPLYDAALTYIETGSCPATPTSPL
FT                   ASAMAAGPQRSGAVATRAAIGLPLIPDRGISAGRARDVVRPAK"
FT   gene            218907..219296
FT                   /locus_tag="PB2503_01497"
FT   CDS_pept        218907..219296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01497"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08378"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK3"
FT                   /protein_id="ADM08378.1"
FT                   /translation="MTPSPLRLCLLFVLAVGSAACAASPAGGTDAPLLTPALLIGDEDD
FT                   ARAVIRQTLAEALARPSLALGPTELHRSSLIPLLPPPSANAPGKSLARPQTVTLAHSEA
FT                   QCWLTGGPLPRPLRLPPLLRCRAEG"
FT   gene            219422..219955
FT                   /locus_tag="PB2503_01502"
FT   CDS_pept        219422..219955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08379"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK4"
FT                   /protein_id="ADM08379.1"
FT                   /translation="MEAFVMNKDYKNTAIALLSLSAASLSTSALAATLQDSDGPVENYF
FT                   EKRAEQAENFGQKAQETSQAGSESLDDRAERRSDLARERAANRGEAVEQFGDNVEERLN
FT                   DNGQKADQFGDNIQRRAENYNDATRERAEDKAERRDNANEALADRAENYGQNAEQRAEE
FT                   RSENRSWFARWFGD"
FT   gene            complement(220183..221826)
FT                   /locus_tag="PB2503_01507"
FT   CDS_pept        complement(220183..221826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01507"
FT                   /product="putative heat shock protein groEL"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08380"
FT                   /db_xref="GOA:E0TBK5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK5"
FT                   /protein_id="ADM08380.1"
FT                   /translation="MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFG
FT                   APRTTKDGVSVAKEIELEDKFENMGAQLIKEVASKTNDEAGDGTTTATVLAQAIVREGA
FT                   KSVAAGMNPMDLKRGIDLAVTKVIEQIRSNATPVSGSAGIEQVGTISANGEKEIGEMIA
FT                   KAMEKVGNEGVITVEESKTAETELDVVEGMQFDRGYLSPYFITNAEKMTTELEDPYILL
FT                   HEKKLSNLQSMLPLLESAVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAVLTGGQVVSEDLGIKLENVTLDMLGTAKRVTITKDETTIVDGAGDKD
FT                   DIEGRTAQLRKQIEDTSSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDA
FT                   LNATRAAVEEGIVPGGGTALLYAARALDGLEGVNDDQNAGIHIIRRAVQAPLRQIVENA
FT                   GQEGSIVVGKLLEQDDTKFGFNAQTEEYGNLLDMGIVDPAKVVRHALQDAASVAGLLIT
FT                   TEAMIAEAPKKDSGGAGGGMPDMGGMGGMM"
FT   gene            complement(221887..222174)
FT                   /locus_tag="PB2503_01512"
FT   CDS_pept        complement(221887..222174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01512"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08381"
FT                   /db_xref="GOA:E0TBK6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK6"
FT                   /protein_id="ADM08381.1"
FT                   /translation="MAFRPLHDRVLVRRVEEDERTAGGIIIPDTAKEKPQQGEVVAVGS
FT                   GARGDDNEIVPLELKAGDKILFGKWSGTEVKVDGEDLIIMKESDVLGILD"
FT   gene            222430..223269
FT                   /locus_tag="PB2503_01517"
FT   CDS_pept        222430..223269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08382"
FT                   /db_xref="GOA:E0TBK7"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK7"
FT                   /protein_id="ADM08382.1"
FT                   /translation="MAAHHTESLRPEGEAEASEAYAGSASEPTTKTSDPSPATEARHRR
FT                   CRRAALLDRPALDEAFGMCQRAPAGCHLLRDRPSLSTCLADRDRLSALPRGTLGRAYYV
FT                   FTEREGRTAPLTTLSTAEERDGGEEAGELSYMRDHLYHAHDLLHVLTGYGRDTIGELCL
FT                   LAFVRPIGRPATSGAPFPASAEPPRARWLAWLGGLGAFKRFGGLPLFRCLNEARKLGLQ
FT                   AEALSTLPWEKLVEHPLEMIRRRYGVGSPTLYLSIKDLAEKIDGNTCPMPTPVLSAA"
FT   gene            223375..224067
FT                   /locus_tag="PB2503_01522"
FT   CDS_pept        223375..224067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01522"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08383"
FT                   /db_xref="GOA:E0TBK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK8"
FT                   /protein_id="ADM08383.1"
FT                   /translation="MSGEHLSDQAEKGASEAARNGREALIASALSLVKERGYAALSVSA
FT                   ICKRAGVSAPSLYHHFGDKAGLLLALIEECLAQDATAMMSKIEGKEPPLQRLQRFIAIF
FT                   REFFTGRTVDTATVVFAISQGRGESEAIANAVDKAQRAIVTFTAARFADILGMKDAQVF
FT                   ADLFLSFAAYLSQIAQTSAPDRDERLHRAVKHFERFFILGIGAERPEFLKDADFAAAHA
FT                   KAASPQLA"
FT   gene            224093..224887
FT                   /locus_tag="PB2503_01527"
FT   CDS_pept        224093..224887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01527"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08384"
FT                   /db_xref="GOA:E0TBK9"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBK9"
FT                   /protein_id="ADM08384.1"
FT                   /translation="MFDGPYQAYSQHRRPLSALAAVARLIKNKEDTAQVFRIIAALDGP
FT                   SLNTAFERFAESEQGRHYLKTRPCLRTALMDHEWLASLPAESFGRAYYDFISKEGLSAD
FT                   GLQHEMDHSGERFDEAGPDRQYFAYRIRHSHDLFHILTGYGRDAIGEVSVLIFTVHSSS
FT                   KASADEKQVRSYGISLIAALGRLKIRREFPNFPVEKCLAEARALGDAARPLTLAPWEDL
FT                   LDQPLEEVRARYNIARPQTYLSIKDSISAADEEYRDRLAAAA"
FT   gene            225142..225966
FT                   /locus_tag="PB2503_01532"
FT   CDS_pept        225142..225966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01532"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08385"
FT                   /db_xref="GOA:E0TBL0"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL0"
FT                   /protein_id="ADM08385.1"
FT                   /translation="MVYNGPYEVFTEKRRPVDAAISAFRLVYNKEDTSKVFRVIAALDG
FT                   PALEMGFKRFASTPYGQHLLAERTCLRETLMRHDWLASLPEGSLGRAYYDFMAAEGLTA
FT                   DGFQEEMNRTGETFEAAGPERRYFLYRMRHAHDLIHVLTGYGRDAIGELSILQFTANLG
FT                   ANKMPKGKLHNAGVKLIVLTGWLKARRMYARFSMDRCLAEAKELGANAKSLFLAPWEDL
FT                   LPQPLEAVRATYRIGRPDFYLSMKSALADFDVMRRAQLAAKAHKKTQTAEAA"
FT   gene            226127..226621
FT                   /locus_tag="PB2503_01537"
FT   CDS_pept        226127..226621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08386"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL1"
FT                   /protein_id="ADM08386.1"
FT                   /translation="MSAEWEIRHMLTVLALTLLEAISPLDVEGTWQTEDGRSKVEIRLE
FT                   EGEKPVGRVVWVDPQSLDPARAAGPIYDRHNPDSQMALRPIIGLPIIYGFERSETAWRR
FT                   GEIYDPSQGATYRARLQRVDQDTLMVKGCVAVLCREQIWTKSPLLAQHEAEALALSPDP
FT                   Q"
FT   gene            226695..227702
FT                   /locus_tag="PB2503_01542"
FT   CDS_pept        226695..227702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01542"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08387"
FT                   /db_xref="GOA:E0TBL2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL2"
FT                   /protein_id="ADM08387.1"
FT                   /translation="MRVMRLGSPQKLENLVLGDLDDPGAPAAGEVRVRIEASSLNFHDY
FT                   SVVKGMLPTEDGRIPLSDGAGTVEAVGEGVTSLSVGDQVVSVFFPHWQDGAPAIGDFST
FT                   TPGDGVDGYARTIVNRPATWFTKTPKGWSAAESATLTTAGLTAWRALFVDGSLKAGDTL
FT                   LCLGTGGVSIFALQFAKAVGARVAMTSSSDEKLAKTEEMGADFTVNYKSNEKWGKAVAQ
FT                   WTGGTGVDHVIEVGGPATLSQSITATRIGGHIHLIGVLTGIQGEIPTANMMRKQITLQG
FT                   LIVGNHRQQRDMIKAIDATGLKPVIDKTFDLSELASAFQYEADGKHFGKIAISI"
FT   gene            complement(227841..228917)
FT                   /locus_tag="PB2503_01547"
FT   CDS_pept        complement(227841..228917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08388"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL3"
FT                   /protein_id="ADM08388.1"
FT                   /translation="MASVSIIAGVALTVLSLVPSPALAALAPVEPAQISAGDGAVTIRH
FT                   FVGRLVIEEGDQLAVQVMAAPLGGPLDMTSPAEGLVIEGDEAAIDAIYQARWRAWSARG
FT                   RSGEGQEGFVQFLSDYPVMRLSLPPGTPLSIETSALFIDGGGLPLAALALDNIFEVYGT
FT                   IGSASSARLTVRGNSDLSLGAVDGDLAISIAGRGTVHAGPSQSASVVLRGSGEVELGPV
FT                   AETASIDIRGSGDVIGEGLGQLDLHIGGSGDVRFGAIADGATIAINGSGDFEATRIGGP
FT                   LSIAVNGSGDIDIGEGETTATSLMINGSGDVRFGGLATDPSVRIGGSGTVRIADYRGNV
FT                   VVRGKTDDVRIGDLRFED"
FT   gene            229134..230708
FT                   /locus_tag="PB2503_01552"
FT   CDS_pept        229134..230708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01552"
FT                   /product="proline/sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08389"
FT                   /db_xref="GOA:E0TBL4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL4"
FT                   /protein_id="ADM08389.1"
FT                   /translation="MEIGTFVSLGAYFLLMLGIGFYAYRTSTGDTSEYMLGGRKLGPAV
FT                   TSLSAGASDMSGWMLLGLPGAAFVSGLPATWIAIGLTLGAFANYLVVAPRLRLYTERAD
FT                   DALTIPDYFEKRFHDNTHILRVFSSVVIVLFFTLYTSATLVGGGKLFESAFGQDYITGL
FT                   WITAGVVMAYTFVGGFLAVSLTDFVQGCIMFIALLIVPIAAFTQLGDNVDLAAILADIG
FT                   PALSGEIAGGLDSPTLNLFAGASFLGTISLLAWGLGYFGQPHIIVRFMAIRSVADVPMA
FT                   RHIGMSWMIVALIGSVSTGLIGLAYIAQNGVPMEFVDENGQFDPETVFIVLSQILFHPL
FT                   IGGFLLAAILAAIMSTISSQLLVASSSLTEDFYKLFLRRGASDKELVMVGRISVILVAL
FT                   VAILLAYDDNSSVLDLVANAWAGFGAAFGPVIIISLHWRKMTMPAAFLGMVVGAVTVII
FT                   WTYLPLLPDADGVARQIPLNSELYSIVPGFLFCWLTVWGVSLFTHPKEAVIATHDAVHA
FT                   EITGGSA"
FT   gene            230695..231213
FT                   /locus_tag="PB2503_01557"
FT   CDS_pept        230695..231213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01557"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08390"
FT                   /db_xref="GOA:E0TBL5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL5"
FT                   /protein_id="ADM08390.1"
FT                   /translation="MDRPDLSASDADLERWMDHALGLASMAARNGEVPVGAVLLSATGQ
FT                   LIAEAVNTPIAQCDPTAHAELAVLRKGALATGNYRLTGTTLLVTLEPCAMCAGAICHAR
FT                   IGHLVYGADDPKGGAVRHGATLFDQVTTHHRPRVTAGIRADESAALLRSFFAERRAMTR
FT                   PRRHGESGP"
FT   gene            complement(231263..231658)
FT                   /locus_tag="PB2503_01562"
FT   CDS_pept        complement(231263..231658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08391"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL6"
FT                   /protein_id="ADM08391.1"
FT                   /translation="MLVAFALSGGAQQEATHDAFDRLTTNSGLMAKGFSSGEGRLYRAS
FT                   GTQIRFHFVHDGRAGQIEFVCRPVQSRCGTRHDLVAQRGVGGDVIFLSAQDVPVVRLTP
FT                   AGSGTLLGGAPFVPIRVPKKGLAFLPE"
FT   gene            complement(231910..232635)
FT                   /locus_tag="PB2503_01567"
FT   CDS_pept        complement(231910..232635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01567"
FT                   /product="Short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08392"
FT                   /db_xref="GOA:E0TBL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL7"
FT                   /protein_id="ADM08392.1"
FT                   /translation="MTKTAIVTGGTRGIGYAITARLKTDGLNVVALYGGNDEAAAACAD
FT                   KLGVDVFKCDVSDPDACAATIDEVQKKHGAVDVLVNNAGITRDSALHKMSREQWREVIS
FT                   TNLDSVFNMTQPILAGMRDRGFGRIINISSINGQKGQFGQTNYSAAKAGVIGFTRALAQ
FT                   ETARKGITVNAIAPGYIETDMVAAMKPEAREAVIAQIPVGRLGQAEEIAHAVAFLADDL
FT                   AGFITGAVLTANGGQYIAA"
FT   gene            complement(232763..233986)
FT                   /locus_tag="PB2503_01572"
FT   CDS_pept        complement(232763..233986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01572"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08393"
FT                   /db_xref="GOA:E0TBL8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL8"
FT                   /protein_id="ADM08393.1"
FT                   /translation="MGCSQLRNEKDITMTSNAVYIVSATRTPIGTFGGTLAPLAAADLG
FT                   KIVITEALSRASVAPDRVNEVIMGNVLTAAQGQNPARQASIHAGIPKECPAMTINQVCG
FT                   SGLRAAMLAAQIISAGDGDVVVAGGQESMSQAPHAQTLRTGQKMGPISLVDTMIVDGLW
FT                   DAFNDYHMGQTAENLAERYQISREDQDAFAASSQQKAAAAQQAGRFDDEIVAVTVPGRK
FT                   GDTTLEQDEFIRPGTTAEKLGGLKPAFKRDGGTVTAGNASGLNDGAAALVLMSEAALKE
FT                   SGATPLARVASLAHCGVDPAFMGIGPAPASRRALDKAGWSIDDLDLIEANEAFAAQSLS
FT                   VGKELGWDAEKVNVNGGAIALGHPIGASGARILTTLLHELKRRGGGKGLATLCIGGGMG
FT                   VALCVEVA"
FT   gene            234089..234736
FT                   /locus_tag="PB2503_01577"
FT   CDS_pept        234089..234736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08394"
FT                   /db_xref="GOA:E0TBL9"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBL9"
FT                   /protein_id="ADM08394.1"
FT                   /translation="MAEKQSAETAQNSPRRQRQAPDEPTIIKKYANRRLYNTATSSYVT
FT                   LETLAAMVRGGENFIVIDAKSGQDLTRSVLTQIIFEQENKGENLLPVSFLREIIGLYGD
FT                   NLQSFVPSYLEMSMEAFKKNQEAMRRSVSEALTAPQSGLKIFEDAARNNMAFFEQGMKM
FT                   FGLGRARGMTGDPQPELDALRAEVETLRSELAKAKGEDKARSEDKAKGDKPS"
FT   gene            235319..236200
FT                   /locus_tag="PB2503_01582"
FT   CDS_pept        235319..236200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01582"
FT                   /product="beta-lactamase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08395"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM0"
FT                   /protein_id="ADM08395.1"
FT                   /translation="MAFILGTSGNDNAVSTAPLDIFLGLGGDDVYQAGSGIDIALAGAG
FT                   SDQLIGGAGLSIFGGGAGADLFTLAAGAGGTMNILDFEQGIDLIDLSEYGIKELAEIDV
FT                   SYSDNGASVFVGDAVINLRNFFGDLTEEDFKFDVDTIDFEDITPADRYAPIPTGYNGFT
FT                   WFNLAVIDVAAQDAQFPLNGYEANSGTNAMFNEFGGSASISRSANFDFDSFYASAAWNE
FT                   GLQLEVSGYDDGVFIGSQTFTLSYDVSNFYELDDTIFDSVDQVEFSTFGGVDDPNDDGT
FT                   GTQFSMDDLVIG"
FT   gene            236365..236832
FT                   /locus_tag="PB2503_01587"
FT   CDS_pept        236365..236832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01587"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08396"
FT                   /db_xref="GOA:E0TBM1"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM1"
FT                   /protein_id="ADM08396.1"
FT                   /translation="MGIINEFKQFAVKGNVVDLAVGIIIGGAFSTIVKSLVNDVIMPPI
FT                   GWLTGGVDFSSLYINLQDITGAEAAYASLDAAREAGAPVIAYGLFINNIISFVIVAWAV
FT                   FLLVKGMNSLQKKAEDEKAAAPVEPPKDVVLLTEIRDLLKAQGEAPIPSPS"
FT   gene            complement(236953..238926)
FT                   /locus_tag="PB2503_01592"
FT   CDS_pept        complement(236953..238926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01592"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01592"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08397"
FT                   /db_xref="GOA:E0TBM2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM2"
FT                   /protein_id="ADM08397.1"
FT                   /translation="MPTITLPDGAVRTYDAPLTGAELAGDISKSLAKKALAVKVNGTVV
FT                   DLWDPIKSDAAVEIVTRDSEEGLDLIRHDAAHLLAQAVQALFPDTQVTIGPVIEDGFFY
FT                   DFARKTPFSTEDFDAIERKMAALVDADLETRKEVVSREEAARLFEAQGEHYKAEIVRDL
FT                   PTDEEVKIYHHGDWYDLCRGPHLPSTKHIGKAFKLLKLAGAYWRGDHRNEVLHRIYGTA
FT                   WANEKALKAYLTRLEEAEKRDHRRLGKQMDLFHLQEEAHGSVFWHPKGYTMWLALEAYI
FT                   RRRLDAAGYKEVKTPQLIDAKLWQSSGHWGKYSQNMFVVPDEVPDVEGEGPVIDPEAKL
FT                   MAVKPMNCPAHVQIFRQGITSYRDLPIRMAEFGCCHRNEPHGALHGIMRVRQFTQDDAH
FT                   IFCTEEQIVEETIRFCELASSVYRDLGFEDVRVAMATRPEQRIGTDEFWDKMESALEEA
FT                   LIAAGLEFEVLPGEGAFYAPKLEYHLRDAIGRSWQCGTLQLDALLPERLDAVYIDEDGA
FT                   KKRPIMLHRAILGSMERFLGILIENHAGRMPLWLAPTQIVVATITTDVNAFAEEAADAF
FT                   RAANLRVETDLRNEKINYKVREHSDGKVPIIAVIGAREAEERTLSVRRLGSKQSQTLSL
FT                   DEAVAVFAAEALPPDLRDRADS"
FT   gene            complement(239017..239742)
FT                   /locus_tag="PB2503_01597"
FT   CDS_pept        complement(239017..239742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01597"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08398"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM3"
FT                   /protein_id="ADM08398.1"
FT                   /translation="MLSVLSSVVAIVSSMTGGPEMLPVRTVGPVMPSAVAANLEATGWT
FT                   IIHQSRSADGQVRVLGARNDDGWAIFHRFADCEGERCGAWYQLAELSPQFLGHDAAIDG
FT                   GAGLTDGPLDARGDAAAALTPVTRSDAVRDHCDAACQRHQIETFATSTYDRTTLCTLAG
FT                   DAGRQTEGSDALAPVGACGTGWVRTAGAQEDDGAVPMHHRQIAAIVAETEALAEMVTVG
FT                   RTRALSITTFPLLLPSRDR"
FT   gene            complement(239833..241026)
FT                   /locus_tag="PB2503_01602"
FT   CDS_pept        complement(239833..241026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01602"
FT                   /product="flagellin protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01602"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08399"
FT                   /db_xref="GOA:E0TBM4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM4"
FT                   /protein_id="ADM08399.1"
FT                   /translation="MTAIGFSLPSQKALSALRIIDRDLAATERMIATGKEVAEPADNPY
FT                   RYTTAMRLRGDATTAQTIADSLSLSASTLAVGASAAEQVQSLLGEIETLIASAEASGAN
FT                   RTAIQTDIDNIVDQISSVVTSARFNSVNLLSGSDPYRVFAGLTATDNGSPAVQTLTFAR
FT                   ADLTQSAGTTGTGKTSGEAGAVHAGSGLFSDSATTSVADSSSGSVTFASGAVEAGDIYT
FT                   LTLGGETARYRAVAGDTADSVAATLGNRLSGLVGTGITVAVASNVVTVTNASGGSLTLS
FT                   ATANAGAAGGGLEDLAQLNVGSSDAALSALADIEGLIDLADRAVASLGSAQSRIGAQQT
FT                   LLEDIAGQYEAGAAALTDADLAEAAAKLQLLQARQALALEALEIANSAPSRLLSLFD"
FT   gene            complement(241135..241392)
FT                   /locus_tag="PB2503_01607"
FT   CDS_pept        complement(241135..241392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01607"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08400"
FT                   /db_xref="GOA:E0TBM5"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM5"
FT                   /protein_id="ADM08400.1"
FT                   /translation="MSWGARGAIALLRVYQMTLSPLFYGAGVRCRHLPTCSDYAIEAYR
FT                   TYPLMRATGLTAGRLLRCRPGGSHGYDPVPPQPHRQAGGN"
FT   gene            complement(241392..241820)
FT                   /locus_tag="PB2503_01612"
FT   CDS_pept        complement(241392..241820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01612"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08401"
FT                   /db_xref="GOA:E0TBM6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM6"
FT                   /protein_id="ADM08401.1"
FT                   /translation="MDDLYSDSLLEAAAGIPPVADMSDMAARARRTSRVCGSEVEVGLA
FT                   MEGGRVTDIALDVKACALGQAAASLFAGTVRGATAAEVRQVAAQMRAMLTADGPSPDGR
FT                   WAALAQLAPIRAYPARHASTLLVFDAAVDCVDHLTKVA"
FT   gene            241895..242920
FT                   /locus_tag="PB2503_01617"
FT   CDS_pept        241895..242920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01617"
FT                   /product="cation antiporter (Na+/Ca2+)"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01617"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08402"
FT                   /db_xref="GOA:E0TBM7"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM7"
FT                   /protein_id="ADM08402.1"
FT                   /translation="MLVIDSPIALLATGAITALLIVFTGIRLSKVADILADRTGLGEAL
FT                   AGALMLGAVTSLSGLVTSVTAASRGLPELAISNAVGGIAAQTVFLVIADLSYRRANLEH
FT                   AAASLENMMQGALLIACLSLALAAMSVPDIAIFSIHPASIAIVALYLGGLPLVRGAREV
FT                   PGWRPRSTIETSMDEPDPDNEERPLRPLMIEFLALAALTAGSGYFLAAAADGAVARYGV
FT                   SEALLGAFATAIVTSLPELVTTLAAVRRGALALAIGGIIGGNSFDTLFIVASDIAYREG
FT                   PIYADIANSQQFLMTLTILMTAILVMGLLSRQRQGPGGIGFETILLIVAYLGGAAILAL
FT                   L"
FT   gene            complement(242927..244594)
FT                   /locus_tag="PB2503_01622"
FT   CDS_pept        complement(242927..244594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01622"
FT                   /product="putative cholesterol oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01622"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08403"
FT                   /db_xref="GOA:E0TBM8"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM8"
FT                   /protein_id="ADM08403.1"
FT                   /translation="MGQNYSNNKQNIQKAAKQTKSGVSTGRRDLLKVGLASALSTSVLS
FT                   APAIARPFRQRERHRAVIIGTGFGGAVTALRLAQAGIDVTLLERGIRWPSGPNGDTFPD
FT                   FEGASKDPRTTWLSNAPAFQPIGQGGVLPDKVLEKLFFKPFTGLQERVVGNGLDIICGA
FT                   GVGGGSLTYQGVTMQPSEAQFVADLPGLDYGKFDRDYYRRVEAMLRLAPIPDDLLYHPT
FT                   YKAALQWHDRIAAAGETPYRTRMPIDWSFAQAELRGEMKPVYTTGDLVFGVNNGGKFSL
FT                   DKTYIAAAEATGRVSLKVLHNVTDIHRDRWGRWLVDVDIIDTGGEVMQRKRLVTDALFL
FT                   GAGSAGTTRLLMKAKAKDQIADLPDDVGGQWGNNGDRIFVWRPSDVSPGPQQGGPTAIA
FT                   LQDWDNPGGPLTLMQGPVPAKVDVGVSTLVGFGPVSPGGYFTYDERKDDAVLNWDQAVD
FT                   RELTQRITAKMQEVVGPDDLLFDTTTAETTTWHPLGGAIMGKVCDLAGRVMGQTGLYVV
FT                   DGALIAGSTGACNPSMTIAALAEHCIETVLKEDLGRVF"
FT   gene            complement(244812..246185)
FT                   /locus_tag="PB2503_01627"
FT   CDS_pept        complement(244812..246185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01627"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01627"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08404"
FT                   /db_xref="GOA:E0TBM9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBM9"
FT                   /protein_id="ADM08404.1"
FT                   /translation="MSLSFYDTFRGHVEPFTPADPERITVYCCGPTVYAPPHIGNARAA
FT                   LTADLVVRLLKDRYGAEKVIFARNFTDIDDKIIAAAKDEGVPIDVVTARATAAYLEGLD
FT                   GLFCLRPDVAPRATAHIDSMQALIGSLLERGHAYGAEGHILFDTQSFPAYGQLSRLDRE
FT                   AILAGARVEIAPYKRDAADFVLWKPSPAEVPGWPVPASWPIDGEGRPGWHIECSAMIAS
FT                   VLGPSIDIHLGGQDLRFPHHENEIAQSCCGTDTGETPLARYWLHNGMLRFGGEKMSKSR
FT                   GNIETPQDLLAAWPGEAIRLALMSAQYRQPLDWSNELLAGSKAQLDRFYRVVPDGPAKA
FT                   AMPDWVMAALEDDLNTPKALAMMHELREAAGRGDIEAAHGLKAAGAFLGFFRQTADEWF
FT                   RGATADGPTESDIDAQIAARQAAKTAKNWAEADRIRDELGAQGIVLEDGPEGVTWRRR"
FT   gene            246365..246976
FT                   /locus_tag="PB2503_01632"
FT   CDS_pept        246365..246976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01632"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01632"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08405"
FT                   /db_xref="GOA:E0TBN0"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN0"
FT                   /protein_id="ADM08405.1"
FT                   /translation="MSVIAYERSPHARDHDRPSREAAEEAVRTLIKWAGDDPGREGLID
FT                   TPARVARAFEDWFSGYGEDAEAVLSRTFEEVEGYDDIVLMRDIRLESYCEHHMAPIIGK
FT                   AHIAYLPDGKVVGISKLARLVDIFGKRLQVQEKMTAQIADTLERVLKPKGVAIMVEAEH
FT                   QCMSTRGVHKHGVDTMTTRFTGVFKDDPALESRFFKLIGR"
FT   gene            247392..248564
FT                   /locus_tag="PB2503_01637"
FT   CDS_pept        247392..248564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01637"
FT                   /product="putative dolichol-phosphate mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01637"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08406"
FT                   /db_xref="GOA:E0TBN1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN1"
FT                   /protein_id="ADM08406.1"
FT                   /translation="MSLSLVQPAAPEIASPSPLRAPVALAAKAPELAVIVPVYNEAANV
FT                   VRLVDVLDEALQGIAYEVVFVDDHSPDGTAHLVRLLGRERPYVRCVERLGRKGLAGACV
FT                   EGVMATTAPVAVVIDGDLQHDERLIPDMLQTLRRDSLDLVVGSRYAEGGSLGVWEEHRA
FT                   KASRLATRLARAATGVDLTDPMSGFFMVRTDKFRDIAPSLSTKGFKVLLDFFASCETPP
FT                   KFAELGYTFRTREAGESKLSGGVVLDYIELMLDKTLGRYGIPASFVMFCAVGSIGILAH
FT                   LAVLSALYMLAGVSFLTAQLIATVAAMTSNFVLNNELTYRDRRLRGWRLVPGWASFCLA
FT                   SSIGATANVGVASWIHNGGGTAWWLSAVAGIAVGVVFNYVATAMATWRRP"
FT   gene            248662..249075
FT                   /locus_tag="PB2503_01642"
FT   CDS_pept        248662..249075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01642"
FT                   /product="phosphoribosyl c-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01642"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08407"
FT                   /db_xref="GOA:E0TBN2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN2"
FT                   /protein_id="ADM08407.1"
FT                   /translation="MTATAIDETDRFSPRFDDRGLIPAIAVEATTGQVLMLAYMTAEAI
FT                   ERTLTTGEVHYWSRSRGELWHKGATSGHTQKLVEMRVDCDQDTVLVRVEQSGPACHTGR
FT                   PDCFYRKVEGPPTAPSLSFDANAPSPCRQTDRS"
FT   gene            249072..250439
FT                   /locus_tag="PB2503_01647"
FT   CDS_pept        249072..250439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01647"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08408"
FT                   /db_xref="GOA:E0TBN3"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN3"
FT                   /protein_id="ADM08408.1"
FT                   /translation="MKPAFFGDGRSLLSVASVLAARVAGAAAGFFALALVARLLSPAET
FT                   GTFLLMQSAVSLAALFALGNLDGAAIRILPGAEETRPGTTHLFLKTLSQTAMIGVPLAF
FT                   IAVSLGLWLTTPLTLIGALWAGCGLLGFVALRSSARVARALGEVRISSAMQLAGRPILF
FT                   FLCLSVTAAIVLMDLSAAVAAFALAAMIAGLGHMTITAKRLHRRLRSPPFAGEIRPWRM
FT                   TGLALLITVLLTEEYPNTVLFIANFALDEAALGELGVALRLALLVKMVPASVLMAFGPQ
FT                   VVAALKRNGPTAASPIALTVTRISATVTAAAALGMALCAVPLLGLFGETYSADPLPLFT
FT                   LLTVPIANAVFGPNLLILATAGKNRRLVTLTLLNLAIMTIAVLTVAPHGLLAISIVIAV
FT                   AFVLWEVTLYLAARETTGINAWLPRALAPLPRAEQPPKTEAAPEAAHRTSQLPSGS"
FT   gene            complement(250324..251508)
FT                   /locus_tag="PB2503_01652"
FT   CDS_pept        complement(250324..251508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01652"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08409"
FT                   /db_xref="GOA:E0TBN4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN4"
FT                   /protein_id="ADM08409.1"
FT                   /translation="MMMAAFIILPLNMPMMQPVRAPFTLLLLAYLAFIGRPLLAAAWRH
FT                   RWVYILPALAAASAIWADSASAALRHGILMTVMVTVALAAAIRLDIRQLAIAVLFSQGA
FT                   LALGSLMSMETMWVGGAHGAEAVVGLFPAKNVLGKRMLLVVLAAVAVMVGAGYRPVFKP
FT                   IALGLSGIALFLIVQSLSASSIILLALAVPLGVGLAVVWRPATAIRGARPVIVSGVFLL
FT                   LALGATFAIIGLRIDPLADLLGLFGKDATLTGRTVLWEAARQVIADHPLLGVGAGNFWA
FT                   ADNDQALILAKQFYKPDHQFSFHNAYFEIAVHLGAVGVLVFLGVFLRGVWTIGQTWWRT
FT                   QGRADVFPVILGAVIAIRTLTEAEMFDALLLAPLLFWAVVLLSEEERGRAAATH"
FT   gene            250975..251583
FT                   /locus_tag="PB2503_01657"
FT   CDS_pept        250975..251583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01657"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08410"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN5"
FT                   /protein_id="ADM08410.1"
FT                   /translation="MHDEKQRNAGKSQGDRLEDRTIAGPDHHGDGGENDEKHTFAKDIL
FT                   GRKQPDHRLGPVGAPHPHGLHRHQRPKGQGPLTEENRDGELADIEPDCRRQGHSDHDGH
FT                   QDAMAQSGTGAVRPDGGGRGEGGQYIDPSMAPCRRQEGAADKGKIGEQEEREGRSDRLH
FT                   HRHIERQNDERRHHHGLIQQGSPARLDREPRWSINIDRV"
FT   gene            251673..252764
FT                   /locus_tag="PB2503_01662"
FT   CDS_pept        251673..252764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01662"
FT                   /product="glycosyltransferase, succinoglycan biosynthesis
FT                   protein ExoA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01662"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08411"
FT                   /db_xref="GOA:E0TBN6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN6"
FT                   /protein_id="ADM08411.1"
FT                   /translation="MANLKTATERADQAAVPDPAPLPPEAGAATAADVVLARVLVVVPT
FT                   LNEAARIEDCLRSLIPDAGAAEVVVYDGGSTDGTCAIVERLIAAFPHLSLQHNDRAVQA
FT                   AAVNAAAHAAPADRDILVRCDAHALYPPHYVRDLVTTLIAREVDSVVVPMDTVPRPGSG
FT                   RIERAIALSLDSPLGAGGAPHRGGRTSGWVDHGHHAAFRRERFLALGGYDPRFAVNEDA
FT                   EFDTRLARAGGRIWLDADIRVRYFPRRSLTALWRQYHRYGTYRARHARLHRSRLKLRQL
FT                   GPALHPLALLASLLMMPISPWLAAIYPALYLGLLGLGALGLGIKHKAAACLLSPLIFAT
FT                   LHMAWGTGFLAGWLSPWADTETS"
FT   gene            252761..253903
FT                   /locus_tag="PB2503_01667"
FT   CDS_pept        252761..253903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01667"
FT                   /product="glycosyltransferase, succinoglycan biosynthesis
FT                   protein ExoL"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01667"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08412"
FT                   /db_xref="GOA:E0TBN7"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBN7"
FT                   /protein_id="ADM08412.1"
FT                   /translation="MTVAFFGQEAGDPAVQRRIAALTRCGWSVDAYTFRRESAKDRPFE
FT                   NVDLGLTHDGQFVHRLGAIIRTPHQLRHVDRLKAADIFWARNLDMLAIADRVRRRVRPS
FT                   APLVYEALDIHRLLTTSSPIGLALRGWERQLLRRTALLIVSSPDYVSEYFEKRQGRVPP
FT                   WALIENRLPPAGLPPRPHPDILRPQEKKERRPLRLVWAGKLRCERSFALLRHIATTPPT
FT                   PLHVDIWGRTSTDRLTDLDQIAAATPHMTFHGPYAGAEGLSRVYGNADLVWVNDYLESR
FT                   PGGAAATNSAWQLPNRLYEGGYFGAVPVAVANTASGRFVKAHDIGFVIEEPTEASLPAL
FT                   LGALSHADIDAKRRRLLAAPRSVFVDDDTPLRAAMEKIAP"
FT   gene            253900..254784
FT                   /locus_tag="PB2503_01672"
FT   CDS_pept        253900..254784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01672"
FT                   /product="succinoglycan biosynthesis protein exoM"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01672"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08413"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS0"
FT                   /protein_id="ADM08413.1"
FT                   /translation="MTLPLLVGVCTFRRPFLIETVRSLAAQSRRPDRVIIIDNDDQSTA
FT                   EKIVDAARDETGLDLFYRHVPGRNIALARNAILDAAGDARLAMLDDDEIADAEWLAQLE
FT                   IAMSKGADAVFGPSIAVYPENAPDWMGHLSPHSQWPPQKGGRLTSGHTANVLMDTTAPV
FT                   LANRRFDPAYGRRGGSDAVFFEAALREGARFHLVADARVYEPVIAQRLSTRWLYRRRIK
FT                   AGITIGLSTPGRRSRRAVLAMGKSAYCFGRAALAIGDPVARHRHGLRGALHVGVLRGTL
FT                   GLSGADYYGKAPV"
FT   gene            254934..255845
FT                   /locus_tag="PB2503_01677"
FT   CDS_pept        254934..255845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01677"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08414"
FT                   /db_xref="GOA:E0TBS1"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS1"
FT                   /protein_id="ADM08414.1"
FT                   /translation="MRFGGPGGAILNMVLFLGVVVAVAYWLSPLSPQPNELLVTSFSAN
FT                   PYLNGLILLVLAVGIVYNFRQAVIIDPAIRWVRSFRASVDPSRTRLPRPPALIGAMARI
FT                   LLDADERGGRLTQASSRAILDSIGTRIDEGREFGRYAGNLLVFLGLLGTFWGLLQTVTD
FT                   VSAVISSLGASTGGDSATAVTSLINNLNEPLSGMNTAFSSSLFGLGGSLILGFLDIQAG
FT                   QAQNRFYSDLEDWLSGITESTTGSAGEGRAHFTASADLIEPLTQALTALAEAQNDSAAA
FT                   VREEIRELGRTLLQGDDRRPRR"
FT   gene            255855..256886
FT                   /locus_tag="PB2503_01682"
FT   CDS_pept        255855..256886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01682"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01682"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08415"
FT                   /db_xref="GOA:E0TBS2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS2"
FT                   /protein_id="ADM08415.1"
FT                   /translation="MSRRRSYTQGANIWPGFVDGLSTLLLVLMFVLSIFVVAQFYLGEQ
FT                   LTRNQQLISEQDDALTRLRAELARLSNDLSLARAEAASLSEDNAALQLDLEVLQDTIAE
FT                   KDAQIASLGSSVAASAEELEVERALSEEQKAEIATLNAQLAALRRQLASLQEALEAAEA
FT                   KDVEQQAQIENLSQRLNAALARRVNELARVRSDFLEQLAAALEGRPGFRRDGDRYIVEG
FT                   DVLFGSCSTELTPAARDVLRTVAAAINDVRRDLDTDYEWVLRVDGHADQVPLGAACRAL
FT                   FDSNLQLSTRRALSVVEFLSSQGVPADRLVAAGFGDAYPLVAGRDPASLAQNRRIEFKL
FT                   TER"
FT   gene            complement(256921..257421)
FT                   /locus_tag="PB2503_01687"
FT   CDS_pept        complement(256921..257421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01687"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01687"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08416"
FT                   /db_xref="GOA:E0TBS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS3"
FT                   /protein_id="ADM08416.1"
FT                   /translation="MKNDSGLTIRRAKRGDDADLARLLMPVIRAGETYPLPRHMSSEAA
FT                   IAYWQGEGRQVFLATGERETVGTYYLRANHQGGGDHVANCGYIVAEGARGKGIASALCT
FT                   HSLRQARLAGFTAMQFNFVVSSNTQAVHLWSQHGFAIVGRLPGAFMHPTKGAVDALVMY
FT                   RTL"
FT   gene            complement(257500..259092)
FT                   /locus_tag="PB2503_01692"
FT   CDS_pept        complement(257500..259092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01692"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01692"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08417"
FT                   /db_xref="GOA:E0TBS4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS4"
FT                   /protein_id="ADM08417.1"
FT                   /translation="MSPLPSFGKIVFFGDSLTDNGIQSNYREATDVPLQIQSELVYSEG
FT                   RFSDGYNYADYFAYELGLTDELGIDTKSLDELTNGVAGGSAENFGVTASRASIDRSWQQ
FT                   LAQEAASVEIDPTNPYADDRVDLPGQVAWFLDTLEPGQDLSNVAVSMLTGINDLGNELT
FT                   RNIIPGMGNITRAEAEQVGQDFAVEVFDSIVDQVSILADLGVGTVFLYTIPKVSETLLG
FT                   SLASANGKAANSAGVDFYNELLFQSEDALETSLGINIEVFDVALFQQELTADYTTFGFY
FT                   TGIIPVTLFGDAINKPVRGVPLDQIAFVDPIHPSEAAQKILVQTMLETLTAENIVGTLG
FT                   RDDLVGTDGDDFVVAREGRDFVDLGLGDDMVLGGTGNDEILGGGGNDLISGGSGTDSLY
FT                   GDDGNDVLVDNDGWDVVRGGLGNDILIKGSGFDTMFGDEGDDIFIYTDQDLFARRSIFE
FT                   RLLAFGGEGNDTLVLRLSSEKADAYNEGTLTLQDLKISIEDIENVVVVDGFDLPDGLSD
FT                   NPLLAEAEAWNFV"
FT   gene            259575..261281
FT                   /locus_tag="PB2503_01697"
FT   CDS_pept        259575..261281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01697"
FT                   /product="ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01697"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08418"
FT                   /db_xref="GOA:E0TBS5"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS5"
FT                   /protein_id="ADM08418.1"
FT                   /translation="MSEIDTFNPSRDEFAEMFEASVVDRETFEQTVVKGTITAIEKDVA
FT                   IVDVGLKTEGRVPLREFGDPSKDPVAVGDQVDVFIDRIENAHGEAVISRDRARREEAWE
FT                   RLEHNFEDDDRVEGVIFNRVKGGFTVDLGGAVAFLPGSQVDIRPVRDAGPLMNIPQPFK
FT                   ILKMDKRRGNIVVSRRSVLEEDRAEHRQEVVRDLNEGDERDGVVKNITDYGAFVELAPG
FT                   VDGLLHVTDMSWSRVNHPSEVLNVNDTVSVKIIKINPETSRISLGMKQLQPDPWDGVAA
FT                   KYPIGGKFHGKVTNITDYGAFVELEDGIEGLVHVSEMSWVKKNVPPSSIVSSGQEVDVM
FT                   VLEVDEQKRRVSLGLKQTLSNPWESFAEKHPIGSIVEGEVKNITEFGLFIGIDDDMDGM
FT                   VHLSDLDWDRQGDDAIRDYQKGDMVKAKVLDVDPDKERISLGIKQVANDPMDAIAELNR
FT                   GDDVTCTVTAVENGGIEVRVGSDGGPKAFIRKSDLSRDRNEQRPERFAVGDKIDARVIA
FT                   LDPQSRRLSLSIKAREIAEEKEAVEQFGSADSGASLGDILGAALKDTEDAG"
FT   gene            complement(261388..263541)
FT                   /locus_tag="PB2503_01702"
FT   CDS_pept        complement(261388..263541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01702"
FT                   /product="catalase/peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08419"
FT                   /db_xref="GOA:E0TBS6"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS6"
FT                   /protein_id="ADM08419.1"
FT                   /translation="MRGRKNKDWWPKALDLSILTQNGKSPSPMEPGFNYAKAFESLDLK
FT                   AVKADLHALMTDSKDWWPADYGHYGPFFIRMAWHAAGTYRMSDGRGGASAGAQRFAPLN
FT                   SWPDNANLDKARRLLWPIKQKYGNALSWADLLVLTGNVALESMGFKTYGFAGGREDIFE
FT                   PENDVYWGTEAEWLGEDDRYSGDRYLEEPLAASNMGLIYVNPEGPSGEPDPAKAAHDIR
FT                   VTFARMAMNDEETVALVAGGHTFGKCHGAANAQIGAEPEGADIAAQGFGWTNATGTGHG
FT                   GHTMTSGLEGAWTPDPTTWDQGYFDMLFGYDWELTKSPAGHWQYAPKGVQEKDLAPDAH
FT                   EAGKRVPTMMLTTDLSMKVDPAYERISRKFHQDPEAFALAFAKAWFKLTHRDMGPKSRY
FT                   LGPEVPEEDLIWQDPVPAVDHPLIEAADISALKQAILGAGISVSDLVFVAWSAASSYRD
FT                   SDKRGGANGARIRLTPQKDWAVNDPERLARVLTTLEGVKSDFNSQQQGGKKVSLADLIV
FT                   LGGVAAVEKAALDAGHRIDVPFVPGRTDATDAQTDAASFDVLEPAADGFRNYVHAEATV
FT                   PAEEMLLDRARLLSLSIPEMTVLIGGLRVLGANQGGKADGVFTDRPGVLSTDFFVNLLD
FT                   METAWKAVSDEQKEFIGTDRASGQERWRGSRVDLVFGSNAQLRAVAEIYAQADGEKTFI
FT                   ADFVKAWTKVMMLDRFDVPDQRS"
FT   gene            complement(263735..265114)
FT                   /locus_tag="PB2503_01707"
FT   CDS_pept        complement(263735..265114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01707"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01707"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08420"
FT                   /db_xref="GOA:E0TBS7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS7"
FT                   /protein_id="ADM08420.1"
FT                   /translation="MRIRLAIIGRPNVGKSTLFNRLAGRKLALVHDEPGVTRDRREIEA
FT                   TFGDLDLTLIDTAGLEEAQQGSLQARMRAGTEKAIGLADLSLFLIDARAGVTAQDEELA
FT                   QMLRSAGRPVIVVANKTEGRGEEGAYEAYRLGLGDPVPISAEHGEGMADLYQAVISKLA
FT                   ESGIDHQIKEEAETLAWDDPRKPLRLAIVGRPNAGKSTLVNQLLGEDRVLTGPEAGITR
FT                   DTISAEWRYVADDRDWPVKLFDTAGLRRRAKVQDKLEKLSVGDTLRAIRFAEVVALLID
FT                   ATQPFEKQDLQIADLALKEGRALVIVANKWDLIDDKDEAARALREMAGRLLPQAPGAPV
FT                   VLLSAKTGRGIDRFMPHVVKVYRDWNAQVRTSDLNTWLAAAVAKHPPPAVGGRRIKIRF
FT                   IAQVNTRPPTFMAHCQRADYLPESYKRYLVGGIREAFGIDAVPVRLFLRKGDNPYVDKK
FT                   R"
FT   gene            265210..267048
FT                   /locus_tag="PB2503_01712"
FT   CDS_pept        265210..267048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01712"
FT                   /product="ABC transporter, with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01712"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08421"
FT                   /db_xref="GOA:E0TBS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS8"
FT                   /protein_id="ADM08421.1"
FT                   /translation="MAAPLLTLSDVHLSLGGKDLFTGADLQVGERDRIAVVGRNGTGKS
FT                   TFLKIAAGLMEADRGDRTVRGGVSLRYLEQDPDLSGFASIDDAVRDGLGPADEAGAIPG
FT                   LLAVLDLDPTRSPKGLSGGEARRVAIARALAPGPDLLLLDEPTNHLDLPTITWLEESLI
FT                   RSRAALVVISHDRRFLSTLTTRTVWIDRGVTRNLDEGFSSFEAWRDQVYAEEERDAHKL
FT                   SRQIVREEHWLRYGVTARRKRNVRRLGDLHALREKRRTLSRPQGSVTMTAAQAEDSGKK
FT                   VVETTALCFRYDGRSLVEGLDLKLHRGDRLGIVGPNGAGKTTLLKLLTGALAPDEGSVT
FT                   HGTKLDIIGLDQQRAGLKDGTVVLDALTGGRGDSISVGGEQRHAVGYLKDFLFTPDQAR
FT                   QPVGALSGGERGRLALAIALAQPSNLLILDEPTNDLDLETLDVLEDTLASYTGTLLLVS
FT                   HDRDFLDRIVTAILAPSPAADGQWILYAGGYDDMIRAQRRVGAAEAVDTSSTPSRASSN
FT                   AAAQGAADRRTQRQSKLSYKDQLALDQLPGKMAALEGEIAALQKTLDDPSLFTKDRSAF
FT                   DKASTALAAAEAALSEAEDQWLTLEERREALAAEAE"
FT   gene            complement(267153..267707)
FT                   /locus_tag="PB2503_01717"
FT   CDS_pept        complement(267153..267707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01717"
FT                   /product="putative TonB-dependent receptor protein with
FT                   OmpA-liketransmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01717"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08422"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBS9"
FT                   /protein_id="ADM08422.1"
FT                   /translation="MKSFVLSALACGVAALPMVASAQYAGSTQLTRYGELGLNFLSIDI
FT                   EDDLPFISEDSIDLEVLTGRLGAAISPYLSVEGELSFGLGDDEVAGVDVNLNYAFAGYL
FT                   RGEYPLSPEFTVFGRFGLIQAEVGFEAGSIDDTESGGGVALGFGGEYRLQSNFYLRADY
FT                   TKYDIDDLDGDSLTVAVGYDF"
FT   gene            complement(267763..268335)
FT                   /locus_tag="PB2503_01722"
FT   CDS_pept        complement(267763..268335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01722"
FT                   /product="putative outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01722"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08423"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT0"
FT                   /protein_id="ADM08423.1"
FT                   /translation="MRSKVMRSPSILAGLALVTFGSSAIAGSSAAAQSVTDNYDAYLEA
FT                   GYSWAEINGRTNDAEFGGVVARLGLNFGQFLALEGESVLGLDDEEDVIAGREVVVSQEY
FT                   SLAGFLRISYPISERLSVHARLGGATVALKAEAVGFEETENEEGFAYGIGASVAVLDPF
FT                   YLRADYVRYDIEDSDTDQYTLTLGAKL"
FT   gene            complement(268573..268647)
FT                   /locus_tag="PB2503_t13800"
FT   tRNA            complement(268573..268647)
FT                   /locus_tag="PB2503_t13800"
FT                   /product="tRNA-Glu"
FT   gene            complement(268751..270583)
FT                   /locus_tag="PB2503_01727"
FT   CDS_pept        complement(268751..270583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01727"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01727"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08424"
FT                   /db_xref="GOA:E0TBT1"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT1"
FT                   /protein_id="ADM08424.1"
FT                   /translation="MSTTPLSSDDHLVETAFLGVTRSVTGRRWRRRAFDARAAETIAQR
FT                   LDIDPLLSEVVAARQVTPDLAAAWLSPRLRDDLPDPSCLKGMDTAAARLADAIIAGETI
FT                   GLFGDFDVDGTTSSAIMARYLRAVGAAPLIHLPNRQSEGYGPNLPAFLAMKEKGASLIV
FT                   TLDCGATAHGVLAAAAEEGLEVIVVDHHLMSLPAPTAVAVVNPNRPDCLSGLTMLSAGG
FT                   VTFLTLVALNRTLRERGFFADRPPPDLLRLLDLVALSLVCDVMPLKGLGRTLTRQGLAL
FT                   LGHIEGAGSGNQGIRALAAEAGAKGPAAAAHFGYAIGPRINAAGRIGHAMTAFDLLTTD
FT                   DPVKAAALAAELSDLNGIRQGVEAAVLEEACKAAEDQGDRDAPLPLVVAGEGWHPGVIG
FT                   IVAGRLKERFGRPALVISLAGEEGKGSGRSLPGVDLGAAIGAAVEAGLLLGGGGHPMAA
FT                   GLTVRRDGLGELRAFLDARLGEAIAAAQADRVLSLDGIVAPTGITRSLHDGLLQAAPFG
FT                   NGNPEPRFALADISVRELRVLKDKHMAVTLADDTGGRARGIAFGCVGQPLGDLLEAGRA
FT                   GQRLHLAGRIKPDEYRGGNAAQIHLEDGAVVKDA"
FT   gene            270741..271052
FT                   /locus_tag="PB2503_01732"
FT   CDS_pept        270741..271052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01732"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08425"
FT                   /db_xref="GOA:E0TBT2"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT2"
FT                   /protein_id="ADM08425.1"
FT                   /translation="MISLRTLIKLVIACLIVGAMLSFIGADPLDFWRGLWSALRDAVQR
FT                   VFDEGLSGALRILNLIALGAVIVLPLWGLREVLRRRRPPAAPGPHDRSPDQPRDPSPR"
FT   gene            complement(271073..272305)
FT                   /locus_tag="PB2503_01737"
FT   CDS_pept        complement(271073..272305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01737"
FT                   /product="DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01737"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08426"
FT                   /db_xref="GOA:E0TBT3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT3"
FT                   /protein_id="ADM08426.1"
FT                   /translation="MAQPAVQYAPPHADSLEEGLAAFGVAAFRPGQRRVIGHLMRGEDV
FT                   LALMPTGAGKSLCYQLPAYLLSGVAIVVSPLIALMENQVQSLHARGIRAGMIHSGRDRA
FT                   QNIADWTAAREGQLDLLYMSPERLMTGRMLSALRSLPVTLIAVDEAHCISQWGHQFRAD
FT                   YRQLGQLRTVFPKIPIAAFTATADRDTEADIKAALFGGEVARVRLSLDRPNLFLGVHDK
FT                   TPRDGKLHSLLAWHRGESGIVYCRTRRGTEAVARQIEASGRRAFAYHAGLPETERLEIL
FT                   NAFTERRGLVIAATVAFGMGIDKPDIRFVIHRDLPSSLEAYYQEIGRAGRDGAPAKAHL
FT                   LYGRGDVIARRRLIENSEADSLVKQAETRRLGTMVDFAETVGCHRMALLAHFGERSPAP
FT                   CGRCTGCREGR"
FT   gene            complement(272377..273132)
FT                   /locus_tag="PB2503_01742"
FT   CDS_pept        complement(272377..273132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01742"
FT                   /product="DSBA-like thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01742"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08427"
FT                   /db_xref="GOA:E0TBT4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT4"
FT                   /protein_id="ADM08427.1"
FT                   /translation="MNRPLVKLIGLYELAIFAVTSGRQPLRPLVSTPRPQLTIDVVLDL
FT                   VCPWCFIGFRGLDWAAMALSFEFDLGVRFRPYQLDPTTPVAGRDRESVWQEKFPDSEIR
FT                   ARVVSALHEAMADVGLSFALDRPDRLPNTLDAHRVVRWAGLEGGGREMVAALFEAYWTE
FT                   GADISRHDVLAAAAETAGLGGADIEARLASDEDRADIAQEMSELRAGGVTGVPTFIVNE
FT                   KAGFPGALPKAELLAALRQLAEETTGGEG"
FT   gene            273213..273629
FT                   /locus_tag="PB2503_01747"
FT   CDS_pept        273213..273629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01747"
FT                   /product="transcriptional regulator (Fur family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01747"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08428"
FT                   /db_xref="GOA:E0TBT5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT5"
FT                   /protein_id="ADM08428.1"
FT                   /translation="MQGAMAEDAMTRNERLVLEVLGREEEPMKAYELLAALKDKGVKAP
FT                   MTVYRALDRLELRGLVHKLDAMNAFVACNHDQPHRVQMFTMCSECSKVTEIKEQRVTSV
FT                   NWQGIAKIGTENGFEASSARVELRGICAECRSLS"
FT   gene            complement(273667..274452)
FT                   /locus_tag="PB2503_01752"
FT   CDS_pept        complement(273667..274452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01752"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08429"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT6"
FT                   /protein_id="ADM08429.1"
FT                   /translation="MAVRLRRGALFYLVVGGVMALSACATSHSQGGPSFRDPATARAVR
FT                   AAVRQEYGPSVRVVFEGPMAFRVKGVSSKAQFEEVAETVWSTFGLEEELDQDPDGAWRP
FT                   DYYGLADQHSAKLYAYSRDHIGADHGRALAAEVQAHLQRQIRYRIPREGFLPPDEVIRR
FT                   GYGDCDSKATLAAAMLLSLDPRLDPHFVRLPSKRHVLLAVRVPVQRGDHTVKINGRRYV
FT                   LMEVAGETRSGLGDLPWEFASALDDAIVLYPGDRSRSRV"
FT   gene            complement(274588..275301)
FT                   /locus_tag="PB2503_01757"
FT   CDS_pept        complement(274588..275301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01757"
FT                   /product="glutamine amidotransferase, class-I family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01757"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08430"
FT                   /db_xref="GOA:E0TBT7"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT7"
FT                   /protein_id="ADM08430.1"
FT                   /translation="MKLLIAETGVPPAPLQDRFPGYPTMMVEMLGRAGLVTTPSTIKTL
FT                   EGERIPLAPSEEDAALIVTGSPAGVYEDHEWIGPLTDDIRQWAKSGRPMIGICFGHQIM
FT                   AHAFGGRVELSDRGWGVGVHTYEVMDDMPGVEGHRLACAVSHKDQVVRLPSGAVRLGGS
FT                   PFCPNGIIRYAQGRSLSLQFHPEFSHDFARALLACRAEDIPGDVAAFGRRSLDNPSDRD
FT                   RIGAFLAAFLKGEIA"
FT   gene            275365..276117
FT                   /locus_tag="PB2503_01762"
FT   CDS_pept        275365..276117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01762"
FT                   /product="Enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01762"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08431"
FT                   /db_xref="GOA:E0TBT8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT8"
FT                   /protein_id="ADM08431.1"
FT                   /translation="MTEEIIMTQEEGVLRLRIARETKKNALTQEMYLTLAEAMEGVPDM
FT                   PEIGAVLFEGSDEIFTAGNDLSAFVTAPPADGSKPPVWRLLEATARCPVPVIAAVAGPA
FT                   IGIGTTLLLHCDLIVAAPEAYFHTPFVDLAAVPEGGASYLMPKRLGRQLASEFLLLSRP
FT                   VPAQRAYEMGFVNAVVTEGPVRDYGFDLAKDLAAKPREAMRQSKALMCHETDDMLAHME
FT                   TEFREFAKRLSSDEMKSVIMAMMQRKKG"
FT   gene            complement(276237..276947)
FT                   /locus_tag="PB2503_01767"
FT   CDS_pept        complement(276237..276947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01767"
FT                   /product="outer membrane protein, 28Kda"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01767"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08432"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBT9"
FT                   /protein_id="ADM08432.1"
FT                   /translation="MRAFWLLAFAPLTLAACGEAPDTDQPRTIMARGIGEVTAAPDQAS
FT                   LRFAVESRAETAAAAMDTNAEAMTAVRDALRSVGVDRRDMQTSGFSLLPLYENESERRS
FT                   QGRDYPAIVGYEASNGLMVRLTEVEKTGEAIDAAIRAGANRLEDLAFGFEDSTALEDEA
FT                   ETLAIEDARATAKRMAEAAGVRLGEVMSVSLSGSPRPQPAMMMEMRAMQSTSTPIEAGE
FT                   SQLSASATITYRLR"
FT   gene            complement(277024..277839)
FT                   /locus_tag="PB2503_01772"
FT   CDS_pept        complement(277024..277839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01772"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01772"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08433"
FT                   /db_xref="GOA:E0TBU0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU0"
FT                   /protein_id="ADM08433.1"
FT                   /translation="MAPHPHPPVPATLYTIDRNTVWSRMRLEAATAAAQEPAIASFLNA
FT                   SLLHHDTIEAALSYRLAEKLSDGEMKAMLWREVAMDAYQDKPQIVAAALSDLLAYFDRD
FT                   PACRQYSHPFLYLKGFHALQSYRIANWLWGQGREALAHYLQSRISELYNIDIHPAARLG
FT                   ESLFFDHASGIVIGETAVIADEVSVLHNVTLGGTGKETGDRHPKIGRGVLISAGAKILG
FT                   NIEVGEGAKIAAGSVVLHSVKPFCTVAGVPAVPVGACAKAAGGEMDQHI"
FT   gene            complement(277849..278457)
FT                   /locus_tag="PB2503_01777"
FT   CDS_pept        complement(277849..278457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01777"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01777"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08434"
FT                   /db_xref="GOA:E0TBU1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU1"
FT                   /protein_id="ADM08434.1"
FT                   /translation="MEEVNGPWRITARHTAYETPWIRIEHHDVVRPDGADSVYGVVRFK
FT                   NLATGVLPLFADGTTILVGQHRFPFNTYSWELPEGGAPAGEAPHAAALRELEEEAGLVA
FT                   RHWTELGQVDLSNSVSDERAFFFLAWELGQGKTAPDPDEVLETKRVPLAEVIQMCLAGE
FT                   IRDSLTHLMILTAVTKARLNRLPTPPQDLILAALDELSS"
FT   gene            complement(278475..278933)
FT                   /locus_tag="PB2503_01782"
FT   CDS_pept        complement(278475..278933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01782"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08435"
FT                   /db_xref="GOA:E0TBU2"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU2"
FT                   /protein_id="ADM08435.1"
FT                   /translation="MTDVPSPQFLGQPSAAPSHPDAARLDPVPNPHPDALYLTRFVVPE
FT                   FTSLCPVTGQPDFAHLVIDYAPEAHLVESKSLKLLMTSYRNHGAFHEDCTVDIAKRIVA
FT                   AIAPRWLRISGYWYPRGGIPIDVVYQTGPPPSALYVPETGVPPYRGRG"
FT   gene            complement(278980..279798)
FT                   /locus_tag="PB2503_01787"
FT   CDS_pept        complement(278980..279798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01787"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08436"
FT                   /db_xref="GOA:E0TBU3"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU3"
FT                   /protein_id="ADM08436.1"
FT                   /translation="MRLGFLGDVMGRAGRNAVLDNIGHLKSSLGIDFLIINVENAAGGF
FT                   GITTALVNDFMDAGADCLTTGNHAFDQRDDLGVFETEPAMIRPANYPSSCPGRGAALLA
FT                   GGGELQVLVVQVLGQRFMNPIDDPVSAIERELDGLVLGQDADAIVIDVHAEASSEKYAL
FT                   GHYLDGRVTAVVGSHTHVPTADFQVLPGGTAFHSDAGMCGDYDSVIGMEKAGPVESMVS
FT                   KMRSGRMVPASGPATICGTVIDSDPKTGLAQAVYPLRLGGRLAETLPPRR"
FT   gene            complement(279895..281196)
FT                   /locus_tag="PB2503_01792"
FT   CDS_pept        complement(279895..281196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01792"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08437"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU4"
FT                   /protein_id="ADM08437.1"
FT                   /translation="MRSEFQSSCRLCGGHELTPAFTLDHENAWVFCGTMGGDNGCGLLQ
FT                   RATYGQDGGYGRSTELSWTEQCRLKDVVSGALEMMSSREGMALDIGCGAGHVLAAYPRW
FT                   FLPVGTEAALERTGQADWGIGIKGHFLEAETQENLRAAAGDRGFDIISSVGYLETINDP
FT                   RALFETVKTYLVEDGVFVVETSYSALALTRTLSSAFHIGANAIYGLATLQRLASETGFR
FT                   IIRGSMSERAAGSLRVTLAHDHYRGHDYGPWLDSLARLWDEEAALSLGTGQAFHAYSSR
FT                   LAQRHREIASFKDSLIRADEHAYVLGTCAPSFAVLSAADIGYDVISAHIGSDPQEGFPE
FT                   IITLEQAKSAPADVLIAPSWRRRETLEQWYDQIMGGMRLVFLEPDFLVVDRSNYATELG
FT                   RALAVTDGPGSVDTLRAALAAMRGPALRLVSHSA"
FT   gene            281443..282261
FT                   /locus_tag="PB2503_01797"
FT   CDS_pept        281443..282261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01797"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01797"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08438"
FT                   /db_xref="GOA:E0TBU5"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU5"
FT                   /protein_id="ADM08438.1"
FT                   /translation="MLPATKAVAKELLTVVDRPLIHYIADEAKEAGIEHLVFVTGRGKG
FT                   AIEDYFDHAVELEQALEAKKKTAILEDTMSSLLAPGASSFTRQQAPKGLGHAIWCARDI
FT                   VGDEPFAILLPDVIVQGPRGCLAQMVDQYEDGRNLVAVEAVPEDLVHKYGIVAPKGEID
FT                   GALFEMEGMVEKPEASAAPSNMSIMGRYILQPEVFSILEKTGKGAGGEIQLTDAMATLM
FT                   DQQPFFAFQYEGESHDCGSKLGFLKANIAYALENDELGADLKSWVSDRIA"
FT   gene            complement(282395..282691)
FT                   /locus_tag="PB2503_01802"
FT   CDS_pept        complement(282395..282691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01802"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01802"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08439"
FT                   /db_xref="GOA:E0TBU6"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU6"
FT                   /protein_id="ADM08439.1"
FT                   /translation="MAVSARQITTSGVPVDASEEEIVAPAPDYVRQDLKLSIDEFTGEA
FT                   PISPALRMQHLLGKEFASVSEEKWSPRKTALFVVLTCGSFWLTMVLLAVALLG"
FT   gene            282782..283354
FT                   /locus_tag="PB2503_01807"
FT   CDS_pept        282782..283354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08440"
FT                   /db_xref="GOA:E0TBU7"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU7"
FT                   /protein_id="ADM08440.1"
FT                   /translation="MRTPFLLRRSISLALVFLGSIAALVTFWYSDTPGASLPETPPKGR
FT                   APDYYIALSQKAGEAGEWALASEAARQAALRAPHEGRSWQRLTYSLTAEALWPTQESLK
FT                   ALMEAYRVAPYPAPTDMIWRVDYAMRYWPAMPNQIQDLTLTQIAALGGIPETFETRRRW
FT                   CKTAPDGALADAACATTPGVWRNGVPQ"
FT   gene            complement(283431..283919)
FT                   /locus_tag="PB2503_01812"
FT   CDS_pept        complement(283431..283919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01812"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01812"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08441"
FT                   /db_xref="GOA:E0TBU8"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU8"
FT                   /protein_id="ADM08441.1"
FT                   /translation="MSRVAQALKGATLSDFTSAFWLGMKYFFRPKATVNYPFERGPSSP
FT                   RFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIEAEERADGSRRTTRYDIDMVKCIY
FT                   CGLCQESCPVDAIVEGPTLQIATETREELLYDKDRLLANGDRWERLIAKNIELDAPYR"
FT   gene            complement(283916..284980)
FT                   /locus_tag="PB2503_01817"
FT   CDS_pept        complement(283916..284980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01817"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01817"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08442"
FT                   /db_xref="GOA:E0TBU9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBU9"
FT                   /protein_id="ADM08442.1"
FT                   /translation="MFEWLVTRDWDAAPLLTAFATTLQTLALMVVLLVSLAFLLLFDRK
FT                   VWAAVQMRKGPNVVGAFGLLQSFADFLKFVLKEIVVPAGADKTIFLIAPFVTFLLAFLG
FT                   WAVVPVGQGLVVADINVGILYLFAVSSLGVYGIIMGGWASNSKYPFLGSLRSAAQMVSY
FT                   EVSLGFIIISVLLLVGSMNLTDIVNSQARGLGILNWHFIPLFPLFVMFFISALAETNRP
FT                   PFDLPEAESELVAGYQVEYSSTPYLLFMIGEYLNIVLMCSLLTILFFGGWHSPFPGDFL
FT                   GFLGPLWFAVKVVFFFFLFAMVKAIVPRYRYDQLMRIGWKIFLPTSIGYLMLVAFVLLY
FT                   VPGVADLFQGWRPS"
FT   gene            285136..286299
FT                   /locus_tag="PB2503_01822"
FT   CDS_pept        285136..286299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01822"
FT                   /product="phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01822"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08443"
FT                   /db_xref="GOA:E0TBV0"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV0"
FT                   /protein_id="ADM08443.1"
FT                   /translation="MGPRMSMPDTKPANPSFSSGPCAKRPGWDIAALRTDALGRSHRSS
FT                   LGKARLKEAIELTRDILGVPDSHLIGIVPASDTGAYEMAMWTLLGARPVTALAWESFGQ
FT                   GWVTDAVKQLKLDAEIVTADYGSLPDLSRIDMKTDILFTWNGTTSGVRVPNGDWIRDDR
FT                   EGLTLCDATSAAFAQDLPFEKLDVVTYSWQKVLGGEAQHGILILGPRAVERLETHQPSW
FT                   PLPKIFRLTKGGKLISGIFQGETINTPSMLCNEDYIDALKWGQSLGGLEGLKARANENA
FT                   GTLSAWVDRTAWVDHLAADPASRSNTSVCLKIVDPKVTAMSEDDQRAFQKKLEKRLAAE
FT                   DAAYDIGAYRDAPPGLRIWCGATVETKDISLLTEWLDWAFGEEVASL"
FT   gene            286417..288000
FT                   /locus_tag="PB2503_01827"
FT   CDS_pept        286417..288000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01827"
FT                   /product="putative phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01827"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08444"
FT                   /db_xref="GOA:E0TBV1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV1"
FT                   /protein_id="ADM08444.1"
FT                   /translation="MKRVLISDKLSEDAVEVLKTRGIEVTFEPGLGKDPEKLKAALPGH
FT                   HGIAIRSATKMTAEMIEAGTDLKVIGRAGIGVDNVDIDAATATGIAVMNTPFGNATTTA
FT                   EHAIAMMLSLARQIPQANESTHQGKWEKSRFMGREITGKTLGLIGCGNIGSIVADRAQG
FT                   LHMKVVAFDPFLTEARAIDLGVERVELDDLLKRADFITLHTPLTDQTRNILSKQALAKT
FT                   KKGVRIINCARGGLVDEEALYDGLESGHIAGAALDVFEKEPATEHKLFGRDDVICTPHL
FT                   GAATTEAQENVAIQIAEQIADYLLTGAVTNALNMPSVSAEEAPKLRPYIDLAGRLGGLA
FT                   GQLAPGAVTGVEMAFAGTAASLNPAPMTAAALTAVLRPAMREAVNSVNAGQLAKQRGIQ
FT                   VSETRTETSPNFGSTVSVKLTTDKGELSVTGALFGGEPRAVRIGNVRLESNFAPHMLYV
FT                   QNKDKPGFIGNLGKLLSSKDINIATFNLGRAAPGGTAYALLAVDQPLDDDTLKALSDLP
FT                   QIDEARMLSF"
FT   gene            288003..288866
FT                   /locus_tag="PB2503_01832"
FT   CDS_pept        288003..288866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01832"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01832"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08445"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV2"
FT                   /protein_id="ADM08445.1"
FT                   /translation="MASPAVCFIGVGALDRAEALSAVGPNAPVTDLGGAALVNMPVGEA
FT                   VKDAMAAARADGLDAAYLPHGARPVRLLLADMDSTVIGQECLDELADKAGHGEAVKAIT
FT                   EQAMRGELNFEEALRDRVATLKDLPASVVDEVLAERITLDPGVQILTATLRRLGAKTVL
FT                   VSGGFTVFTGPIAARAGFDAHFSNRLEIEDDRFTGEVLPPILGREAKKERLMAELSALG
FT                   LSTADALCVGDGANDLAMVTAVPHGVAYHAKPVVAEAAPVRIDHHDLSALLYLQGIARS
FT                   DWADPR"
FT   gene            289066..289647
FT                   /locus_tag="PB2503_01837"
FT   CDS_pept        289066..289647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01837"
FT                   /product="NADH dehydrogenase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01837"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08446"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV3"
FT                   /protein_id="ADM08446.1"
FT                   /translation="MSVPLNICAVLAAGLFTASAGLSAVQAQPAKPGAQAVGYLKGVAA
FT                   AKGHPVPRPFANARYPGAQAVGYAKGFAAAKGYRPAPAPRIVYAPPRAYSPSYVPPRPV
FT                   HPGARAIGYAKGYADASRAAQPPAAYPAPPAYAAPVYAPAPAYGAPAYGYAPYAAAPQP
FT                   YAYTDKPFKAAAADALRQVVQAEIYQAYYD"
FT   gene            complement(289749..291866)
FT                   /locus_tag="PB2503_01842"
FT   CDS_pept        complement(289749..291866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01842"
FT                   /product="NuoG, NADH dehydrogenase I, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01842"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08447"
FT                   /db_xref="GOA:E0TBV4"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV4"
FT                   /protein_id="ADM08447.1"
FT                   /translation="MADTRTIKVNGEEIDVDPNLTLLQACELAGEEIPRFCYHERLSVA
FT                   GNCRMCLIEVKGGPPKPVASCAQNVRDLRPGPEGAPPELFTNTPMVKKAREGVMEFLLI
FT                   NHPLDCPICDQGGECDLQDQAIAYGAGESRFLENKRAVEEKHMGPLIKTVMTRCIQCTR
FT                   CVRFATEVAGVNDLGLVNRGENAEITPYLEKAVDTELSGNLIDICPVGALTSKPYAFTA
FT                   RPWELIKTETVDVMDALGSAIRVDARGREVLRILPRIHNGINEEWIGDKSRFIWDGLRK
FT                   RRLDRPYVRKDGKLQPVSWPEAFDAIAAKVKAVPSEKIAAIAGDLVPVEALKALKDLTD
FT                   KWGTPHRDCRQEGSMLGVLPNGERAPRGSYIFGASIAAIDEADMILLVGTNPRIEAPVL
FT                   NARIRKRYLQDLSVEIGVIGPKVDLSYETRHLGHDPSVIGDIEPAFLDRLSKAKKPMII
FT                   AGAGAFVRGGAGTMNSLLTLAAQIGALGAEQGDWNGLNVLHSAAARVGGLDIGFLPGEG
FT                   GKGFSDIISGAESGDIDVVYNLGADEFDTDLLKNAFVIYQGHHGDAGARVADVILPGAA
FT                   YTEESGTFVNTEGRVQLTNQAYHPFGEAKANWAILRALSQVLGQTLPYDDLFAVRQAMI
FT                   EDNEVFGAIGTVSPVAALDQTLYQGAADGDAAFVPPFTSYWLTNPIARASETMRECHQT
FT                   FVAPQGLLAAE"
FT   gene            292151..293815
FT                   /locus_tag="PB2503_01847"
FT   CDS_pept        292151..293815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01847"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01847"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08448"
FT                   /db_xref="GOA:E0TBV5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV5"
FT                   /protein_id="ADM08448.1"
FT                   /translation="MSSTPQDVNHTFDDDDLSILTTYGTVKAHEAGEILVPSGTSKADC
FT                   LVTLSGQTHIFVISGQEESRVGYMERGQFAGDLSVLTGGVTFARTVMGEAGEVLHIPHD
FT                   RFKRLLVERSALSDVFVRVLTARREFGKSRANRSIILIGPGRQRETFALRRLLERQSVP
FT                   HTLVDPTLDEEAGEGVMRVHGLGPEDLPAVLLGEKEPMRAPTPSALAEALGLDLVADGT
FT                   TTDVLVIGAGPAGLAASVYAGSEGLSVLTLDGDAPGGQAGTSSKIENYLGFPTGISGQE
FT                   LADRASVQAQKFGVQMAAPAEVASLQVEDKLYRVALEDGREVAARSVVIATGARYRRLD
FT                   IDHLEDFEGRGIYYGATPMEAQLCGGREVAIVGAGNSAGQGAVFLSHTAKAVHVVYRRA
FT                   DIRETMSEYLVRRLEETPNIILHPEREVVALYGDNDGLLEKVDFINHATGSTETCDCGF
FT                   LFLFIGARPCTDWLQGRLATDDRGFLKTGADLTNMELVKAQWSMDRMPTKYETSLPRVY
FT                   AVGDVRTGSIKRVASAVGEGSVVVSDIHRALGELAAS"
FT   gene            complement(293852..294196)
FT                   /locus_tag="PB2503_01852"
FT   CDS_pept        complement(293852..294196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01852"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08449"
FT                   /db_xref="GOA:E0TBV6"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV6"
FT                   /protein_id="ADM08449.1"
FT                   /translation="MREYQTFAEFFPFYLRQHARPRTRFFHIAGVGLTVLTFLTVLVLD
FT                   LPWLLLAAPLAGYGPAWISHAFIERNKPATLTYPLWSLRGDIWMSVLWVSGRLDAELER
FT                   AGVGPSLSSP"
FT   gene            complement(294213..295070)
FT                   /locus_tag="PB2503_01857"
FT   CDS_pept        complement(294213..295070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01857"
FT                   /product="ATPase of the PP superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01857"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08450"
FT                   /db_xref="GOA:E0TBV7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV7"
FT                   /protein_id="ADM08450.1"
FT                   /translation="MVGGEGMMATTDLSRLYDTAPDTTAFRKRRKRLVRLTEEAISRYA
FT                   MVSKPGARWLVCLSGGKDSYTLLTLLMDLKAQGRLDVDLVAANLDQAQPGFPTEVLPHY
FT                   LEGLGLAHRIDRRDTYSTVIEKTAPGQTLCTLCSRLRRGHLYRMAREEGCDAIALGHHA
FT                   DDILETFFLNLFHGGRLEAMSPNLMNDEGDVQVVRPLTLVREADIVRFAEDMAYPIIPC
FT                   TLCGSQDGMARQTMKAMIASWDLAHPGRSDTILRALGTIRPSHLLDDSHFDFSSFSCEP
FT                   KSNK"
FT   gene            complement(295089..295637)
FT                   /locus_tag="PB2503_01862"
FT   CDS_pept        complement(295089..295637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01862"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01862"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08451"
FT                   /db_xref="GOA:E0TBV8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV8"
FT                   /protein_id="ADM08451.1"
FT                   /translation="MPVGDIVEVSDETISGADDVMKAAFGHMVEAQLTHDLRDGAYMLD
FT                   ERVVLQARGVVGYGALSRAIIRYGDNKEVAIAALAPLAVSPSVQREGIGFALAQTLISA
FT                   WQENGNGAVIVLGHPPFYRRLGFSASLAERHLISPFPEAGDAFMLSDPAGVLCEITGGH
FT                   VEFPAPFGVGVPRQKEKSA"
FT   gene            complement(295681..297042)
FT                   /locus_tag="PB2503_01867"
FT   CDS_pept        complement(295681..297042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01867"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01867"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08452"
FT                   /db_xref="GOA:E0TBV9"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBV9"
FT                   /protein_id="ADM08452.1"
FT                   /translation="MAGCAESLTTTSEIEWDSFSLMLQDKDRIFTNLYGLKDPFLEGAK
FT                   DRGAWNGTKDILDMGIDWVIQQVKDSGLRGRGGAGFPTGLKWSFMPKEVGERPHYLVVN
FT                   ADESEPGTCKDREIMRHDPHTLIEGCLIASFAMRAHACYIYIRGEYIFEREQLQKAIDE
FT                   AYAAKLIGKDNVHGYDFDLYLSHGAGAYICGEETALLESLEGKKGQPRLKPPFPAGAGL
FT                   YGCPTTVNNVESIAVVPTIIRRGADWFKRFGRENNHGTKVFCISGHVNKPCNVEEEMSI
FT                   PLKTLIDTHCGGVRGGWDNLKAVIPGGSSVRCLPKSICDDVLMDFDALREHKSGLGTAA
FT                   VIVMDKSTDMVKAIARIAHFYKHESCGQCTPCREGTGWMWRVLVRMSRGEAEMWEIDKL
FT                   LDVAGQVEGHTICALGDAAAWPVQGLIQHFRHEIEEKITAYRANKPHIPVMAAE"
FT   gene            complement(297073..297276)
FT                   /locus_tag="PB2503_01872"
FT   CDS_pept        complement(297073..297276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01872"
FT                   /product="ATP synthase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01872"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08453"
FT                   /db_xref="GOA:E0TBW0"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW0"
FT                   /protein_id="ADM08453.1"
FT                   /translation="MANSSPSRTRALLQIVAVSALPFAFVFWLIGEAAGFQVALGGVLI
FT                   FAVIVGAVIGFSVLRRKGRSSP"
FT   gene            complement(297345..297578)
FT                   /locus_tag="PB2503_01877"
FT   CDS_pept        complement(297345..297578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01877"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01877"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08454"
FT                   /db_xref="GOA:E0TBW1"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW1"
FT                   /protein_id="ADM08454.1"
FT                   /translation="MDRRDQEGAAAKASGSGESRFYVIFALLEGSFLILAVAAYFLMHE
FT                   SVPLLIGSIVVISLVSSTFLLPRILSARRSQE"
FT   gene            complement(297586..298251)
FT                   /locus_tag="PB2503_01882"
FT   CDS_pept        complement(297586..298251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01882"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01882"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08455"
FT                   /db_xref="GOA:E0TBW2"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW2"
FT                   /protein_id="ADM08455.1"
FT                   /translation="MADRSPARQQPDSFQWTEDNKAWCEKEITKFPEGRQASAVIPFLW
FT                   RAQKQEGWVSIPAMEAIATQLGMPYIRVYEVATFYTMFNLKPVGTYFVQVCGTTPCMLR
FT                   GSESLIEVCERVIGPQGAITESGHLSWLEVECLGACCNAPMAQINDYYYQDLTPEKFEE
FT                   ILLTLDKGEAVAPGVFNPARHTSDPEGDNTTLTDESLYDGSAAKPIDRLPNSAPAEQG"
FT   gene            complement(298401..298712)
FT                   /locus_tag="PB2503_01887"
FT   CDS_pept        complement(298401..298712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01887"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01887"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08456"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW3"
FT                   /protein_id="ADM08456.1"
FT                   /translation="MKSSFLLISSVLMFTHGQDDALTVSQMDRSFAPGALSISAGQTVK
FT                   VINDDRFVHHVQSKHRNLKVDSGIQRPGEYIEIAFAKQGIYELTCAIHPKMSLKVAVD"
FT   gene            298841..300580
FT                   /locus_tag="PB2503_01892"
FT   CDS_pept        298841..300580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01892"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08457"
FT                   /db_xref="GOA:E0TBW4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW4"
FT                   /protein_id="ADM08457.1"
FT                   /translation="MHAGFGLMTLLTVSYAVWSIHALDRSSRIVRQTYDHSLMAINYAR
FT                   AAEANTARFLLSDRHDDEMLMTVVSDLAIVVDRSEGPSRDEASAIRDTIAGWREGNTPD
FT                   NAADWSEQAFDLLTELLAADSFIEREKAIAAADRSTRLAMIGMVLVALLSLLLAAGLNR
FT                   LIVTPLKALEVAARKIAAGAYDSSLPKVVGIELIALVTSMRVMQRKIARRIAEELEGRQ
FT                   RAETRLEAIIREAADAILILDKAGRIQMVNDAAQALLPEASMGRGERLTDLLAATSIDP
FT                   NIILTLNEGGETRLPNGVWVNAAAPHTNDEGRILVWSDITAIKAREEDLSAANEAKTRF
FT                   MAVTTHELRTPLNAVIGFSQLMRDEAFGPLGDESYQQFAREIFEAGNTLLGLVDDILRF
FT                   SDAQNTDYYADLELVAPAPLFHALCEGVRYDEHYTSLTLETIIDDTLQEIRAKPSHLTS
FT                   ALRHLLINAGQFSDEGGLVSFIAKDCGDTVVVTIKDRGKGMSAEALERALELFGQADNS
FT                   RTRHHEGMGLGLPLARTIVLSHRGTFDIESLAGEGTTITIILPYAEGEMAEDTPLTRSL
FT                   ASA"
FT   gene            300577..301437
FT                   /locus_tag="PB2503_01897"
FT   CDS_pept        300577..301437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01897"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01897"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08458"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW5"
FT                   /protein_id="ADM08458.1"
FT                   /translation="MIRFMFMAALATMIVSPPAAAQWAPDRGRLLMTGGVSQIEGQGGS
FT                   GLVPWALITGYGSELSWGASAFVTDVQLSDFSISSHGLAVGVRNRLELSYARQAFDTEE
FT                   LGGALGLGEGFEFDQEVFGAKLRLAGDVVTDQDTWLPQISVGIQVKKNKDGDIVRAVGA
FT                   DDDEGVDYYLSATKLLLAQSLLLGGTIRSTEANQLGFLGFSSTRTIQVEATAAALLTKR
FT                   LALGGEVRTKPDNLAFAEEEDAATAYLAYFPSKYLSLTAAYADLGTIAGLDDQTGSYLS
FT                   VQGSF"
FT   gene            301437..301871
FT                   /locus_tag="PB2503_01902"
FT   CDS_pept        301437..301871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01902"
FT                   /product="protozoan/cyanobacterial globin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01902"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08459"
FT                   /db_xref="GOA:E0TBW6"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW6"
FT                   /protein_id="ADM08459.1"
FT                   /translation="MRALIACLSLVVATAMAPQPAAALSDDALYRALGEKAGIERVIET
FT                   LLHRSLADPRIADTFEGANFERLEEKLVLQICELAGGPCVYDGLSMADSHMGQELTTAH
FT                   FNALVENLRAAMAAEGVGFRAQNRLLALLAPMHRDVVTKP"
FT   gene            301914..302843
FT                   /locus_tag="PB2503_01907"
FT   CDS_pept        301914..302843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01907"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01907"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08460"
FT                   /db_xref="GOA:E0TBW7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW7"
FT                   /protein_id="ADM08460.1"
FT                   /translation="MSSPSPSAGADRKTPDAAPRSFVDRLPAGMRPYFRLMRADRPVGL
FT                   WLLFWPCLWGTLIGRPDDMTAPEIYRLWALFLIGSVAMRSAGCIYNDIVDRDIDAQVAR
FT                   TASRPLPSGQVRVSEAWVLLVALCLVGLTVLLSLPLPAILIGLCALVLVAAYPFMKRIT
FT                   WWPQAWLGLTFNWGVLVGGAAVAGGLSGPILCAYAAGLFWTLGYDTIYALQDVEDDALI
FT                   GVKSSARALGDSAVTGVAVFYGLCVILMAFALLSQSALWGLLLLLPAAGHLTWQVRSLD
FT                   LSDGDRALRLFKANVWTGLLLALPGLAA"
FT   gene            302910..303260
FT                   /locus_tag="PB2503_01912"
FT   CDS_pept        302910..303260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01912"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08461"
FT                   /db_xref="GOA:E0TBW8"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW8"
FT                   /protein_id="ADM08461.1"
FT                   /translation="MDKLIVAAAALLGFAGVGLGAFGAHGLADRLTGPALGWWETATLY
FT                   LLLHAVAALCVGATGLSSIGGGCFVAGALIFSGTLYAMALGAPTFLGAVTPIGGLLLLG
FT                   GWAATFLAVITK"
FT   gene            303275..303814
FT                   /locus_tag="PB2503_01917"
FT   CDS_pept        303275..303814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01917"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01917"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08462"
FT                   /db_xref="GOA:E0TBW9"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBW9"
FT                   /protein_id="ADM08462.1"
FT                   /translation="MMIMNQLTRRSVLLGGSAALTVACTGRDSKAQEAAMSPSSPSEIN
FT                   DDTDWAELSEAAWKDRLTAEEFRVLRKEGTERAGTSPLNAEKREGTYVCAGCALPLFLS
FT                   SHKFESGTGWPSFFDVIDGAVDTKTDFKLIVPRTEYHCSRCGGHQGHVFKDGPQPTGLR
FT                   YCNNGVALDFVPAESA"
FT   gene            303819..304835
FT                   /locus_tag="PB2503_01922"
FT   CDS_pept        303819..304835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01922"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01922"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08463"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX0"
FT                   /protein_id="ADM08463.1"
FT                   /translation="MTPEALLHPTPAGLYCAPGDFYIDPVAPVDRAVITHGHADHARSG
FT                   HGSVIATEETLAIMAVRYGEEFTARRTALAYGETTNVNGVGLWLAPAGHVLGSAQAVIE
FT                   FGGLRMVVTGDYKRRRDPTCPAFEVVSCHIFISEATFALPVFHHPDTGGEVRKLLASQQ
FT                   QFPERTHLVGAYALGKAQRVIRHLREEGYDRPIFIHGALDRLCTLYESFGVNLSPLLPA
FT                   TLKDSSGEKTDFSGEIVICPPAAIQSTWARRFPDPVPCFASGWMRIRQRAKQRGVELPL
FT                   IISDHADWGELTDTVEAVDPDELWVTHGREDALIRWAELRGRVARPLHLIGYEDDHD"
FT   gene            304872..306485
FT                   /locus_tag="PB2503_01927"
FT   CDS_pept        304872..306485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01927"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01927"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08464"
FT                   /db_xref="GOA:E0TBX1"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX1"
FT                   /protein_id="ADM08464.1"
FT                   /translation="MNRFAALLESLIYTPSRNGKIRLLTEYFASTPDPDRGWAVAAMTR
FT                   DLDIKSVKPAMIKTLVEERVDPVLFGLSYDYVGDLAETVSLIWPGQEQRNYIPTLTDIV
FT                   ETLGEISRQEAPSVVADWFDALSPPARWALIKLITGGLRIGVAARLVKLALAEFGGQPV
FT                   QDIEELWHGLEAPYRDLFAWLEGRSPRPAQAAKAPFRPVMLAHPVEEKDQPKIDLTEMM
FT                   AEWKWDGIRVQTVVEDGVKRLYTRTGDDISGTFPDLLASLNEEVAIDGELLIFDPAITD
FT                   RFVVRPFNDLQQRLNRKVVSKKLLEESPAFIRAYDLLWARGEDLRPLPFSARRAHLEEI
FT                   SQQGAFPRLDLSPVIPLSSWEALADLRANPPEDAIEGVMLKRADAPYVPGRPKGQWWKW
FT                   KREPFLVDAVLMYAQRGHGKRSSFYSDYTFGVWRTGKDGEELVPVGKAYHGFTDLELKK
FT                   IDKFVRDHTIDRFGPVRAVRATREEGLVFEVAFEGLQRSSRHKSGIAMRFPRINRLRWD
FT                   KPTAEADRLETLEAMLPATA"
FT   gene            complement(306486..307430)
FT                   /locus_tag="PB2503_01932"
FT   CDS_pept        complement(306486..307430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01932"
FT                   /product="Putative malonate transporter, mdcF, AEC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01932"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08465"
FT                   /db_xref="GOA:E0TBX2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX2"
FT                   /protein_id="ADM08465.1"
FT                   /translation="MLDTLVVISPVFILVGAGATACWTGVISQATVDGTMSFVLKIAVP
FT                   VLLFRELARLDLALVFQPALLLSFYLAAFTAYTIGIVVARFVIGRDLPDAVVIGFGALF
FT                   SNSLLLGIPITFQSFGPESVAGNYAIIAFHSPLTYLVGLTVMEMVLAGRSGMRSLPRKV
FT                   GGAMFRNAIMVGIAAGILANLLSLAPTGPVGAATEMLAATAFPAALFSLGGVLTRIPIK
FT                   RSFGAAAMVASLSLLVHPAIAFLLGVGVFGLDKAGVVSAVMTAAMPTGVNGFIFAQLYG
FT                   RATGAAASAVFLATLLSVLTIPLWIMLLNTVLG"
FT   gene            complement(307553..308755)
FT                   /locus_tag="PB2503_01937"
FT   CDS_pept        complement(307553..308755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01937"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01937"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08466"
FT                   /db_xref="GOA:E0TBX3"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX3"
FT                   /protein_id="ADM08466.1"
FT                   /translation="MRALGALMAASYSIEGSDGEEVEELIPAPLDEGPSDAEEELGAPE
FT                   IRKQGQATFDSQARKFADEFREIWKNPEGNLHKALMQRTLNSRVFGAFLVGLLATTILG
FT                   ALFDLTAGLSMTQMVIGRAASVAVMGFGLAMLILTLRWNETHRAQLIIEQACSAISDGL
FT                   VERILRSRAEEIHRHINHLSFTKRDGHGSDPQQCVVEVSNLWREISLIPYLLDKEWKIF
FT                   KYAFVMKNERRRTRPFFIVSLIGYSALYVLAGIIAALALHNEGQPTLRAAIAGGTVAFF
FT                   GWAQFMVMAMVIRNQMRDRMSHFVAEIEERLGYYFGDGKSGKEEWMSVIARYDPAPIVG
FT                   KKLKDAYEFIARSRQSLDVDTGERGGRADDLSPPTGKSSGAVAWSPPAARPAPRVIRRI
FT                   R"
FT   gene            complement(308878..311052)
FT                   /locus_tag="PB2503_01942"
FT   CDS_pept        complement(308878..311052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01942"
FT                   /product="putative excinuclease abc subunit b protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01942"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08467"
FT                   /db_xref="GOA:E0TBX4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX4"
FT                   /protein_id="ADM08467.1"
FT                   /translation="MADPIPDTLAFSEAVATYHGRMEPATWSPHRPSRPEKMEGGRAFR
FT                   VSSDYEPAGDQPAAIAELVAGIAAQEQDQVLLGVTGSGKTFTMAKIIEATQRPALILAH
FT                   NKTLAAQLYGEFKSFFPDNAVEYFVSYYDYYQPEAYVPRTDTYIEKESTINEQIDRMRH
FT                   SATRALLERDDVIIIASVSCIYGIGSVETYTEMTFTLEVGETVERKQLLADLVALQYKR
FT                   NDVAFARGAFRARGDIVEIFPAHLEDVAWRISLFGDEIEAITEFDPLTGQKIADLPRIK
FT                   MYANSHYVTPRPTLRRAIEGIKKELAATLPILHQEGKLIEAQRLEQRVQFDIEMMEATG
FT                   SCQGIENYSRYLTGRKPGHPPPTLFEYLPENALVFCDESHVTVPQIGAMFRGDFARKRT
FT                   LAEYGFRLPSCMDNRPLKFEEWDAMRPQTVHVSATPGPWELDRTGGVFVEQVIRPTGLI
FT                   DPPVEIRPVTTGQVNQVDDVIDECKKVAAQGGRSLVTTLTKKMAEDLTEYMHEQGVRVR
FT                   YMHSDVDTIERIEIIRDLRLGVFDVLIGINLLREGLDIPECQFVGILDADKEGFLRSET
FT                   SLIQTIGRAARNVDGRVILYADGMTGSMERALQETERRREKQLAHNAAHGITPKTVKAK
FT                   IAEITDSDDEATKAAAGTSFTSERLTKGATGMGAMREEREAYIPGANMRSHLGALEKRM
FT                   REAAANLEFEEAATLRDEIRKLEALDLETR"
FT   gene            complement(311170..311712)
FT                   /locus_tag="PB2503_01947"
FT   CDS_pept        complement(311170..311712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01947"
FT                   /product="putative RNA polymerase sigma factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01947"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08468"
FT                   /db_xref="GOA:E0TBX5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX5"
FT                   /protein_id="ADM08468.1"
FT                   /translation="MGSQYLARARADRLKQRDGDLLDHPDAAEALCALRRFAFSLTRNE
FT                   DRAADLVQDCLERCLRKQYLFDGRNLRSWMFTVCRRVFLNQIRREQSRGIALELDDAPL
FT                   LALSVEGNQDSFMAFRDLCTSMENLSSDDRTMLSMIAVDGLRYEDVAEALDVPVGTVRS
FT                   RLSRARTKLKDSLDAVV"
FT   gene            complement(311964..312170)
FT                   /locus_tag="PB2503_01952"
FT   CDS_pept        complement(311964..312170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01952"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01952"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08469"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX6"
FT                   /protein_id="ADM08469.1"
FT                   /translation="MVSEKRLSKLQVLITETELATIDDWRFANRADSRSSAVRELIALG
FT                   LKLAESSPEQADQVLTSLRKLSS"
FT   gene            312445..313341
FT                   /locus_tag="PB2503_01957"
FT   CDS_pept        312445..313341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01957"
FT                   /product="sulfate adenylyltransferase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01957"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08470"
FT                   /db_xref="GOA:E0TBX7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX7"
FT                   /protein_id="ADM08470.1"
FT                   /translation="MTLTHLDRLEAESLHIIREVAAECENPVMLYSVGKDSSVMLHLAL
FT                   KAFSPSLPPFPFLHVDTTWKFREMIKFRDETAEKLGLDLKVHINAEGVRDNVGPFSHGS
FT                   AYHTDVMKTQALKQALDKYGFDAAFGGARRDEEKSRAKERIFSFRAPGHRWDPKNQRPE
FT                   LWSIYNTRIRKGESIRVFPLSNWTELDIWQYIYRENIEIPDLYFAAERPIVEIDGTLIM
FT                   VDDDRIPLEGREPQMKSVRFRTLGCYPLTGAVESTAATLPDIIQETLLAKGSEREGRVI
FT                   DHDQAASMEKKKQEGYF"
FT   gene            313341..315254
FT                   /locus_tag="PB2503_01962"
FT   CDS_pept        313341..315254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01962"
FT                   /product="binfunctional sulfate adenylyltransferase subunit
FT                   1/adenylylsulfate kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01962"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08471"
FT                   /db_xref="GOA:E0TBX8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX8"
FT                   /protein_id="ADM08471.1"
FT                   /translation="MATSPKDLAAVESDVVAYLEKHEQKSLLRFITCGSVDDGKSTLIG
FT                   RLLYDSQMLYEDQLSSLEQDSKKMGTQGDQIDFALLVDGLAAEREQGITIDVAYRFFST
FT                   DRRKFIVADTPGHEQYTRNMATGASTAQLAILLVDARAGLMTQTRRHSFICSLLGIRHI
FT                   VLAVNKMDLVDYSEDKFKEIEADYRDFSKGLGFEGITCIPISALAGDNITASSENTPYY
FT                   TGPSLMDHLETVNVERSEQRPFRMPVQWVNRPNLDFRGFSGTVASGSISPGDEIITIPS
FT                   GQRSKVARIVTMGGDLDMAETDQAVTITLEDEIDISRGDIICGGQAPADQTDQFSAHLI
FT                   WMSDEEMLPGRQYILKTANKSVTGVVTDLRNKIDVNTLEQRPGKTLGLNEIAVCKFNLS
FT                   APIGYDPYKENRATGSFILIDRQTHSTVAAGMIDHSLRRASNVVWQDLEVGTAERAAIK
FT                   MQRPALLWFTGLSGAGKSTIANLVEKRLYDRGRHTYILDGDNVRHGLNKDLGFTDADRV
FT                   ENIRRVAETAKLMVDAGLIVLSAFISPFRTERQMARSLLGEGKFIEVFIDTPLNVAEER
FT                   DVKGLYKKARAGEITNFTGIDSEYEPPKEAEIHIDTTALSSVEAAEKIIAYLEEGGYLD
FT                   AE"
FT   gene            complement(315418..316857)
FT                   /locus_tag="PB2503_01967"
FT   CDS_pept        complement(315418..316857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01967"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01967"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08472"
FT                   /db_xref="GOA:E0TBX9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBX9"
FT                   /protein_id="ADM08472.1"
FT                   /translation="MRWSGLSLAARMALVLALSLLLAQGVSLALLLESRARLADVRAQA
FT                   TIDRFVDAVARDEARPIGAMLRRRLRPGGLSIPVETGTPIAAAFPLEEDLTERLIRSLT
FT                   AEGLPSEGASVGLAPQLPGALRRRPSEANEQLAQAETAPRHLVLSAPIPSGGFVNSVVP
FT                   EPFRDQVRIRPLIVQTILIYLGLLAATLIVTRQLSRPLARLTLTARQLTVPGPPPDLPR
FT                   RGPSDITDLSAAFADMHARLETVFTEKDAMLGAIGHDLRTPLTSLRLRAERIADDELRE
FT                   QMIASLDAMALLLTDILAVAKTGRGSGERQAIALDKLCAELAATHPALEVGGERGLIVQ
FT                   GFPMLLQRAMENILDNADRYGAPPIRLDIRRAGGDVLLRVEDCGEGFPAQGEEASRLIK
FT                   PFERGEVSRSRVTGGAGLGLAIAEAAASAHGGALTIGRATGGGAQVTICLPAAPVSPAP
FT                   EDLAPNDPPQDDRAETQTERP"
FT   gene            complement(316854..317570)
FT                   /locus_tag="PB2503_01972"
FT   CDS_pept        complement(316854..317570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01972"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01972"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08473"
FT                   /db_xref="GOA:E0TBY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY0"
FT                   /protein_id="ADM08473.1"
FT                   /translation="MSGEKILIVDDEASIREPLADYLAGHHYDILRAKDGLEAREVCRT
FT                   AQPDLVLLDIMMPGEDGLSLLREWQATGGPPVILLTAMADDTDRIVGLELGADDYVTKP
FT                   FNPRELVARIKAVLRRAGGEGANPPPDACEGYSFAGFHLDIGRRHLTGPDHPSIPLTGG
FT                   EFALLHVLLDSAGRVLSRDQLLDATQGREAHLFDRSIDNQISRIRKKIELDPKQPQIIK
FT                   TVRNGGYVLSVPVSRR"
FT   gene            complement(317721..318968)
FT                   /locus_tag="PB2503_01977"
FT   CDS_pept        complement(317721..318968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01977"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08474"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY1"
FT                   /protein_id="ADM08474.1"
FT                   /translation="MGARLFLETSPLMIRVLRMDEDGPVKIAHATGDKREALLGDLYRA
FT                   KVLGHDPRLGAAFVDLGTGGEGFLRRPGKLPPVGATLIVEIKREAMGAKGPDVTDKWSA
FT                   ALPLLRLTAQRATPGPLGEDQLLADRIGPQLSREGEPGRIDICPVEIRLLMTLGLQAED
FT                   RVIVTTGEAAARLAPFLGGVAETLPMKQIGEQIDLAEEEALRHRHIIPGGGALTIEETE
FT                   AAFTVDLDLAQGAGQSKAGAGSRLLAEAMRPLGRLLSLAGAGGQILIDAPRGAIAAPKI
FT                   FRDQLTRALKPLGRVSVPAVTPEGCALVVAPRPRPSTLMKLTEPFGQGVVQGRRMSAPV
FT                   ARASAYRALAAALERNPTAQRRLVVAPRLAEGLVGEGPAAHLMRERYGPRFEILVDRTF
FT                   EEKAVTQGGEAYRVEE"
FT   gene            complement(318968..319600)
FT                   /locus_tag="PB2503_01982"
FT   CDS_pept        complement(318968..319600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01982"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01982"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08475"
FT                   /db_xref="GOA:E0TBY2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY2"
FT                   /protein_id="ADM08475.1"
FT                   /translation="MSETGSNDTQSKAGPRLILASGSARRRALLTQIGYPPDEIHPADI
FT                   DETPREDELPRLLAGRLAEEKAMVVADRYPGDVVVSGDTVVAAGRRILPKAETRDEAAT
FT                   CLSLLSGRSHRVYTGMACAGANREKIRTRIVETRVKVKTLSHTEIDLYLDSHQWSGKAG
FT                   GYAIQGAFAAFIIQIVGSYSGVVGLPLYETANLLRDALGRAPAFPAD"
FT   gene            complement(319624..319842)
FT                   /locus_tag="PB2503_01987"
FT   CDS_pept        complement(319624..319842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01987"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01987"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08476"
FT                   /db_xref="GOA:E0TBY3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY3"
FT                   /protein_id="ADM08476.1"
FT                   /translation="MAKEELLEFQGTVEELLPNANFRVKLDNDHEIIAHTAGKMRKNRI
FT                   RVLAGDKVLVEMSPYDLSKGRITYRFK"
FT   gene            complement(319895..320332)
FT                   /locus_tag="PB2503_01992"
FT   CDS_pept        complement(319895..320332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01992"
FT                   /product="putative arsenate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01992"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08477"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY4"
FT                   /protein_id="ADM08477.1"
FT                   /translation="MGKATRSILFACNMNSVRSPIAEALARRLLGPGTRVESCGVYEGM
FT                   LDPFVAEVLLENDLPVPQRPPQTFADVDLAEFDRVIALSPEAAAEARRLSGNVSYWEID
FT                   NPTDIRGGDEELRRAYRLCRDCLAERINSEFQSTTAISPAS"
FT   gene            complement(320335..320823)
FT                   /locus_tag="PB2503_01997"
FT   CDS_pept        complement(320335..320823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_01997"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_01997"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08478"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY5"
FT                   /protein_id="ADM08478.1"
FT                   /translation="MTERLVAIDIDEGSLGARSSEVDHERKVAMHDLLEENRFAPVGGE
FT                   DKGPYRLKLFEQNGRLVFDVSTEAGDPLIQHHLSMTPFRRLIKDYFMLCETYYDAIRAA
FT                   MPEKLETVDMARRSVHNEATELLQKRLEGKISTDFDTARRLFTLICSISLRASSRGDR"
FT   gene            complement(320901..322199)
FT                   /locus_tag="PB2503_02002"
FT   CDS_pept        complement(320901..322199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02002"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02002"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08479"
FT                   /db_xref="GOA:E0TBY6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY6"
FT                   /protein_id="ADM08479.1"
FT                   /translation="MVQRLTTAAADFDGQLTTLLSRKQEASPAVAEAVRGIIQQVIKEG
FT                   DGALRDLTRRFDSHEADSLAISVAERDAAADRASPEAVAALEAAAARIETYHRKQMPDD
FT                   ELYTDEEGVTLGWRWTPLEAVGLYVPGGLASYPSSVLMNAIPPRVAAVPRMVMVVPTPD
FT                   GQINPLVMAAARICGIEEIYRIGGAQAVAALAYGTETIASVDKIVGPGNAYVAAAKREV
FT                   FGHVGIDSIAGPSEIVVVSDNRSPAPWVAADLLSQAEHDPSSQSILITDDAAFADAVEG
FT                   AAEDLLAVSPREAITRRAWEQNSALIVVRRLGGDGMEVVNRLAPEHLELAVDKPEDLLP
FT                   SIRHAGAIFLGRHTPEAVGDYVAGPNHVLPTARAARFSSGLSVADFLKRSSLIGCSAES
FT                   LEVIGPLAMTLAEKEGLWAHGESVRQRLEDRGQ"
FT   gene            complement(322200..322649)
FT                   /locus_tag="PB2503_02007"
FT   CDS_pept        complement(322200..322649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02007"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08480"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY7"
FT                   /protein_id="ADM08480.1"
FT                   /translation="MTRVSHTPLALMAADREDLEVVSSILQDAAGRLADTAYLPAERRF
FT                   VWVANRFLWEEGVRRRRGPFHRVRTGLHIDDVVRVRTRGLPADRATGVLALLRVGYDGD
FT                   ENGGTVSLDFAGGGTVALDVEAINITLKDLSAPWRTKHKPNHEEG"
FT   gene            complement(322719..323984)
FT                   /locus_tag="PB2503_02012"
FT   CDS_pept        complement(322719..323984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02012"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02012"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08481"
FT                   /db_xref="GOA:E0TBY8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY8"
FT                   /protein_id="ADM08481.1"
FT                   /translation="MDKLAIIGGRELYGVLPVSGAKNSALKVMVASLLTEECLTLENVP
FT                   SLADVRQLMVLLDHLGVAISGGGTTLHLTAETLRSTLAPYDIVRKMRASFNVLGPLLAR
FT                   EGKAKVSLPGGCAIGARPVDQHLKALEALGAEIDLDEGYVLASAERGLRGASITFPFVS
FT                   VGATEHTMMTATLAKGETILENAAREPEIVDIAECLRMMGAKIEGDGTSTIKITGVDRL
FT                   SGGTHRVVPDRVEMGSYAMAVGAVGGELLLEGGRLDLLGAAKGVLLDAGLSLSEEEGGV
FT                   RVKKWGRPTVGTDIRTEPFPGFPTDLQAQYMALMALADGTSVIRETVFENRFMHVPELM
FT                   RLGADIRVDGQQATVRGKPVLKGAPVMATDLRASMSLIVAGLAAEGQTLLSRLYHLDRG
FT                   FERLDEKLRAVGALVERVAVPD"
FT   gene            complement(324008..324148)
FT                   /locus_tag="PB2503_02017"
FT   CDS_pept        complement(324008..324148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02017"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02017"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08482"
FT                   /db_xref="GOA:E0TBY9"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBY9"
FT                   /protein_id="ADM08482.1"
FT                   /translation="MTDDPAHPTSPRAPRKETPREARLAEALRENLRRRKSAAKSRKDE
FT                   A"
FT   gene            complement(324372..324446)
FT                   /locus_tag="PB2503_t07308"
FT   tRNA            complement(324372..324446)
FT                   /locus_tag="PB2503_t07308"
FT                   /product="tRNA-Thr"
FT   gene            complement(324672..325442)
FT                   /locus_tag="PB2503_02022"
FT   CDS_pept        complement(324672..325442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02022"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08483"
FT                   /db_xref="GOA:E0TBZ0"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ0"
FT                   /protein_id="ADM08483.1"
FT                   /translation="MRMAGQVLARYRIAPKAALSALLLIGLYEVWRVVFYILGYSAATP
FT                   PTSFPLINDTAKALDVMATHPNLILYTHGLCGVAAVTIGAVQIYALWTGQVRRWHALLG
FT                   RGYIAACLMGAATAFILAWHLYYTFWLTSLLYTLGALAWGGAAVLAVTYIVKGDVMAHA
FT                   RWVIRSYVYLMMVVTARALIGATIGFGLNRWAQFEWPLAYGIIIGVTFIVHLVAAEVIV
FT                   RRLRLVRPIRAGSTLLTEEVSSVASGVPSSPAPH"
FT   gene            complement(325571..326482)
FT                   /locus_tag="PB2503_02027"
FT   CDS_pept        complement(325571..326482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02027"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02027"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08484"
FT                   /db_xref="GOA:E0TBZ1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ1"
FT                   /protein_id="ADM08484.1"
FT                   /translation="MMMDDTSPPIDETRIRLAVQKKGRLADSTFELLAQCGLKVRFGKS
FT                   QLFARIRELPIDVLLVRDDDIPELVASGAADAGIVGANVYSEDQLDRADRSAAVIKELG
FT                   FSRCRLCIAVETGVAYPGPSYFRGKRIATSYPHLTADWLRKKGVEDVEIVMMHGAHEIA
FT                   PRLGHAHAICDIVQTGTTLDQNGLKVAETIFSSQALLIARPDAPQEKSALIDDLAARMA
FT                   AAMASRDAKYVMMNAPRSAIADIRKVLPGKDAPTILALAGSEEMVAIHVVCKEEVLWDQ
FT                   LEELKGLGASAILVLDIDKMLS"
FT   gene            326593..328758
FT                   /locus_tag="PB2503_02032"
FT   CDS_pept        326593..328758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02032"
FT                   /product="peptidase M13 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02032"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08485"
FT                   /db_xref="GOA:E0TBZ2"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ2"
FT                   /protein_id="ADM08485.1"
FT                   /translation="MVRRHSSLMLSSLLVLAACGGESSQEPQVPIATDEALSMTPEGTS
FT                   APDMVTPSAGQPDGPELGAWGIDLTAMDVSVDPGDDFFRYVNGSWLEGFEIPAEFSNYG
FT                   AFTVLFERSEARVRDIIESAAATESEAGSISQKIGDYFASFVDRDGIDAKGLAPIAGQI
FT                   ETYAALEDHADIAAAFADIDAGSNSPFVFYVDVDNKQPDRYIVYLTQSGLGLPNKDYYV
FT                   KDEFAEQREAYQDFLVQMVATADRALAENGLGVTVTEGDVADRAAAVYALEEKLADAHW
FT                   DPAKRRNADLTYNLYTLAELGDYAPGFPWSDSFDIAGIGQQDEFVVRENDAIKASAAIF
FT                   ADTPVAVWADYLAVHALIENADVLPSDVDAQVFDFYGRTLSGTPEQRARWKRGVQAVNG
FT                   AMGEAVGQIYVERYFPPESKAQMQQLVENLKTAFSQRLDALDWMGEATKDEARAKLASF
FT                   TTKIGYPDKWTDYEALEIKPGDAFGNARRAQRFEFEEMIGKLGQPIDKTEWFMTPQTVN
FT                   AYYSRNRNEIVFPAAILQAPFFDPHADPAVNYGGIGAVIGHEIGHGFDDQGRKADGTGL
FT                   QRDWWTEEDAARFDALAEKLGKQYGGYSPLNGHFINAELTMGENIGDLGGVTMAYDAYR
FT                   LSLNGEEPEVLDGFTGDQRFFMAWGQVWKRKYREDELKRRLVTDPHSPSEYRTNGVVRN
FT                   MTPWYEAFTVTEEDDLFLPVDQRVEIW"
FT   gene            328874..329317
FT                   /locus_tag="PB2503_02037"
FT   CDS_pept        328874..329317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02037"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08486"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ3"
FT                   /protein_id="ADM08486.1"
FT                   /translation="MSISAGMVVAMAMTAGTPRAESALDNVSGHWFTPDKASIIKIEDC
FT                   GDGTPCGKVVWIDTDGDHLRRDRHNADPGLKDTPLEGRVLLHGFEANGERWTNGAIYNP
FT                   ENGHTYRALLERLDAQRLEVKGCVGPICRGLIWTAADRALLGE"
FT   gene            complement(329431..330630)
FT                   /locus_tag="PB2503_02042"
FT   CDS_pept        complement(329431..330630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02042"
FT                   /product="putative 3-ketoacyl-CoA thiolase/acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02042"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08487"
FT                   /db_xref="GOA:E0TBZ4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ4"
FT                   /protein_id="ADM08487.1"
FT                   /translation="MREAVIVSFARTPIGKAYRGAFNNTGATELAGHALKHAVDRAKID
FT                   PERIEDVVMGEAMQYNTGGFNLGRNAALRAGLPMSVPGQTMDRQCGSGMMAIATAAKQI
FT                   IADNMDVCAAGGAESISTNQGPKMPTVMPNPWLLEHIPQTYMTMIETAEIVSDRYDIKR
FT                   ELQDEYGYQSQQRTAAAQEAGYFDDEIVPMSSVMIRKDKETGETSQQEVTLEKDEGNRP
FT                   QTTLEGLNGLSPVFKGGQRVKEGSYITAGNASQLSDGAAAVVLMERKAAEQAGLEPLGA
FT                   YRGMAVAGTDPDEMGIGPVFAIPKLLEKNGLSIDDIGLWELNEAFACQVVYCRDKLGIP
FT                   NDRLNVDGGAISVGHPYGMSGARMVGHALLAGKRLGAKYIVSTMCVGGGQGAAGLFEVY
FT                   "
FT   gene            complement(330753..331295)
FT                   /locus_tag="PB2503_02047"
FT   CDS_pept        complement(330753..331295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02047"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08488"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ5"
FT                   /protein_id="ADM08488.1"
FT                   /translation="MMTVIGADRATQEAGEGRLAPFVRSKVFTNLFAQGMELVEETAGY
FT                   LDNTGRAAARELSREAQMTYAGVSMRLTTRLMQIASWLLVLRAVRDGEMSEDEAADEKY
FT                   RVGPAEPGGKSATDVDVLPEELLELIAETDTLYTRIRRLDHDLFDDAAGRDSHAGDAQT
FT                   RLAALQQAFGDRENSPS"
FT   gene            complement(331441..332460)
FT                   /locus_tag="PB2503_02052"
FT   CDS_pept        complement(331441..332460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02052"
FT                   /product="phosphate binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02052"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08489"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ6"
FT                   /protein_id="ADM08489.1"
FT                   /translation="MIKRVVICLAALTLTAGFGAGLERVEIAGATSVTPFAEVVQKILH
FT                   DDILVTLNQRGSTRGLRQLCEKASVPTVVLSSHRVTAETLDRCRVHGFDWLREIKVARY
FT                   GLVLAQNASTSPLELTTRDLFLALGARTPLSDQDCTLLTNNRTSWSAVRSSLPARPILM
FT                   IGPAQGTDRFNDFVDLALRDGARSFPCLATLEVKAPQIFDRAVKVRNDQHWVVAGDDEG
FT                   AVAGVLRHLPHGLALFGWSSLIGTDELAILPLNGVHPTTSTIADRTYPLTQDFYLYTAE
FT                   AHLGEESAVRRVVEPFVNLGETSPGGRLFEIGFVPPRDSELSYLVNVASGERSAALSP"
FT   gene            complement(332457..334328)
FT                   /locus_tag="PB2503_02057"
FT   CDS_pept        complement(332457..334328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02057"
FT                   /product="sensory box sensor histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02057"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08490"
FT                   /db_xref="GOA:E0TBZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TBZ7"
FT                   /protein_id="ADM08490.1"
FT                   /translation="MAEASTQLRASFDRRYLLAIALLTAAAVANFTLSYIMASLDTDRA
FT                   HVFNLVTAQETGAQRVANLASNLIDPNAAEDIAATREALRTTIDRMRDVHETLIGKGAG
FT                   KERIARYIEPLDDIFGSGRGSFEGRIRDFFENAETIAQGGGLSDAQRALAVAVIDDADS
FT                   ILRTHNLMALVLEEKARQQNRFEKLLHVGALVSMCLALCLVTIFIFRPMASSIEKAVDN
FT                   LEGAKATARHAEEAATQANRARGDFLQAASHELKTPLNAILGMTDAIRDKKVKGIEVEL
FT                   EQIIAAGDHLLTILNNILDTHRLSEGKLKLEHRDFSLSEAIAGPLARARAAALAKGIDF
FT                   QVENKLPADLSVVGDARRIEQVVTNLLDNAVKFTENGSVKFDAGISAEKDKLADIYMKI
FT                   VDTGIGIEQERLRQIFERFSTEGSMLTRNGGLGVGLALAREIVRSMGGEIEVKSDIGLG
FT                   TSFAVHIPMPVSNEPHQSAPANPASDRNIHENNGRPLNILIVDDNLANRMVAEALVKPL
FT                   GATTQSAADGRQAVDMASKERFDIIFMDISMPVMDGMTATKMIRASDGPNAQTPIVALT
FT                   AHMGTAEWDEIRRAGLDDILNKPVRRDMIVKCLDKWTKAPVDEAISA"
FT   gene            334461..335444
FT                   /locus_tag="PB2503_02062"
FT   CDS_pept        334461..335444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02062"
FT                   /product="NADPH/quinone reductase and related Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02062"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08491"
FT                   /db_xref="GOA:E0TC58"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC58"
FT                   /protein_id="ADM08491.1"
FT                   /translation="MRCIAITSPGGPEALVPADRPAPLPGPGQILVAVAAAGVNRPDAL
FT                   QRQGLYPPPKGASPLPGLEIAGTVSGHGEGVTSPPLGTRVMALLPGGGYAETVAVDARH
FT                   ILPLPDDLSFVEAAAMPETLFTVFANLIEAGQLVEGARVLVHGLTSGIGTMAIRLATAY
FT                   GAFIWGTAGTADRCRAAEALGAVRCYDYRQEDWAAALSTEPPMDIVLDMIGGDYVAKNL
FT                   GLLAIGGRHVSIAFLGGAKATIPIPLVMTRRLHLTGSTLRSRSDEEKARLTAAIAQHVL
FT                   PMIAEGTVRPVIDSVFPLAEAADAHRRLDDHHIGKIVLSVDGAAAP"
FT   gene            335624..336310
FT                   /locus_tag="PB2503_02067"
FT   CDS_pept        335624..336310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02067"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08492"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC59"
FT                   /protein_id="ADM08492.1"
FT                   /translation="MADKPLMPKATAVWLIDNTGLTFEQIADFCGLHTLEVKGIADGDV
FT                   ASGVRGIDPITQHQLTREEIEKAEADEDYRMKLSKPKTIVAPPKKKAPRYTPLSRRQER
FT                   PNAIAWIVRHHPEVPDAQIVKLLGTTKTTIQAIRNKTHWNSSNLEPQDPVALGLCSQFD
FT                   LDMAVSKAAEKRAAMQEAGRLSEGDSLAPAAETERGEEEAPEAPEAAPDIDKIFANFSD
FT                   KDEEDS"
FT   gene            336410..337228
FT                   /locus_tag="PB2503_02072"
FT   CDS_pept        336410..337228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02072"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08493"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC60"
FT                   /protein_id="ADM08493.1"
FT                   /translation="MVVRHLALAGVSLGLGAWAAQAVSAPAVSSTSPSAASVSAMSEIN
FT                   APYASFLSRYISMEDGIALVEYGAVTAADHQVLKTYIADLAGLSPSTFSRDEALAYWFN
FT                   LYNAKTLDIVLDHYPVTSIKDIGRSFTNPLGGPWKQKVVTVEGRKLSLDNIEHDTVRAT
FT                   YDEPRVHYAFNCASIGCPNLKSSPWTAETLDTDLDSAARAYIAHPRGLRIEDGEVTASS
FT                   IYKWFQEDFGGSEDGVLDHVRAYATGAKAEALSDVTDIDDYAYDWSLNDR"
FT   gene            complement(337179..337871)
FT                   /locus_tag="PB2503_02077"
FT   CDS_pept        complement(337179..337871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02077"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08494"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC61"
FT                   /protein_id="ADM08494.1"
FT                   /translation="MAKPPLIGRVKTRLARDIGAVSAVGFYRWSVHRLLTRLARPRQWR
FT                   LVLAVNERAARRYACWPAGTVERCAQGRGNLGDRIGHVCAQFGAAPCVVIGTDSPQIDP
FT                   WLIERAFAALGGHDAVFGPAEDGGYWAIGVNHGAALPDLSAVRWSTPKALEDSLAAFRA
FT                   QARIATLPTLVDVDDAASYRQLVQQYGPLRHGPMPPQAREAGRGLRGEKAAFSGRSKTN
FT                   HRRSRRYR"
FT   gene            complement(337822..338592)
FT                   /locus_tag="PB2503_02082"
FT   CDS_pept        complement(337822..338592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02082"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02082"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08495"
FT                   /db_xref="GOA:E0TC62"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC62"
FT                   /protein_id="ADM08495.1"
FT                   /translation="MSMISVVIPTLNAAPHLAGPLCSLVEGMCQGLIKEVIVSDGGSDD
FT                   GTSDIAEGVGARLVVGAAGRGAQLARGAAVARGAWLLFLHADTQLAPGWERVAERHMQE
FT                   SYERVAGVFRLRFDRPGLRPALVAMGANLRTALFKRPYGDQGLLIARRHYDDIGGFAPL
FT                   PLFEDVDFIQRLVERGGRRALRGLPITAITAADRYEAEGYFRRVGRNAALRRAYRRGVP
FT                   PTDLAERYYAPSPTRLDPYGKAAAHRARQDTLGP"
FT   gene            338650..339777
FT                   /locus_tag="PB2503_02087"
FT   CDS_pept        338650..339777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02087"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08496"
FT                   /db_xref="GOA:E0TC63"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC63"
FT                   /protein_id="ADM08496.1"
FT                   /translation="MFWLAGHRRKMTDRAISPPFSPHRPASGRGRGARSNVSGRYEKES
FT                   RETVDDGWHDTPPDRPKTIVQMEPARRIITYNDSPYVGFDRSINPYRGCEHGCIYCFAR
FT                   PSHAYMGLSPGIDFESRLFAKPEAATLLKKELSSKRYQIRPIAIGTNTDPYQPTERRLL
FT                   IMREVLKVLSSYNHPVSILTKSDLILRDLDILGPMAKKGLVRAMLSITTQDARLARTME
FT                   PRCPRPDKRFAALEGLAQAGIPTGVMHGPLIPGLSDHELEALMEKARDKGATFAAYTLI
FT                   RLPIEVADLFQEWLKAYTPHRYDRVIGHIKSMNGGRLYDVNWSRGDGPKNPVALLVAQR
FT                   FAAAYRRLGFQNFPPLRTDLFCPPKPPRAQADLFA"
FT   gene            339856..340485
FT                   /locus_tag="PB2503_02092"
FT   CDS_pept        339856..340485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02092"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02092"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08497"
FT                   /db_xref="GOA:E0TC64"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC64"
FT                   /protein_id="ADM08497.1"
FT                   /translation="MNASADTELAFADEIGGPICGIDEAGRGAWAGPVVAAAVICGDVK
FT                   AYPEDLADSKTLREARREHLFDLLSARQDLRVGVGVASVAEIDRMGVGKANWLAMARAV
FT                   KALPSPPLGALVDGNYAPALPCPDIRPIVKGDGSCLVIAAASIVAKVTRDRIMRSLCPE
FT                   HPAYRWSANKGYPAPVHRAALEEIGPSAHHRHSFAPIAALDDRHAS"
FT   gene            340636..341670
FT                   /locus_tag="PB2503_02097"
FT   CDS_pept        340636..341670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02097"
FT                   /product="modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02097"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08498"
FT                   /db_xref="GOA:E0TC65"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC65"
FT                   /protein_id="ADM08498.1"
FT                   /translation="MKMIPDGSVDLIFADPPYNLQLGDGLTRPDQSTVDGVNDAWDQFG
FT                   SFAAYDAFCRAWLSEARRLLKPDGAIWVIGTYHNIFRLGSIIQDLEYWIQNDVVWVKTN
FT                   PMPNFRGTRLQNAHETLIWAARGKESRPTFNYHSLKTANDDLQMRSDWTFPLCTGQERL
FT                   KNGGKKLHPTQKPEALLHRILLGTTNPGDLVLDPFFGTGTTGAVAKRLGRHYIGIEREA
FT                   AYIDAAAERIAAIEPEAAEMVTPMPSPRREARIPFGRLVEDGLLSPGTVLYCAKRRYRA
FT                   KVKADGSLATPGATGSIHKIGAHLQNAPSCNGWTFWHVERQGRLLPIDTLRQTVRAQMA
FT                   SMAS"
FT   gene            complement(341665..342723)
FT                   /locus_tag="PB2503_02102"
FT   CDS_pept        complement(341665..342723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02102"
FT                   /product="Putative mutY, A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02102"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08499"
FT                   /db_xref="GOA:E0TC66"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC66"
FT                   /protein_id="ADM08499.1"
FT                   /translation="MTRSDKTAFSTSLLEWYDRHARQLPWRISPAASRAGVRPDPYRVW
FT                   LSEIMLQQTTVATVTPRFAAFVQRWDGFPALAEAPLEEVLGEWAGLGYYSRARNLHACA
FT                   KVVTRLHDGQLPASESALKDLPGIGPYTAAAIAAIAFDRRAVVVDGNVERIMVRQAAIE
FT                   RPIKEAKAAIYALAAEVVPDRRGGDYAQALMDLGATICRPRRPDCLLCPVRSSCRAHAL
FT                   GLEAQLPVKPPKKKRPTRRGIIYVGIGPRGCVLSETRPAKGLFGGMRGLPGSAWTEEGG
FT                   DEEGAPFEADWQCAGRISHTLTHFHLELDVKWAPTEGAPAPFFWTPIAEHGAFPTLFRK
FT                   AAVAALSAAGEL"
FT   gene            342766..343251
FT                   /locus_tag="PB2503_02107"
FT   CDS_pept        342766..343251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02107"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08500"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC67"
FT                   /protein_id="ADM08500.1"
FT                   /translation="MPFPPPPVKTKGVRPSAPTLRRQTGDLLADLAKKAGIIDPAIVTY
FT                   WADIVGPDLEALCRPVRLKKNRGAFVLHVDVPHGGAATQVHYAQGNILAKASRHVGRPI
FT                   TRLVIEQTGRRAEPTRWRSRRMTDPQVDRPPFSVGSAATTEEALAALRKALSETDSP"
FT   gene            343336..344025
FT                   /locus_tag="PB2503_02112"
FT   CDS_pept        343336..344025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02112"
FT                   /product="twin-arginine translocation signal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02112"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08501"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC68"
FT                   /protein_id="ADM08501.1"
FT                   /translation="MYRLVGVWVVLLAGVLSGCGGGAQENATAEGETSASQSQTLAAPE
FT                   GSLAGATMALGSEEAPLTIIEYASVTCPACAAFHAQYFPEIKEKYIDTGKVRFIYREFP
FT                   TAPQNLAYAGFYTARCAATDRGPVAYFAMLDTLYARQREWAYGDNPGDVLENIAAQAGI
FT                   DRQELETCFRREDIRSAVKANVLEGVEAHGVNSTPTFIVDDEELDWNRGSETMSEAIER
FT                   ALAARQG"
FT   gene            344167..347640
FT                   /locus_tag="PB2503_02117"
FT   CDS_pept        344167..347640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02117"
FT                   /product="chromosome segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02117"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08502"
FT                   /db_xref="GOA:E0TC69"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC69"
FT                   /protein_id="ADM08502.1"
FT                   /translation="MEFQRLRLTGFKSFVEPTDFEIRPGLTGIVGPNGCGKSNLLEALR
FT                   WVMGATSAKALRAGGMEDVIFAGSGTAERTGRPPRQWAEVALQIGNETRTAPDAYNDQP
FT                   LIEVSRRITKKAEGTQSTYRINGKEVRAKDVQLLFADGATGANSPALVRQGQVSDLINA
FT                   KPENRRKFLEEAAGVAGLYTRRHEAELRLKGASQNLERLDDVLGELEQQRGQLARQARQ
FT                   AVRYRTLSENLKKTEALLAYSRWADARDALEGANAQLEGTRRQLEEAARAAASATAERE
FT                   RAHEALPALRKTDAEAAAALHRLTVEQETYERELIRAEEEIERLRAEKDRLDQALVRER
FT                   DLGADAAEALDRIAADVAALEAGAAAETEALAALGTKVTEAETAFSAAEKAAAAAQAQY
FT                   TDAKAERSANVSRVEAATRAQQSAEAELARLRDDLAQFESDAAGEDDAPLKSALATAET
FT                   ALTAATTERERLRADLAEAEAAADALSDPRDQARAATNALQAEVDTLTRILKQSEPEGV
FT                   SLADRISVAPGVETAFAAALPEALALGDDPEADRYWSALGAMPADLPSLPAGATPLADE
FT                   VSAPDLLHRRLAMIGVVSPEAGPDLAQHLVPGQCLVSTVGDIWRWDGYVAKAGAKTAEA
FT                   LWLERKRELAEKETALAAAFTARDDAESAFADARHIVTDLKASLATARSRAEAADRERL
FT                   TAERALAKQAAEAERRAAKGEALLARRNEAAARLQSATQALQTAQTALDSLPDLDAAGA
FT                   QLGRLNSERDQARQALGRLRGQRADLQRDRDSRQARLTQLIADKEGWERRAATAVDRTG
FT                   SVSDTLNALVDQLAAAERRPEDLATRRTSLFEAVDRAEADRRRAADALAEALALQEQAD
FT                   AAARLTAEAVSVAREVKAREEALRDAARDRLSEMASRAHELHEGDPDGLLTVAGHDPDT
FT                   PLPDQTTLEEKVDKLKRDRDSMGGVNLCAEQEMTEIDDRLSDITRERADCEEAIAKLRG
FT                   AIGSLNRDGRQRLLDAFKTVNTNFQALFSDLFGGGSAELRLVDSDDPLEAGLDIFASPP
FT                   GKKLTSMSLMSGGEQALTATALIFAVFKANPAPVCVLDEVDAPLDDANTDRFCAMLAKM
FT                   AAETETRFIAITHHPLTMSRMDRLYGVTMIERGVSQLVSVDLEQAEKLAA"
FT   gene            347760..348227
FT                   /locus_tag="PB2503_02122"
FT   CDS_pept        347760..348227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02122"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08503"
FT                   /db_xref="InterPro:IPR019884"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC70"
FT                   /protein_id="ADM08503.1"
FT                   /translation="MRTWTIYLSGEIHTDWRDDIAAGAKARALPVVFSAPVTDHPASDD
FT                   CGVAILGSEDSKVWHDRKGAQLNAIRTQTLIKAADIVIVRFGDKYRQWNAAFDAGVAAA
FT                   LGKPLIVNHGPDLIHPLKEVDAAALAVAETSDQIVEILDYVINGRLAGYTD"
FT   gene            348322..348678
FT                   /locus_tag="PB2503_02127"
FT   CDS_pept        348322..348678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02127"
FT                   /product="ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02127"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08504"
FT                   /db_xref="GOA:E0TC71"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC71"
FT                   /protein_id="ADM08504.1"
FT                   /translation="MGVLLTGFAMDETDKTDPLSPSELDERIRGARERAGLDRKPVEPS
FT                   STHTGAAGRGLNAAIEFVVATLVGTGLGYGLGLLLGGKVIGLIIGMAVGFAAGIRGMMR
FT                   MLTPTDGENEDRGR"
FT   gene            348678..349526
FT                   /locus_tag="PB2503_02132"
FT   CDS_pept        348678..349526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02132"
FT                   /product="Fo ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02132"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08505"
FT                   /db_xref="GOA:E0TC72"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC72"
FT                   /protein_id="ADM08505.1"
FT                   /translation="MSGMLVELLSPLMGHPLMAPLRAAGPLEQFEIIRLIRLPISGEPF
FT                   DISITNSTVWMFIAVGMATLLLTLATRRLQLVPGGMQSLGEMTYEFVAKMLRDAVGDEG
FT                   RALFPYIFTLFVFIFLANILGLLPTIPGTPEGLHVFTPTSHIIVTFALASLSVGIVVVI
FT                   GFMKNGLGFLKLFAPSGIPLLLMPLIVPIEVVSFLSRPISLGVRLFANMLAGHIVLKVF
FT                   AGFVVTLFGAGGALAVISIIPFFGIVIVFFLELLVAFLQAFVFAVLSCIYLSDALHPSH
FT                   H"
FT   gene            349584..349808
FT                   /locus_tag="PB2503_02137"
FT   CDS_pept        349584..349808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02137"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08506"
FT                   /db_xref="GOA:E0TC73"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC73"
FT                   /protein_id="ADM08506.1"
FT                   /translation="MDAEAAKFIGAGLAVLPLLGVGLGLGILFGNFMQGAFRNPSATAG
FT                   LNTQFYIAFALTEATGLFALVIAFLILFS"
FT   gene            349884..350474
FT                   /locus_tag="PB2503_02142"
FT   CDS_pept        349884..350474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02142"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08507"
FT                   /db_xref="GOA:E0TC74"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC74"
FT                   /protein_id="ADM08507.1"
FT                   /translation="MRNLLSLSASIVAVLPVSALAAAPAAGPEAAAETGGLPQLETSTY
FT                   VSQVFWLLIAFLILYLLCARIFLPRLGGIIEERRNRIANDFDKAAEYKREAEEAQQAFN
FT                   QALADARARAAQIASETRARIDEEIAEMTADADREIEADIAAAEERIRATGEEAAAAVR
FT                   RAAHDTTKAVVNALIDETPSDDAVENALSTVAA"
FT   gene            350497..351081
FT                   /locus_tag="PB2503_02147"
FT   CDS_pept        350497..351081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02147"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02147"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08508"
FT                   /db_xref="GOA:E0TC75"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC75"
FT                   /protein_id="ADM08508.1"
FT                   /translation="MIAFAQDDPQHSETALEAVTEVEKHIDDGHSGPVTADTNFWVLLA
FT                   FLIVVGIFLWQGVPKMIGSFLSARAEGVQRQLDEARTLREEAQRTLADFQKRQREAETE
FT                   AEAIIEQAKADAKSVATEARAKLDEQIARRRKAAEDRIARAEAQAIAEIRGRTADMAIA
FT                   AAREIIANRMDDRSQGQLIDRAINEVGTRLN"
FT   gene            complement(351168..352676)
FT                   /locus_tag="PB2503_02152"
FT   CDS_pept        complement(351168..352676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02152"
FT                   /product="choline/carnitine/betaine transporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02152"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08509"
FT                   /db_xref="GOA:E0TC76"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC76"
FT                   /protein_id="ADM08509.1"
FT                   /translation="MRRRPFLSALPYGVVIVIAGAALVWPAVLSRVLRQVSDGFLRNFD
FT                   WFTLTLTATALVFCALAALHPKLAHRRLGGPAAVPEFRLVTWFAMLFAAGMGAGLVFWG
FT                   AAEPLIFTKAPPPGGAVANTERATVEALALTQFHWSLHAWGVYAAAAIAVSVSLRPGEP
FT                   PVPSAPFRRPGLRIFVDWLAVIAVLFGLVASVGQGVIQMGAGVERLSGGVVGDGTMTRL
FT                   AVLMAVSAAYLLSVARGLRGGIALLSNINLAVAVALALFVLIVGPSRDILNTLIDGLTA
FT                   YLEALPRLSLDLRPEGQARQWTRDWSITYFLWWIAWTPFVGVFIARVSYGRSLRAFALA
FT                   VVLVPAIVTLLWFSIFGGTALALDHAGIDLRTTDFRSAPFATYRVLENLPLASITTVLT
FT                   FVLVFIFILTSADSASLVLAMFAKRDPNPPLKERLFWGLMIAVLTAGAVLSEAGQSVTR
FT                   AFAVAGAVPLSFLLLAQMLVAAWNRFGTPPATEKKGGNKTPVGR"
FT   gene            complement(352673..353377)
FT                   /locus_tag="PB2503_02157"
FT   CDS_pept        complement(352673..353377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02157"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08510"
FT                   /db_xref="GOA:E0TC77"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC77"
FT                   /protein_id="ADM08510.1"
FT                   /translation="MTPWARPGLTAVVAVATFVLLGLGTWQLFRLDWKRELIATTATHQ
FT                   SAEPLPLSDILSLPVAEREWRSVTIEVERALPPIAHVIGTHEGQSGFFVFSLVELPNGG
FT                   SLPVNHGFVAFADRQGDYDFSPPRRLVGLYRTAAPRQGLAQMLAPPDNAETGTFYGREP
FT                   EGLIAYLFGGAVPPDPFYLSRLDDQLVSPLVAHRTRPAFSNNHLGYALTWFGLAAGLGV
FT                   IYGLLLRRSPRA"
FT   gene            complement(353374..353751)
FT                   /locus_tag="PB2503_02162"
FT   CDS_pept        complement(353374..353751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02162"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08511"
FT                   /db_xref="GOA:E0TC78"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC78"
FT                   /protein_id="ADM08511.1"
FT                   /translation="MVDPEPYYPPLSPFQTGLSSKCPRCGRGDLYDGFLSLKSECPRCG
FT                   LDYTKADAGDGPAVFIMFITGTIGVCFAMVLRFGFGAPEWLVLLLAIFIILGLSLALLR
FT                   PMKGVLVALQFRNKAREGRIE"
FT   gene            complement(353760..354719)
FT                   /locus_tag="PB2503_02167"
FT   CDS_pept        complement(353760..354719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02167"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02167"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08512"
FT                   /db_xref="GOA:E0TC79"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC79"
FT                   /protein_id="ADM08512.1"
FT                   /translation="MTVARSDGILDMAGDVKHDFHLVEPSPWPLVGSVAAMVLMFGAIV
FT                   WAYSEQQLFGFSGPWIFIIGLVGVLFTMAGWWTDVARESVRGENTAEVIRIGFRYGMVL
FT                   FILSEVMFFIAWFWAFFAGALFPGAGEAIILADGTQMLNVEGLPAFLQNDAKYHFLDGQ
FT                   WPGPGVEPLSPWGLPFVNTVILLLSGTTVTWAHHAIQVGDKEGFKWGLIVTVALGVIFS
FT                   FFQGVEYYEVLSQDMFSFNGGSIYGSSFFMATGFHGAHVVIGTIFLAICLARGLAGQLT
FT                   PERHFGFEAAAWYWHFVDVVWLFLFAMIYILGNQGLLG"
FT   gene            complement(354811..355113)
FT                   /locus_tag="PB2503_02172"
FT   CDS_pept        complement(354811..355113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02172"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08513"
FT                   /db_xref="GOA:E0TC80"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC80"
FT                   /protein_id="ADM08513.1"
FT                   /translation="METVTASLLALIHKITGGLLVMAGFVVLPMPIPLGLIMIALGLAM
FT                   LAPYFSAVQALVRTIRRKSPVVNDAMVKFKQKCPRVIQITIEKTNPDMTPPMVED"
FT   gene            355302..356819
FT                   /locus_tag="PB2503_02177"
FT   CDS_pept        355302..356819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02177"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08514"
FT                   /db_xref="GOA:E0TC81"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC81"
FT                   /protein_id="ADM08514.1"
FT                   /translation="MAYRSLREFLTHLEAEGELIRIAEPISTVLEMTEIQRRLLGVGGP
FT                   AVLFENPVKDDGSPSDIPVLVNLFGTVKRVAMAVSFGGKARRSAADLRDVGETLAFLRQ
FT                   PEPPQGLKDAFDLLPIAKQVLAMRPGSVRKAPCQEIVEEGEAVDLTRLPIQSCWPGEPA
FT                   PLITWPLIVTKGPSAAREDNFNLGIYRMQRLSRNKTIMRWLKHRGGAQHHRRWGQEKKA
FT                   PLPAAAVLGADPGTILAAVTPVPDTLSEYQFAGLLRGKKVDLVDCKTIPLKVPAEAEIV
FT                   LEGYVSLDEYAEEGPYGDHTGYYNSVEKFPVFTVTAITRRKSPIYLSTFTGHPPDEPSV
FT                   LGEALNEVFLPLLQQQFPEIVDFWLPPEGCSYRIAVISMKKAYAGHAKRVMLGAWSYLR
FT                   QFMYTKWVIVVDADIDARDWKDVWWAISTKSDPARDMTVLENTPIDYLDFASPVSGLGS
FT                   KVGIDATDKWEGETNREWGTTLSMDPEVVARIDELMDRLGLEGAKLK"
FT   gene            complement(356869..358176)
FT                   /locus_tag="PB2503_02182"
FT   CDS_pept        complement(356869..358176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02182"
FT                   /product="putative isopenicillin N epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02182"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08515"
FT                   /db_xref="GOA:E0TC82"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC82"
FT                   /protein_id="ADM08515.1"
FT                   /translation="MVSMTRRRLVSAGVAATATASSGASFAATSASLLHTGPLGSPTGP
FT                   DDETFWSAIATQYDMTDRVTNLENGNWGVMARPVLDAYKAHTERVNRENSYFARRQFGP
FT                   IYRDIVTQTAAQLRVEPTELALTRGASEALLALIGGYRPLTKGHSVMYADLDYGSMQAA
FT                   MRALARRQGAEVVELALPEPATYEGLIATYEAAFEAHPRTKLLLLTHISHRTGLMLPVA
FT                   EITERAQARGIDVIVDAAHSWGQVDFQLPDLKADFIGVNLHKWIGAPIGVGALYIAKDR
FT                   LDDIAPDIGAHEEEFDRIEGRVHTGTANYAAFMTVPDAFAFHRKVGPAAKEARFRYLRD
FT                   LWAEACRPIPGVTILTPNEPRLHGGITAFRIEGRTSTEDNQRIAAFLLDEYGVFSVHRT
FT                   GVARGACVRLTPTAYTTPLDMTLAIDAVTAAAAAFR"
FT   gene            complement(358255..358569)
FT                   /locus_tag="PB2503_02187"
FT   CDS_pept        complement(358255..358569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02187"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08516"
FT                   /db_xref="InterPro:IPR030972"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC83"
FT                   /protein_id="ADM08516.1"
FT                   /translation="MTRKAALAAVSLLAFSTMGAMGSAQAQSSISYDFYFSYDRQELVT
FT                   RAGERAVRQRLAYEATHYCRALTAQRDDVRVGPCKREIIAGVEAELRTAIRQVRVAQAR
FT                   "
FT   gene            complement(359002..359478)
FT                   /locus_tag="PB2503_02192"
FT   CDS_pept        complement(359002..359478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02192"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08517"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR021708"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC84"
FT                   /protein_id="ADM08517.1"
FT                   /translation="MTTKRHLAQVNIGRVLGGPDAPAMQDFYRNLARINQLAERMPGFV
FT                   WRLQDETGDSAMSLSWPGDPTMNVNMSVWENDEALATFVFKTVHQNFYARKHEFFEMPE
FT                   DPSVALWWVEIGHIPTVAEAKERLDHLIAHGATAFAFGWVDLPVAKLWRERRCA"
FT   gene            complement(359644..359964)
FT                   /locus_tag="PB2503_02197"
FT   CDS_pept        complement(359644..359964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02197"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08518"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC85"
FT                   /protein_id="ADM08518.1"
FT                   /translation="MQNLWLDIWTAGVVVAARLPILASDMQNPTPASREETQRMVTEKA
FT                   EAALAGAQAVNDYWMTLLMTPWKMPFDASPLEDSFEAFVAPGRETLQANARRLSRGDET
FT                   LS"
FT   gene            360057..360659
FT                   /locus_tag="PB2503_02202"
FT   CDS_pept        360057..360659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02202"
FT                   /product="glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02202"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08519"
FT                   /db_xref="GOA:E0TC86"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC86"
FT                   /protein_id="ADM08519.1"
FT                   /translation="MTLTIYHAKFARSVRLIWACEEMDVPYTIETVELRGDKKISPDVH
FT                   PLQKVPAMIDGDVHMFESLAILDYILARYNDALRPKPDHPDYPAYLQWYHFGESTLAFP
FT                   IMFAMAHRVLLPERARDEKLALWAQGEAEKAFEAMAAPLEKNEYLLPSGFSAADISCAY
FT                   MLLLSKFSRIMGNAPEAVKAYFARIAERPAWKTATAA"
FT   gene            complement(360682..363198)
FT                   /locus_tag="PB2503_02207"
FT   CDS_pept        complement(360682..363198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02207"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02207"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08520"
FT                   /db_xref="GOA:E0TC87"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC87"
FT                   /protein_id="ADM08520.1"
FT                   /translation="MSQPIDRSKPSRGRRHTDETVLPRPFGDWFAARGWRLRDHQAQMI
FT                   KKAEAERSCLLIAPTGGGKTLAGFLPSLIDLAKAPRNQRRLHTLYISPLKALAVDIARN
FT                   LSAPIEEMGLPITVESRTGDTSSHARSRQRTRPPDILLTTPEQLSLLLAHPSADDFFGG
FT                   LQTIILDELHALAGKKRGDLLALGLARLRRLAPGVRSVGLSATVHDPVPLQRYLVDQGV
FT                   GEGVADLVLGQGGAAPAVRVMTPGPKIPWSGHSGRHAFSQIYEAIKTATTTLIFTNTRS
FT                   QAEVCFAELWRMNDDGLEIALHHGSLERGQRERVEAAMAAGGLRAVVCTATLDLGIDWG
FT                   GVDLVICLGAPKGSARLVQRIGRANHRMDDPSQAILVPTNRFEVLECVAAKEAVDEGRL
FT                   DESPPTDGALDVLCQHIWGMACAEPFLPDTLFEEVRAAAPYAQLPRALFDQALDFVATG
FT                   GYAMRAYDRYRRIVRQPDGRMRIKDPRTAQLYRMNAGTIIDNPTYQVRLGRMPVRNGRA
FT                   GKPRGGRTMGTVEEWFVTQLAPGDTFLFAGEVVRLEGVHDMDVYVSRAPDDEAKIPSWQ
FT                   GAKFPISSFLAGRVREMVSDQSTWHRLPTEVSQWLTLQQRKSFIPAADELLIETFARGG
FT                   KHFLVCYPFDGRLAHQSLGTLLTRRLERSGLEPLGFCPTEYALSIWMRQDPSDLSMEAL
FT                   FDEDMLGDDLEIWLADAQLMKRTFRHCAVIAGMIERHHPGAEKNGRQVSFSASLIYDVL
FT                   REHEPDHILLKAAWTDAASGFLDIKRLAALLARIKGRLVHRALPRVSPMAVPVMMEVGR
FT                   ETVAGSGNEAILAALEDDLLAEMMAD"
FT   gene            complement(363339..366176)
FT                   /locus_tag="PB2503_02212"
FT   CDS_pept        complement(363339..366176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02212"
FT                   /product="Oar-like outer membrane protein protein, OmpA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02212"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08521"
FT                   /db_xref="GOA:E0TC88"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC88"
FT                   /protein_id="ADM08521.1"
FT                   /translation="MIVVSGSAPGLGANLATGPSTAFSLETLETAPSINRDVKDIVRID
FT                   PRVYLDANAGGTQGNDGILCAGANPRFNSLTVDGIRLNDAFGLNSNGYPTERIPFTYDA
FT                   IDQVAVELAPFDVEYGSFTACNVNAVTKSGNNEFHGSVFIDYNDDTLIGNRADDEAFPT
FT                   DGFTNKRYGGTLSGPLLKDKVFFFLAYEKQESSNLFGGNTPEAKGVSEADFARITQIAS
FT                   DLYGYEVSRLPTALANEDEKFLAKIDWNITDRHRAAFTYNYNDGFNNDPSDGDGNELPE
FT                   FNHFYERGAELNSYAGSLYSDWTDTFSTEFRVSYVDLQNRQNSLGGLDQWGEVQIEVGD
FT                   STVYLGADDSRHANQLSYELWTYKAKADWVLGDHILTFGAEREDFDVFNLFVQEVKGEW
FT                   IFESIDDFESGLFDSFRYENAAGTNNAADAAAEFGYAINTIYAQDEWQVNDKLNIVAGL
FT                   RFDYYSSDDEPEYNPDFEAAYGFRNDETLDGKSILQPRVGFTYEYNPDLLFRGGIGLFS
FT                   GGNPNVWISNNYSNNGVTLFDCRNRGRSGDCVGDGTLNNINDFTYTTDPRGVFYSVPDE
FT                   FIQAVEDADGGGPVNALDPDFEIPAQWKANLGFTYDFDTPYAWAGGNYTLNVDLLYSKT
FT                   HEAALVQSLDALFGSTSTAPDGRTVYGASSLNDFVLTNADDKAEAFSFSTWINKSHDFG
FT                   LDWTLGYAFTDAEDVNPMTSSVAFSNYTNFATADANDPGTATSDYEISHRFTFNANYTK
FT                   NFFSDLDTSFGVFGSVSRNLPYSYVYGNSAFDGSPLGDAFLTRQLIYVPDGADDPLVAS
FT                   APQSFLDFISQDDCLDDNRGEILDRNSCTNDWWTQFDVKFAQELPGFMPGHNSEFFLVM
FT                   ENVGNFINSDWGVLRDQNFPGNRIVDVALDSGDVDSDGNTNEYVYTNFREDPNDGFVLP
FT                   EPSLWSVRVGLRYEF"
FT   gene            complement(366687..368465)
FT                   /locus_tag="PB2503_02222"
FT   CDS_pept        complement(366687..368465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02222"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02222"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08522"
FT                   /db_xref="GOA:E0TC89"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC89"
FT                   /protein_id="ADM08522.1"
FT                   /translation="MVAAHQLRQRLGALVAEAFAAEGVDPQFGAVQRSDRPDLAPFQCN
FT                   GALAAAKQAKANPRAIGEAVKRRLDDNPIFEKVELAGPGFLNLTPADGALAEAAASLST
FT                   DPHLGAWQRPVDERQTIILDYGGPNVAKPLHVGHLRAAIIGESLKRLFRAVGDDVLGDI
FT                   HLGDWGLQMGQLITQLAEEQPDLPYFDADFTGPYPTQSPVTVDDLAALYPRASAASKAD
FT                   PDRRAAAQAATMDLQQGRPGYRALWAHFVDVSKAALEADYAELGVTFDLWRGEASVQDR
FT                   IGPLTERLKAKGVVTESEGALVIDVAREADKKTLNPVMMIKSNGSVGYHSTDVATIEER
FT                   VEEFGAERIVYVVDQRQAQHFEEVFRAVERAGLIEADRLEHAGFGTMNGPDGRPFKTRE
FT                   GGVLRLRDLIDQVVEAARRRLAEGGFSADEDSAVREDTARKVGIAALKFGDLSNPRTSD
FT                   YVFDVDRFVTFEGKTGPYLLYGVVRVRSVIAKAGERPDPAAPILLTDEAERQLVLEMSL
FT                   YGDAVEAAYRRRLPHLICDHAYRLAQAFSRFYTHCRIGDEADPAVRASRLALALLTARQ
FT                   LEAALTLLGIDVPEKM"
FT   gene            complement(368468..369037)
FT                   /locus_tag="PB2503_02227"
FT   CDS_pept        complement(368468..369037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02227"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08523"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC90"
FT                   /protein_id="ADM08523.1"
FT                   /translation="MLKRASVLVGLAALLSACGSVGDTLDDLSASSERNPGPCPNVFAL
FT                   GDAASKVEFIGPAALENVAWSAEITDVRTSCRYVDDKPIRAEVAIDFAVGRGPAATGAQ
FT                   HDLRYFVAVTRRNTDVIAKEVFTLPVQVRGELATVRLSEEVANILIPRADADTSGTNFE
FT                   IAVGLVLTREQLLYNRSGQSLRFPEL"
FT   gene            369129..370076
FT                   /locus_tag="PB2503_02232"
FT   CDS_pept        369129..370076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02232"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02232"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08524"
FT                   /db_xref="GOA:E0TC91"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC91"
FT                   /protein_id="ADM08524.1"
FT                   /translation="MPERMPITLRLAAPRGFCAGVDRAILMVERAIDRYGAPVYVRHEI
FT                   VHNETVVRRLRALGAVFVDELSEVPDDAPVLFSAHGVPKTVPAEAERRQLLYLDATCPL
FT                   VSKVHIESDRHHRNGCHVLLIGHEGHPEVIGTMGQLPDGAMTLIETEEDAHRFAAEGRP
FT                   VAYVTQTTLSVDDTARIVEILKARFPDIQTPIKDDICYATTNRQEAVKILAADADALFV
FT                   VGSETSSNSKRLVEVGKAAGCPYGVLIEDETRIDWPAVEALSPRIIALTAGASAPETVV
FT                   QNVVDAFRERMSVEVEEIETTRENVTFKLPKALL"
FT   gene            370087..371049
FT                   /locus_tag="PB2503_02237"
FT   CDS_pept        370087..371049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02237"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02237"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08525"
FT                   /db_xref="GOA:E0TC92"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC92"
FT                   /protein_id="ADM08525.1"
FT                   /translation="MAVFTHLTAEAVRDFLYAYDLSPFARHEGIAAGVENTNYHVFTED
FT                   DRYILTLFERRTPTADLPYFLAVMDHLSAHGISVPRPLHARDGRSLREVGGRPAALFTF
FT                   LEGRDLKAPDAENARAAGTALAALHRAAAGFEQTRPNGMGPRAWQALYDKIRPGLDRYG
FT                   ESVPNEIGEATRRLSEAWSAPSSLPTGTIHADYFPDNVFFSRGKVSGIIDFYFACTDYL
FT                   AYDLAIAALSWMPEDDDAPAHARAMIDGYSTVRPLTEEEHAALPLFFEAAALRFFLTRA
FT                   HDDIFRTEGSVVTIKDPHVYLRRLRAARNATIGWEDESL"
FT   gene            371046..371468
FT                   /locus_tag="PB2503_02242"
FT   CDS_pept        371046..371468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02242"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02242"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08526"
FT                   /db_xref="GOA:E0TC93"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC93"
FT                   /protein_id="ADM08526.1"
FT                   /translation="MIEIYTDGACSGNPGPGGWGVLIEWGEDTSRLNGGEPNTTNNRME
FT                   LTAAIKALESVDPKTPFTLYTDSQYVKNGVETWIHGWKRNGWRTANKKPVKNQDLWQTL
FT                   DRLAQERAVTWKWVKGHAGHPGNEEADRLAREGMPR"
FT   gene            371536..372180
FT                   /locus_tag="PB2503_02247"
FT   CDS_pept        371536..372180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02247"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08527"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC94"
FT                   /protein_id="ADM08527.1"
FT                   /translation="MMRIVTLAACLMIAVSACATSPSVPSGPYGQAAQSRFDDFTETAG
FT                   ATDFTQYNAVFLAPITVSDEIAERYDIRRPALSGSPRPLSPALVEAKIAELREDLEAAL
FT                   VQVTSLADAPGADILTLEVELIALDANRPTQADFAVSPGLSLQSLYSGEAGAIVTFSTD
FT                   DTVLAVARDIDRPGLDLTEPGAGIWSTADRFFRRLADKTAALLYSPAPAGA"
FT   gene            372334..373638
FT                   /locus_tag="PB2503_02252"
FT   CDS_pept        372334..373638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02252"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02252"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08528"
FT                   /db_xref="GOA:E0TC95"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC95"
FT                   /protein_id="ADM08528.1"
FT                   /translation="MEDMQTWSAEIWQRLLEGLTQEHVYIQIGLVLAAWLIGWVIAALV
FT                   MRRVKVPQTVQAPLNLGNIAGSLEKLRELIPPFLITFSLAIAERISEELGTGLGLLHIA
FT                   LGISVVILIRSFVHRFIANAFILALVNYVAVPAAILQVLGVLDDVVAFLESVAIQLGNI
FT                   KLTAYAIVRTVIFGSILFYIGRISNSTGKRVIRSRQELDARTRELATKLFEILLFVVIS
FT                   LLLLQIIGINLTTLAVFGGAIGVGLGFGLQSIASNFISGIIILLDKSITIGDFIELEDG
FT                   RSGTLKDLSMRSAMLETYDGKVIMVPNETFISSSFVNWTHHDTKQRYDIRFSVAYDTDI
FT                   EAMIDIVREVVQSHPQVISGENASKAEQPDAEIESFGDNGIDILVEFWMEGVDDGPNRV
FT                   GADLNLMIWTALKQNGIVIPFPQREVRMLGDAQKN"
FT   gene            complement(373655..374296)
FT                   /locus_tag="PB2503_02257"
FT   CDS_pept        complement(373655..374296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02257"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08529"
FT                   /db_xref="GOA:E0TC96"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC96"
FT                   /protein_id="ADM08529.1"
FT                   /translation="MAGEPMSYAIKECYYTLQGEGAQAGRAAVFLRFAGCNLWSGREID
FT                   REEAICRFCDTDFVGTDGPGGGRFVAEELAAHVASFWPGGGSPYVVATGGEPLLQLDSP
FT                   LIDALHDEGFEIGVETNGTIAAPAGLDWICVSPKSTAELVQTEGDELKLVFPQSDAPPD
FT                   QFSGLAFDHFFLQPMDGPYQSIAIATTVDYCRANPLWRLSLQTHKLIGIP"
FT   gene            complement(374278..375009)
FT                   /locus_tag="PB2503_02262"
FT   CDS_pept        complement(374278..375009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02262"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08530"
FT                   /db_xref="GOA:E0TC97"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC97"
FT                   /protein_id="ADM08530.1"
FT                   /translation="MKTKNADRPAIKPVDAGALVLLSGGQDSATCLAWALGRYRVVETL
FT                   GFDYGQRHRVELDARERVRAWWADRPEGGALGADHRLPVPAFGEIGDTAMTAEVEIEMA
FT                   ANGLPTTFVPGRNLAFLVFAGALALRRGLSVVVGGMCQTDAAGYPDCRWETIKAQADAL
FT                   SLGIDPSLSVATPLMFRSKAETWALAQELGGDDLVSMIVEDTHTCYRGDREHRHPWGYG
FT                   CGDCPACHERARGWATWQESR"
FT   gene            complement(375246..376049)
FT                   /locus_tag="PB2503_02267"
FT   CDS_pept        complement(375246..376049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02267"
FT                   /product="putative divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02267"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08531"
FT                   /db_xref="GOA:E0TC98"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC98"
FT                   /protein_id="ADM08531.1"
FT                   /translation="MGIMGIVLPTIAPAVWASLAAALVATLGLAVVSVSGGWADRNRNY
FT                   FAGFAAGVLVTSALLLLPEAIERTPSAPYFALLGYLFLFSLNALLRQSQGAVAAPLIAV
FT                   SFHSFIDGFEYGVLFDHDVILGTIASLGLITHEFAEAVILFSLLKVAGISTRTAFIATF
FT                   IGAALTTPMGALLSQPLLNAISPNAFAQLLAIAAGALLYVGATHLPGHLVEGVRWRLLL
FT                   SYLLGIGLAVVLAIFVHPDHSHLSDPDHDHQGEGVDEDHHHPMAP"
FT   gene            376268..376822
FT                   /locus_tag="PB2503_02272"
FT   CDS_pept        376268..376822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02272"
FT                   /product="Putative siderophore binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02272"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08532"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E0TC99"
FT                   /protein_id="ADM08532.1"
FT                   /translation="MTAALILPFEGKSPQIHETAFIAPGAVVIGDVTIGPGASVWYGCV
FT                   LRADTNRIEIGARANVQDGSILHVDAPSQGGTPVLIGEEALVGHRCLLHGCTIEEGGFV
FT                   GMGSTVLDKAVIEEGAFLAAGAFLAPGKRVPTGEMWGGLPARKLRDLKGLEGKAARMGA
FT                   AHYVEEAKAHRAALSDAREDA"
FT   gene            376859..376934
FT                   /locus_tag="PB2503_t07282"
FT   tRNA            376859..376934
FT                   /locus_tag="PB2503_t07282"
FT                   /product="tRNA-Ala"
FT   gene            complement(377561..380377)
FT                   /locus_tag="PB2503_02277"
FT   CDS_pept        complement(377561..380377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02277"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08533"
FT                   /db_xref="GOA:E0TCA0"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA0"
FT                   /protein_id="ADM08533.1"
FT                   /translation="MSEIFVNRGEAKAWFRERLRNIPNQGATISVFHGEGGQGKTALCD
FT                   KIESMTRGGDWTLHDAQLYCARVNFDRSSNLILDPILLLIKIRNAYAEQGITVPGFDLA
FT                   LAYVWERVRPEEPPKTLKNAWLSKAHCAFGEGASDSIEIGAAIVGSEIQKIPFMGSFLA
FT                   QIAKWSIDTTKRAWLVRAKPYVSDFIDRGKARNDAELIDALISVLAKELSVALQDDDRK
FT                   KLVLLLDEYEWAFPAVGMRGQHPVDRALRRFCESADRLAATFFARSKLPWKSNRFLHIG
FT                   DEDHFELDGLERRYGEEWLIQAAIDDEAVRRSMLDSSMSEEEDGHRCYPLVLDLCLDLY
FT                   NAFGEKGITPTPQDFFLAPTGLEGKLDDLVNKISRRFEENLHLRDAVDYLALAGRFDGE
FT                   TLDFISSEFQLQLPGGGLDLITSLSIVKPDDKATGPEKFVLHRKIAEVFRLRMDEVRRN
FT                   EGGTRLIEHFLARANVDHPEEVDADVISSIAIAAEIRERHGASGYVDWLTNAVQVLQAA
FT                   AKSSELEGLWRRALEITLAEFGEDHPDTATSYNNIAYNLNAQGRYGEAAPLLRQGLEIF
FT                   QRVLGEDHPDTASSYNNVAYNLNAQGRYVEAAPLYRQGLEIFQRVLGEDHPDTASSYNN
FT                   VAYNLNAQGRYVEAAPLFQQGLEIRRRVLGEDHPDTAASYNNVASNLDDQGRYGEAAPL
FT                   YRQGLEIRRRVLGEDHPSTASSYNNVASNLNAQGRYVEAAPLYRQGLEIRRRVLGEDHP
FT                   DTASSYNNVAYNLDAQGRYGEAEPLYRQGLEIRRRVLGEDHPDTAASYNNIAANLNAQG
FT                   RYGEAAPLYRQGLEIRRRVLGEDHPDTATSYNNVAYNLNAQGRYGEAEPLLRRALEIRR
FT                   RVLGEDHPSTAISYNNVASNLDDQGRYVEAAPLYRQGLEICRRVLGEDHPTTRVVRKNL
FT                   EILLERRR"
FT   gene            complement(380429..380587)
FT                   /locus_tag="PB2503_02282"
FT   CDS_pept        complement(380429..380587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02282"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08534"
FT                   /db_xref="GOA:E0TCA1"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA1"
FT                   /protein_id="ADM08534.1"
FT                   /translation="MDDQSRETVLTLLRDTQLPVKQIAKQAGVSVATLYKEFPGGRGAL
FT                   QDSSASL"
FT   gene            complement(381015..383183)
FT                   /locus_tag="PB2503_02287"
FT   CDS_pept        complement(381015..383183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02287"
FT                   /product="methyl-accepting chemotaxis protein McpD"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02287"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08535"
FT                   /db_xref="GOA:E0TCA2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA2"
FT                   /protein_id="ADM08535.1"
FT                   /translation="MTKSATLPVAAKLAMMSGGLTFIAASAAVIVAGGLSLPLQIGLFV
FT                   TLAAVVGAGVFALTSSVMSPLKAISAHLDGIVAGKAEGDVPFKGRAGEIGVFADKLSLL
FT                   ALRVTSPEEREDMMMKMCAYETADAAIMIVNRDLVVTAVNRSTRDLFESNRELFKTHFP
FT                   NFRPDNIIGMTIDDFHKNPSHQRQILSRPENLPYRSEITIGDCIFNLSVSAAYNEAGDY
FT                   IGAILEWENVTQQRFSGAISQAVDANSAVIQFRPDGTVISANANFLNTMGYAEAEIVGK
FT                   MHSIFVPDHVRSTEEHKSHWTRLAMGETLTGVFERKNKRGETVWIEGSYSPVLNSSGKV
FT                   ERVVKYARDITETLTRNKEQAAKLERASNEQQLVVSELTSALSRLSGGDLTAQITADFP
FT                   GQYEGLKSDYNQAVDRLHQAFCDILENTQSITSGVSELSQASTDLSGRTENQAASLEQT
FT                   AAALNQATQSVADTAKTAKQANKIVSETRAEATESGNIVREAIGKMGEIENSSKEISQI
FT                   IGVIDEIAFQTNLLALNAGVEAARAGDAGRGFAVVASEVRALAQRSSDAAKEIKDLIST
FT                   SGRHVTSGVELVGKAGSALGDIVTRVAEVSEMVASINGAAQEQSTGLSEVNAAVNDMDQ
FT                   VTQQNAAMVEESNAACHSLQTQIERLRSMMLRFKTRGATASQTTTVSSMPKADVVAQQR
FT                   LAKSFAAGGGGAAAAVASGGGDDGWDDF"
FT   gene            complement(383597..384616)
FT                   /locus_tag="PB2503_02292"
FT   CDS_pept        complement(383597..384616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02292"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02292"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08536"
FT                   /db_xref="GOA:E0TCA3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA3"
FT                   /protein_id="ADM08536.1"
FT                   /translation="MGVSAADRRPIGVATSLKIARSVERPLLSPPIQALTTNKDFLVST
FT                   KQSADLARYHTRMQRVFAHIDDNIDGDLGLEALSSVAAFSPCHFHRQFRAIFGVSLHRY
FT                   VQLVRMKRASWRLAYRADVSVTEIALDAGYEAPDSFARAFRQLMGQAPKAFREEPNWSA
FT                   WAAAMVPLAEARNQIMMQNFSINDIEIRQVGETSVAFMSHRGEPERLGQTIRKFIAWRK
FT                   ANGVRAGTHATYTIFHTDPDSVASEDYRIDLAAATDRATTCADEDIESGLIPAGRCAVL
FT                   RIIGQSDNLRHAAEFLYRQWLPASGEELREFPLYAQRVSFFPDVPEHEAITDLFLPLK"
FT   gene            complement(384723..387113)
FT                   /locus_tag="PB2503_02297"
FT   CDS_pept        complement(384723..387113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02297"
FT                   /product="Hybrid sensory histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02297"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08537"
FT                   /db_xref="GOA:E0TCA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA4"
FT                   /protein_id="ADM08537.1"
FT                   /translation="MGSRQNKPGQRGIGARIALLTMSIVAVVLCLVVVGLLVYEGTSFR
FT                   RDLLRERMDLARVTAANVSAAVLFDDRATINENLSALSQLPDLMAAKVWSVRGEPLGGY
FT                   IEQTDTAIKPLTRGTTPVSIVSWEQVTVQVPISVDQEIIGYVQLVSSLDRLGFTVKRYL
FT                   QIVGAVSLVGMAGAFILARLTAQGLIQPIHSLIMTMQQVQRDRNYRLRVEGLSNDESGQ
FT                   LAAAFNDMLDEIQRRDENLEKTVEERTADLEEAVTKAEAASLAKSAFLANMSHEIRTPM
FT                   NGVLGMAELLMSTELDTYQRELIGTIMSSGTSLVTIINDILDFSKIEAGKFSLNEEPFN
FT                   LREGIENVATLMAGRAAEKDLELFVRYDPSLPEGVFTDGGRLRQVITNLVGNAIKFTDE
FT                   GQVLIDVTGAQSGETVDLRISVTDTGIGIPPEKLEAIFEKFEQADNTSSRMYEGTGLGL
FT                   AICKTIIELMGGKIGVTSELGRGATFFIDINYKIDDRASLRPTIDTAELAGARIAIVDD
FT                   NATNLRILSEQLAAWNTEIFAFSSGKEIFQWLDSRGEGEALPDVIITDYQMPEMNGIEL
FT                   GLGIRARTGFPPIPIIMLSSVCAPKEEGSKSLPLSAWLVKPIRSLQLAEYVFEAKMKTG
FT                   RFGDVEALAEAKADRSISASSDPDAICETILVVDDNLVNQLVITNMLKGWATEILTASN
FT                   GEDAIEKFSAYSPDIIFMDVSMPVMDGLEATRRIRGMEADQNLPTTPIVGATAHAMDED
FT                   RQRCLKAGMVDVLTKPVRKESVDGMVLKWAASSPQSKLASSSA"
FT   gene            complement(387331..387612)
FT                   /locus_tag="PB2503_02302"
FT   CDS_pept        complement(387331..387612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02302"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08538"
FT                   /db_xref="GOA:E0TCA5"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA5"
FT                   /protein_id="ADM08538.1"
FT                   /translation="MTERDDAPSLAPRETDGPAGSRPNRRFALWAAAALIVPTLLLALF
FT                   VKFAFFGEGFHAVAAVILGVGATIGLAVALMGLTFHSNRSGHDKQIDD"
FT   gene            complement(387650..390286)
FT                   /locus_tag="PB2503_02307"
FT   CDS_pept        complement(387650..390286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02307"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02307"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08539"
FT                   /db_xref="GOA:E0TCA6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA6"
FT                   /protein_id="ADM08539.1"
FT                   /translation="MTGTASQTFVNIGERTNVTGSAKFRKLIKNGDYAAAVDVALQQVE
FT                   NGAQIIDVNMDEGMLDGVEAMTTFLRLIASEPDIARVPVMIDSSKWEVIEAGLKQVQGK
FT                   PIVNSLSLKEGEAPFLHQARLCRRYGAAVVVMAFDEEGQADTCARKVEICTRSYNLLTG
FT                   IGFPPEDIIFDPNIFAVATGIEEHDNYAIEFIEATRRIKETLPHAKISGGVSNISFSFR
FT                   GNDIVREAMHSVFLYHAIRAGMDMGIVNAGQLAIYDDIPTDLRERVEDVILNRRSDATE
FT                   RLLEKAEDYKGKAGKARTEDLSWREAPVEERLSHALVKGINAYIDADVEEARQKLGRPL
FT                   HVIEGPLMDGMNIVGDLFGEGKMFLPQVVKSARVMKQAVAYLTPFMEEERLAGGEGAPR
FT                   ANGKVLMATVKGDVHDIGKNIVGVVLQCNNFEVVDLGVMVPTADIVAKAQEHQVDVIGL
FT                   SGLITPSLDEMVNVASEMKRLGMTQPLLIGGATTSKAHTAVKIAPAYDDGVIYVTDASR
FT                   AVGVVSDLISEERREAYLEKIRTEYDDVRETFLARQKKDDRIGLEKARANAFSDVAPAA
FT                   APRQPGITEIKDLSLETLVPYIDWSPFFASWDLHGRYPAILSDSVVGEAARSLYSDAER
FT                   MLAQIVEEKWFTAHGVVGLWPANRQGDDIVIWADESRSTEAARLFTLRQQIAKSADKPN
FT                   FALADFIAAEGTPDWIGGFAVTAGHGEDEIVERFNRGNDNYNAIMASALADRLAEAFAE
FT                   YLHEKVRREIWGYAPDETLETEALIAERYRGIRPAAGYPAQPDHTEKEVLFQLLGATDR
FT                   CGMTLTESFAMQPGASVSGLYFAHPRAVYFGTGKIGRDQVEDYARRKGWSLETAERWLA
FT                   PILSYTP"
FT   gene            complement(390283..391155)
FT                   /locus_tag="PB2503_02312"
FT   CDS_pept        complement(390283..391155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02312"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02312"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08540"
FT                   /db_xref="GOA:E0TCA7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA7"
FT                   /protein_id="ADM08540.1"
FT                   /translation="MSSVNVSFEFFPPKTDAMEQTLWASVEKLAPLDPAFVSVTYGAGG
FT                   STRERTHRTVSRLVQETGLPVAAHLTTVAASREDIDAVLRAYWAAGVRHIVALRGDPPG
FT                   GLGAAYEPHPDGYANAAALTEAARRVGDFEVTVGCYPETHPESANREADIDWLKQKVDA
FT                   GATRAITQFFFDNNVYERYVDDVRRAGIDIPIVPGIMPVGSYKALSRMAGLCGATIPPT
FT                   IKDCFEDLDNDPETRRLAAVTTVADQCRDLVRRGVEDLHFYTLNRADIAYAVCHLLGIR
FT                   PTHADGRTS"
FT   gene            complement(391142..392143)
FT                   /locus_tag="PB2503_02317"
FT   CDS_pept        complement(391142..392143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02317"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08541"
FT                   /db_xref="GOA:E0TCA8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA8"
FT                   /protein_id="ADM08541.1"
FT                   /translation="MGDAVSSFAHTLSALRAAGEHSRLRLLLLLHKGELTVTELTSLLG
FT                   QSQPRVSRHLKVLAEAGLVERFQEGTWVFYRLAPGAVDSAIAPIFAPGGVALLDEDQAA
FT                   FEDIQSRRAALAAAYFAEKAEEWEDLRRRHIPETEIETALLSMAPDEVDVFLDLGTGTG
FT                   QMLSVFADRCQSGIGVDVSPEMLMIARSRVLASGAGHLQLRRGDFLVDPLPQGVDLVCL
FT                   HHVLHFLAAPEAAIGVAAKALGARGQILIADFAPHDHEDLREAHAHRRLGFSSAEIAEW
FT                   GARHRLVLTDDRELAAPLSGGLVTKLWRLEKAPSAARAAAPLPEVKRDNVVR"
FT   gene            392171..392797
FT                   /locus_tag="PB2503_02322"
FT   CDS_pept        392171..392797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02322"
FT                   /product="thiol:disulfide interchange protein DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02322"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08542"
FT                   /db_xref="GOA:E0TCA9"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCA9"
FT                   /protein_id="ADM08542.1"
FT                   /translation="MVNERHRVLSASGLSPLGRIALGEESRHIGVMKRLILILPLIAFA
FT                   GLAFYLLPGLKLDPSAPPSALEGKEIPELVLTKMPGRASFTEKDLTGQVTLVNVFGSWC
FT                   APCKVEHPLLVTISQEGKVPIYGINWLDTPERGAAWLDTEGDPYTKVGNDQGGRTVIAL
FT                   GVTGAPETFVIDKQGRIRHRHAGPITTHTWEQTFEPLIASLQLEE"
FT   gene            392892..394157
FT                   /locus_tag="PB2503_02327"
FT   CDS_pept        392892..394157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02327"
FT                   /product="peptidyl-prolyl cis-trans isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02327"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08543"
FT                   /db_xref="GOA:E0TCB0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB0"
FT                   /protein_id="ADM08543.1"
FT                   /translation="MKRLAILWVTLILTGLTAPLANAQVGERVAAVVNDDPISTFDVRQ
FT                   RIQLIIVTEGMRNLPQEALAQLQGRALRELIEERLKLQEAERFELTIPDEAIDAELEQL
FT                   AGQAGTTVQQLTEDLATAGVNIGTLRDRIQAEQAWQQLVRGRYGPRVSITDDAVETMLD
FT                   DLELSARSDQYLISEICLPVTRQEDQPEMYQAGMQMIEQLRRGVPFGALAQQYSACSSA
FT                   ARGGDLGWLRADELDQTTLDIVQQLSEGNVSRPIPLRGVIKIVALRQTREAATAGEPSY
FT                   QVAYAGAPASLGEEVAKQRLARLPETNACNGQSLSIDMGEDVGATVLPRLPERAFEPIF
FT                   RTTLAALDVGETSDVIESDGAFHRLMMCEKDEGYGLPTRRAVESRLESEELELLSRRYL
FT                   RDIERESAIEIRYGGTGTIEGS"
FT   gene            394162..395247
FT                   /locus_tag="PB2503_02332"
FT   CDS_pept        394162..395247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02332"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02332"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08544"
FT                   /db_xref="GOA:E0TCB1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB1"
FT                   /protein_id="ADM08544.1"
FT                   /translation="MTSDAIAPLAVSMGEPAGVGTELILKAWKNLSALPKGKGPVFYLI
FT                   DDPVRVDRLARSLYPDTAVATISTPEETGDVFYRALPVLSLPTEVIADLKSVTLGTPTP
FT                   KTAAAVIRSIDTAIAAIHRGEAGGLVTLPIQKQTLMAAGFQFPGHTEYLEHATAEMAMP
FT                   VELERGAVMILTAGPFRVVPATVHIPLAEVTRALSTDLLIRRGRTLMQSLRRDYGIVHP
FT                   RLAVSGLNPHAGEGGVLGREEEEIIAPAITALAKEGYVVEGPFPADTLFHDQARAAYDA
FT                   VLAMYHDQALVPIKTVAFHAAVNTTLGLPIVRTSPDHGTALALAGKGVARADSLINAIY
FT                   SAHRISTARLAFDSGAYAADV"
FT   gene            395231..396052
FT                   /locus_tag="PB2503_02337"
FT   CDS_pept        395231..396052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02337"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02337"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08545"
FT                   /db_xref="GOA:E0TCB2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB2"
FT                   /protein_id="ADM08545.1"
FT                   /translation="MPPMSDLPPVGTVVRSHGLLAKKTLGQHFLLDMNITRKIAALCAL
FT                   SPGEDVIEIGPGPGGLTRALLEAGAALTTIERDDRIVPILSEISAAFPGQLTPLEGDAL
FT                   SVDYRALMPGGGVIASNLPYNISTELLVRWLTLSPRPWRRMVLMFQREVGDRILASPGS
FT                   KAYGRLSVLSQIAARPTLGFHLPARAFTPPPKVASSVLVFLPPATEPQNVAALERVTAA
FT                   AFGQRRKMIRKTLAPLYGEKLGPLLDGLGLLPTQRAEELSVETFRALAEAL"
FT   gene            396052..396840
FT                   /locus_tag="PB2503_02342"
FT   CDS_pept        396052..396840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02342"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08546"
FT                   /db_xref="GOA:E0TCB3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB3"
FT                   /protein_id="ADM08546.1"
FT                   /translation="MLSYQHAYHAGNRADLHKHAVWCALLAHLTQKSRGLTILDTHAGR
FT                   GLYDLAGAEAQKTGEASDGAAAVSLDGSHALGSAVAACRAQYGEMAYPGSPLLSLHFAR
FT                   PQDQVILMEKHPQEGAALKTVMRGKKAAVHLRDGYEGALALAPPTPRKGLVMIDPSYEV
FT                   KTEYQNVALFLPTLIDKWPEASVLLWYPILAAKRHEAMLDTLSPMQPWRHEVLFTEDSL
FT                   LRMKGSGLVLISPPYGGEGAIDAALAPFDHLWTSCRQSPS"
FT   gene            complement(396847..398313)
FT                   /locus_tag="PB2503_02347"
FT   CDS_pept        complement(396847..398313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02347"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02347"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08547"
FT                   /db_xref="GOA:E0TCB4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB4"
FT                   /protein_id="ADM08547.1"
FT                   /translation="MSERPLKYLQGETGEWEVVIGLEVHAQVASNAKLFSGASAQYGAG
FT                   PNENVSLVDAAFPGMLPVINRYCVEQAVRTGLGLNAKINLWSRFDRKNYFYPDLPQGYQ
FT                   ISQYKDPIVGEGMIEVELDDGETVEIGIERLHLEQDAGKSIHDLSPKESYVDLNRSGVA
FT                   LMEIVSKPDMRSAEEGAAYFSKLRTILRYLGTCDGNMEQGSMRADVNVSVRRPGDALGT
FT                   RTETKNVNSIRFVRQVIDYEARRQIEVLEAGGTIDQETRLFDVKTGETRTMRTKEDAHD
FT                   YRYFPDPDLLPLELEEAMIERIRAELPELPDQKKRRFVDAYGLSVYDASVLAADREKAD
FT                   YFETVADGRDGKLAANWVTTELFAVLNKRDLTIAESPVPAAHLGELIDLIQDGTISGKI
FT                   AKQVFEIMLDEGGAPRAIVDERGLKQVTDTGAIEAAVDKVIAENPAQVEKVKEKPKTLG
FT                   WFVGQVMKETGGKANPQAVNAILKEKLGVE"
FT   gene            complement(398310..399788)
FT                   /locus_tag="PB2503_02352"
FT   CDS_pept        complement(398310..399788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02352"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02352"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08548"
FT                   /db_xref="GOA:E0TCB5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB5"
FT                   /protein_id="ADM08548.1"
FT                   /translation="MTDLTSLTLAELRAALLTRKCSAVEATTAYLGRIEAAGALNAFVS
FT                   VTPELALQSAEESDRRLAAGEARPLEGVPLGVKDLFCTKGVETTAASKILGGFSPTYES
FT                   TVTANLFADGAVMLGKLNMDEFAMGSSNETAASGPVVNPWKRAGLETKLTPGGSSGGSS
FT                   AAVAAQLVAGATGTDTGGSIRQPASFTGTVGIKPTYGRCSRWGIVAFASSLDQAGPIAR
FT                   DVKDASLLLQSMAGYDPKDSTSVDRPVPDYMASLEKGIKGLKIGVPKEYRLDGMPSDID
FT                   SLWQQGMEWLRSAGAEIKEVSLPLTKYALPVYYIVAPAEASSNLARYDGVRYGLRVEDD
FT                   DIQEMYARTRAEGFGAEVKRRILIGTYVLSAGYYDAYYLQAQKVRKRIFDEMSGVLEDV
FT                   DLLLTPSTPSAAFGLGEKSDDPLAMYLNDIFTVTANLAGLPGISVPAGLDGQGLPLGLQ
FT                   LIGRPFDEETVFRGAAVLEQAADFTARPEEWWAK"
FT   gene            complement(399785..399994)
FT                   /locus_tag="PB2503_02357"
FT   CDS_pept        complement(399785..399994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02357"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08549"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB6"
FT                   /protein_id="ADM08549.1"
FT                   /translation="MTFCDRRPWLVATAFPTEGGAERVAGAEGAFASAGSSTKAAGEER
FT                   PSLSDHLNGRGYHLRTAIDITVHI"
FT   gene            complement(399991..400290)
FT                   /locus_tag="PB2503_02362"
FT   CDS_pept        complement(399991..400290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02362"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit C,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02362"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08550"
FT                   /db_xref="GOA:E0TCB7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB7"
FT                   /protein_id="ADM08550.1"
FT                   /translation="MSIDEQTVVKVAKLARIKLDDRDVGPMTQELSAILDWIEQLGEVD
FT                   VEGVDAMASTVAKSLPMREDVLATDQTGGGRPDEIVANAPKTDDHFFVVPKVVE"
FT   gene            complement(400322..401170)
FT                   /locus_tag="PB2503_02367"
FT   CDS_pept        complement(400322..401170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02367"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08551"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB8"
FT                   /protein_id="ADM08551.1"
FT                   /translation="MKDVWGIRCLWAGGALIASHFVMGWLCLAAAASAAGPSAPAPSAT
FT                   ASAPPDWVEARYDSLVPDLAAVLGLPTPRIDLRFDPTPAPSHLVLTAHVTADETIAVRL
FT                   SGAGWHRRTPQTDRQIVANLAHELAHLWQRRLLPAPAEPRWIHEGGAEAIALSLLVDTG
FT                   LWSEIDRRRADSALAERCSRALENGPLRPQFEGETADAAYGCGYVVVDWLAGRSGRSPR
FT                   ALYAELAATWPDPVALGTTLGAWLPAGDVATLNEFLTADWRGADPDTVVRSFRAGPSSG
FT                   L"
FT   gene            401169..401645
FT                   /locus_tag="PB2503_02372"
FT   CDS_pept        401169..401645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02372"
FT                   /product="putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02372"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08552"
FT                   /db_xref="GOA:E0TCB9"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCB9"
FT                   /protein_id="ADM08552.1"
FT                   /translation="MDRAFLTAIAAMPKGPLLGLDPGSKTIGVAVSTPERRLATPVTVI
FT                   RRTKFGKDAEALFALAEARGVVGLIIGVPLNMDGSEGPRAQSARTFGRNLSQRGPLPVA
FT                   YWDERLSSVAAERALLATDTSRARRAEVIDAHAATHILQGALDRLATNGHSARA"
FT   gene            401642..402598
FT                   /locus_tag="PB2503_02377"
FT   CDS_pept        401642..402598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02377"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02377"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08553"
FT                   /db_xref="GOA:E0TCC0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC0"
FT                   /protein_id="ADM08553.1"
FT                   /translation="MTALRHLTDVASLPEETFRRLLSRSLTIREMMDRGSFPAPVLDRR
FT                   ALVNLFFEDSTRTLMSFEMAAKRLGAHTLTLPIANSSVKKGESLEDTVLTMCAQGADYL
FT                   VIRARDQGTIARAIDVIEQEGFLASVLNAGEGSFGHPTQGLLDAATMLRAIDRTPDQGL
FT                   TGYKLAICGDVSHSRVAASTIEASACLGAEIVLGGPVALLPDAPPPGVQAMTSSVAEAV
FT                   SGADFVMTLRLQKERMTKALDLSLEEYHRQYGLRHEVIAAANPGAFILHPGPANRNVEI
FT                   TDALADDPARSLIRSQVRQGVALRMALLEEIERGKSR"
FT   gene            402595..403200
FT                   /locus_tag="PB2503_02382"
FT   CDS_pept        402595..403200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02382"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08554"
FT                   /db_xref="GOA:E0TCC1"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC1"
FT                   /protein_id="ADM08554.1"
FT                   /translation="MTLVILIFSYLLGAVPFGLVLVRAAGLGDIRTMGSGNIGATNVLR
FT                   TGRKDLAFATLLLDSGKGAIAVLLAGMLSSFDARVMAVAGAAAFVGHCFPVYLGFKGGK
FT                   GVATFLGTLLALNIKVALVAGGVWLAVAAVTRYSSLSALLAAALTPFLFLVFGQWAFFA
FT                   ASVVMTALIFLRHRENILRLMDGTETKIGKGPRDDAVA"
FT   gene            403389..404795
FT                   /locus_tag="PB2503_02387"
FT   CDS_pept        403389..404795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02387"
FT                   /product="glutamine synthetase I"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02387"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08555"
FT                   /db_xref="GOA:E0TCC2"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC2"
FT                   /protein_id="ADM08555.1"
FT                   /translation="MAVKDVLKKIKDEDIQYVDLRFTDPKGKWQHVTFDKSMVDEELFE
FT                   DGTMFDGSSIAGWKAINESDMILMPDAETAIVDPFFAQPTLSIICDILEPSTGQPYSRD
FT                   PRTTAKAAEAYLKSSGIGDTAYFGPEAEFFIFEDVRISTEQNNMGFSLDSTEGPYNMAR
FT                   EYEGGNLGHRPRAKGGYFPVPPVDSEQDLRSEMLSYMSQMGLEPEKHHHEVAPSQHELG
FT                   MKFSTLLKMADNMQIYKYVVHQVAHAFGKTATFMPKPVFGDNGSGMHVHQSIWNAGKPV
FT                   FAGDRYADLSETCLHYIGGIIKHARAINAFSNASTNSYKRLVPGFEAPIMLAYSARNRS
FT                   ASVRIPWVSSPKGKRIETRFPDAAGNPYLTFAALLMAGLDGIENRIDPGDAMDKDLYDL
FT                   SPEEQQGIPTVCASLEEAMAALDADRDFLRKGNVFSDDQIDAYIELKMEEIVRYNTTPH
FT                   PVEFDMYYSV"
FT   gene            complement(404952..406331)
FT                   /locus_tag="PB2503_02392"
FT   CDS_pept        complement(404952..406331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02392"
FT                   /product="putative diguanylate cyclase (GGDEF)"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02392"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08556"
FT                   /db_xref="GOA:E0TCC3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC3"
FT                   /protein_id="ADM08556.1"
FT                   /translation="MTARVLVVDDLAPNVKLLEAKLRAEYFEVITALGGREAIELARTQ
FT                   SPDIILLDVMMPGIDGFETCKLLKEDPLTRHIPVVMVTALDQRSDRIAGLEAGADDFLT
FT                   KPVQDLALFARVRNLSRLKQMTDELRHRHAQGAQLGAIETPKIEDVEREIGEVIIISDR
FT                   PVIEGLENDSESLLSGINFSYQNDSRELLDRIRTDLPDMIMVDLGLESYDPLRLCSAIR
FT                   SAEGSRLLPLLAIADQEDTRRLVKALDIGVNDYLMRPIDVQEMAARVRTQLRRKWYVEH
FT                   LRDSLSQSLELAVLDGLTGIYNRRFLQSQLPRLLTKAVKRELPLSVMILDVDFFKAVND
FT                   TYGHDVGDAVLREIGHMLHFSLRGMDLACRYGGEEFVVVLPETPREGSEVIAERLRKEI
FT                   AGLQIDAGNGQSFSVTVSIGMAFFDGTSREETPASLLKRADEALYRAKEGGRNRVILEA
FT                   A"
FT   gene            complement(406379..406771)
FT                   /locus_tag="PB2503_02397"
FT   CDS_pept        complement(406379..406771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02397"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08557"
FT                   /db_xref="GOA:E0TCC4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC4"
FT                   /protein_id="ADM08557.1"
FT                   /translation="MSEPAGTPNADRTVLIVEDNELNMKLFHDLLEVQGYRVLQAVNGA
FT                   EALDLARAHRPDLILMDIQLPEKSGLDVTREIKADDELRAIPVIAVTAFAMKSDEARIR
FT                   EGGCEDYIAKPISVPVFLDKVKRYLS"
FT   gene            406946..408214
FT                   /locus_tag="PB2503_02402"
FT   CDS_pept        406946..408214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02402"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02402"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08558"
FT                   /db_xref="GOA:E0TCC5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC5"
FT                   /protein_id="ADM08558.1"
FT                   /translation="MCLDCGGVSEPVSPLCPICGSARQVSHPELDRLSIAHVDCDAFFA
FT                   AIEKRDDPSLVDKPVLVGGGHRGVVSTCCYIARSYGIHSAMPMFKAKALCPQAVIVPPR
FT                   GAAYREAAAQIRDLMAPLTPLIQPVSIDEAYLDLGGTERLHGAIPAQLLAKLAKDVETQ
FT                   IGITLSIGLSVNKLLAKIASDFDKPRGFTLIGGTEAANFLAPYPPGLLPGIGTRFSEKL
FT                   MRDGFRTLGDLQHCSTRELVDRYGEHGLTLRARACGEDPRPVTVDRETKSVSGETTFRA
FT                   DIGDAAALEDHLYAMARKVSSRAKEKGLAGRVVTLKLKTARFRTFTRRQTLPHASNLTR
FT                   VIFDCARAMLTAELQKGRTPVTYRLIGAGISDLVPAEVMHDGYLFAEDLEKTGRREDAI
FT                   DKLNARFGEDSIGTMRDRRIARK"
FT   gene            complement(408336..408629)
FT                   /locus_tag="PB2503_02407"
FT   CDS_pept        complement(408336..408629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02407"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08559"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC6"
FT                   /protein_id="ADM08559.1"
FT                   /translation="MSSRIPHHIDHKVRGTVDHRRLVTKIGAAGDKAPQFHAANQIGQT
FT                   APKIRFDLGEQIDRTYFGGFLAFLKGKGGDVRPRGAADNPLDQGFRGYGDLT"
FT   gene            408573..408713
FT                   /locus_tag="PB2503_02412"
FT   CDS_pept        408573..408713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02412"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02412"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08560"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC7"
FT                   /protein_id="ADM08560.1"
FT                   /translation="MINGASDFMIDVMGDAGRHTRFAVGAPSLPLGVAVEIDGIFRIKQ
FT                   S"
FT   gene            complement(408654..409841)
FT                   /locus_tag="PB2503_02417"
FT   CDS_pept        complement(408654..409841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02417"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02417"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08561"
FT                   /db_xref="GOA:E0TCC8"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC8"
FT                   /protein_id="ADM08561.1"
FT                   /translation="MTPPVVMIAAVEPSADALGAALIREMRQRAPHLTFTGCGGPQMQA
FT                   EGFESLFDIDIFSVMGFTDVAKVIPAAWSRARQLARRAAQGDVVCAVFVDGWTFSRLSA
FT                   KRIRQRAPNLPIVKYGAPQVWASRPQRTAFVRDHFDLVLALLPFEPPIFEEAGTRALFV
FT                   GNPNFEAMAATPRSGKAFRTRHGLEGRDLLAVLPGSRKGEVSRLLSIFGDATTLAAQSV
FT                   RGLVPVIPLAPSVAEQVVTATREWPVPPLCIPPEERYDLFEAADVALAASGTVTTEIAM
FT                   AGTPMVVGYRVDPLTAFWAKRVLITEYISIVNIFAGREVIPERLQDDCTPDQLSADIIR
FT                   LFTDDDARRTQLTAYRQLLPALIGEGNTAGRAAEAVLGLLDPEDTVDLHRNAKGQ"
FT   gene            complement(409838..410710)
FT                   /locus_tag="PB2503_02422"
FT   CDS_pept        complement(409838..410710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02422"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08562"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCC9"
FT                   /protein_id="ADM08562.1"
FT                   /translation="MAEPWKKLGIIAGGGSLPLKIAESCQQQDAPFHILALSGYADDIL
FT                   KSFKPSWCGIGEVGKAIRVLKDHGCDAVVLAGNVTRPNFATLRPDWRGAKLLPKILSAA
FT                   TQGDGAMLDVLVATFASEGFYVVGADDVATALTVPAGALGMLGPDTCDLSDMRKAAAVV
FT                   AALGPFDVGQGAVVRQGFVIAIEAAEGTDLMLGRCAPLIARLQGEEGNRSERRGVLLKC
FT                   PKPEQERRVDLPTIGVRTVELAAEAGLAGIAVEASGGLVLDSGAVARCADARGLFVYGY
FT                   TSHDLREGA"
FT   gene            complement(410714..411499)
FT                   /locus_tag="PB2503_02427"
FT   CDS_pept        complement(410714..411499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02427"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02427"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08563"
FT                   /db_xref="GOA:E0TCD0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD0"
FT                   /protein_id="ADM08563.1"
FT                   /translation="MTLHPTAIIEDGAEIGEGVKVGPFAHIGPEVRLGPNVHISSHAVV
FT                   TGRTEIGEGTEIGPFCVIGTPPQHNAHRGEPTRLIIGKRNRVREHVTMHTGTMLDQGVT
FT                   SIGDDCLLMVGAHIAHDCVVGNHVTFANNATLAGHCRIGDHTFLGGLSAMHQFCRVGPY
FT                   AILGGGGILRGDLIPYGSAKGNTATLEGLNIIGMKRRGLSRETIHRLRSAFRSLFAASG
FT                   TLKERVAATEEAFGDIDEVQTILAFLKEEAKRPLCQPGA"
FT   gene            complement(411496..411966)
FT                   /locus_tag="PB2503_02432"
FT   CDS_pept        complement(411496..411966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02432"
FT                   /product="UDP-3-O-3-hydroxymyristoyl
FT                   N-acetylglucosaminedeacetylase/(3R)-hydroxymyristoyl-(acyl-carrier-protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02432"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08564"
FT                   /db_xref="GOA:E0TCD1"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD1"
FT                   /protein_id="ADM08564.1"
FT                   /translation="MTESQDTPRTFPDLDVNGIKAILPHRYPMLMIDKIVDITLDGATG
FT                   VKSVTANEPFFEGHFPQMPVMPGVLIIEAMAQTAAAYTAYVEEIDTEGKVVLFMGIEKA
FT                   KFRHPVFPGEQLRIETKIASKRPPVWRYEAKAYVNGKLATEASFGAMLTEPK"
FT   gene            complement(413161..413733)
FT                   /locus_tag="PB2503_02442"
FT   CDS_pept        complement(413161..413733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02442"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08565"
FT                   /db_xref="GOA:E0TCD2"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD2"
FT                   /protein_id="ADM08565.1"
FT                   /translation="MKKFIALIVVLGMLPGAAFAQKVAYYDHGKVVRDSNAWQSIDKEL
FT                   AAKRDEIVAKLQPIVAEVQKEGQELQKATDGLKPEQIQARYGERVQEYQGKLAGLQASR
FT                   NQVNQQMSVVRELAENKINVVINDSLDEIASRRRVDVVERQVPLSFYSKKYDATDEVLA
FT                   AVNQKLSSLDIDSLVAEVAARAEAQAQ"
FT   gene            complement(413954..416485)
FT                   /locus_tag="PB2503_02447"
FT   CDS_pept        complement(413954..416485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02447"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02447"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08566"
FT                   /db_xref="GOA:E0TCD3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD3"
FT                   /protein_id="ADM08566.1"
FT                   /translation="MGGAASIVLVPTVSAQSSPVVPSEPVGAATVPDETGGLIRRIEVV
FT                   GNQRIEASTVRSYLPIGPEQRVSQVAIDASLKTLFGTGLFADAGISFDNGVLTVAVQEN
FT                   PIVNRVIFEGNRTNEDKFTEEIQLAPRAIYTRAKVQADTQRILGVYRATGRFGASVTPK
FT                   IVELPQNRVDVIFEIEEGPKTGVAAINFVGNEAFTDAQLRKAILTSESAWWNFLESNDN
FT                   YDPDRLEYDRQLLREFYTKQGYADFSVASAVAELTPDREDFFITFTVEEGPQYTFGKVD
FT                   VRTTLYKIEGDALKAVLPIREGTQFNSELIEKAEEAIAYATGINGYAFVDVAPRLTRNA
FT                   DTKTVDVVFEVNEGPRVYVDRINIRGNTQTLDRVIRREMRLTEGDAFNRVLVERSERRI
FT                   KGLGFFSEVAIEEQPGSAPDRTVLDVAVTEQSTGSFQIGAGLSSADSFIINFQLEQRNL
FT                   LGRGQYLLLDLQTSSRTRRARVSFTEPYFLGRRLRAGFSFTANRTDFEEAGFISDSIGG
FT                   GLNIGFPVSEFGSMSLSYLLRQDDVTLERSTTQVVEASEGEVIEDFLVNGASTPEIVET
FT                   APNGDLTYQVEICDLLTRSLDPTCESRGKFLTSQVGYSLRFDRRDDPITPSRGWRVDLS
FT                   QALAGVGGDVNYLQSTARGSLYRPLPLDFVGALKFDVGYIDGFGDDGVRVSDRFFKGGN
FT                   RGFRGFDVAGVGPRYFEPGATVNGVTQAGFDRAIGAKAYAIGTVEAVLPLPLPPQYGIR
FT                   AALFSDFGAVGVVDEDDKLLNNDPVNFVDFDDDGIPDPPVQDDFSMRATAGLSINWRSP
FT                   FGPVQIDLAEAIQKEEYDETQVFRFSAGGAF"
FT   gene            complement(416573..418066)
FT                   /locus_tag="PB2503_02452"
FT   CDS_pept        complement(416573..418066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02452"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08567"
FT                   /db_xref="GOA:E0TCD4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD4"
FT                   /protein_id="ADM08567.1"
FT                   /translation="MVDLALTVLVSLVAFAVLLAFIVFIHEYGHFKTARLCGVKVETFS
FT                   IGFGKAMLQWTDRKGTVWKIAAIPLGGYVKFFGDANAASAGTEAKGARPATTQFGSEKD
FT                   RLAALLTEEEKRVCFHFKPVWQRALIVAAGPVANFILGALIFSAILFLLGTRTVDPVVG
FT                   RVAPNTVADAAGFEPGDRILSVNGRTLRSFNDLVTRVRLAADETLTFVVERDGETETIT
FT                   ATPRRTEQTDAYGNKVRMGQLGIVAFTPPLVGALAEEGPAAAAGLAVGDEIVSVAGQEV
FT                   FTFSDIYDAIEGRAGQTVPVQFRTQDGQIREVRVTLGTRVVGEGATAESYATLGIGAPL
FT                   PPLRTYSPLMALVDGTRQVGTVIETTLRYLGRLILGREDPRQMGGPVKIAQYAGQAAKS
FT                   GFEPTYDIPLSDRLKISLSQFISLAGLISVSIGFMNLLPIPVLDGGHLVYYGYEAIAGR
FT                   PLSDRVQGIGFRVGLAIVGTFMIFVIVNDVVGLVMKVGA"
FT   gene            complement(418125..419300)
FT                   /locus_tag="PB2503_02457"
FT   CDS_pept        complement(418125..419300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02457"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02457"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08568"
FT                   /db_xref="GOA:E0TCD5"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD5"
FT                   /protein_id="ADM08568.1"
FT                   /translation="MTLKRRVTVLGATGSVGTCTLKLVADTRRTAAAEIEVEALTAHTN
FT                   AEALAALAIEHQASFAAVADPGAGGRLAAALKGTGIAHGAGPEAVIEAAERDADWVMAA
FT                   IVGAAGIKPLLAAAHRGADIAFANKECLVCAGEAVLAAVAEGGGRLLPVDSEHNAIFQV
FT                   FDFARPETVRRIVLTASGGPFRERPRDTFDQVTAAEAVSHPNWSMGAKISVDSATMMNK
FT                   GLERIEAAYLFPVPKERIEILVHPQSVIHSMVDYIDGSMLAQLGTPDMTIPIASALAWP
FT                   ERIPTGATPLDLAAVGRMTFEPPDEQRFPALRQARESLEAGGLMTAVLNAANEVAVAAF
FT                   LKGQVRFTDIAALTDHCLQTVQPEGDPFTLEGVLEADRAARAAVKARALSL"
FT   gene            complement(419323..420213)
FT                   /locus_tag="PB2503_02462"
FT   CDS_pept        complement(419323..420213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02462"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02462"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08569"
FT                   /db_xref="GOA:E0TCD6"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCD6"
FT                   /protein_id="ADM08569.1"
FT                   /translation="MEKRLGPRQTRQGRELPTRTPITASPSPLRPPGAAPRLRGLITRI
FT                   VTAGLLVPLALGIVWWGGPAFSALIAFMLIILIFEWARIVDRAEFSRGFYTLSLTAFAT
FT                   VFFAAGGAYGLASLIAIFGGGIATLLERRRKAAVSWPLIGAIYLLLPAVAVLFIRHDGG
FT                   LAAAVLLFVVVWATDSGAYLVGTFLGGPKFWPALSPNKTWAGVLGGLMAGSGTALLLGQ
FT                   VLSLPPLIAPLWLVAAGLSLATLIGDLLESALKRAYDIKDTGGAFPGHGGVLDRLDGFI
FT                   FAAVILAFLLLIGQE"
FT   gene            complement(420259..420885)
FT                   /locus_tag="PB2503_02467"
FT   CDS_pept        complement(420259..420885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02467"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08570"
FT                   /db_xref="GOA:E0TCI1"
FT                   /db_xref="InterPro:IPR009495"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI1"
FT                   /protein_id="ADM08570.1"
FT                   /translation="MSFIEGLAATAQPVARRRGAQDLVIIALVVLVEVIGFSYFFDPER
FT                   FAAYVDAAPRQMIMKIVLFSSLFVTSLAAALHSFEATARRLDPVILAGGSAVGLMGLMS
FT                   FDYAMGPGLEATLLPRQGLGCLSAITLLSLPVCFAMGLLMTRAASVQPGRTALLIGLTG
FT                   GAFGATLFSLICPYTSLWYIGVWYGGAIIVSSAWCVRVLPDFNQW"
FT   gene            complement(420887..421465)
FT                   /locus_tag="PB2503_02472"
FT   CDS_pept        complement(420887..421465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02472"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08571"
FT                   /db_xref="GOA:E0TCI2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI2"
FT                   /protein_id="ADM08571.1"
FT                   /translation="MVMTIVDFTKASRTPIHQVDLSPCGALMAKAQKGDKAAYTEALSL
FT                   CDQWLRLYLPRRLAHERIDDAIQETLLAVHRKRHTYDPSRPFPPWFVAIARFKWLDGLR
FT                   AAYRAEEAELTDDHGIDSHEESVLSRILLQKVMTHLPPAQAEVLRLAKVEGRSIEEISV
FT                   ATGQSASLVKVNIHRARKKLVKLLEKSHE"
FT   gene            complement(421533..422303)
FT                   /locus_tag="PB2503_02477"
FT   CDS_pept        complement(421533..422303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02477"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08572"
FT                   /db_xref="GOA:E0TCI3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI3"
FT                   /protein_id="ADM08572.1"
FT                   /translation="MDVNAPRRLAQRMAASMPGAGDEEEKSLRHVAIIMDGNGRWAKKH
FT                   GVSRLRGHQEGMEAARRAVEAAKDLGLSHLTLYSFSTENWNRPEWEVRHLMGLLRQFFE
FT                   KDLADLVEEGIRVRIIGDRRTLPNDIREMVEQAERQTADNKGYTLQIAFNYGGRDELVR
FT                   AVSSLAEQVASGTLDVEAIDERVIGDTLDTANAPDPDLVIRTSGEQRLSNFLLWQAAYS
FT                   EFIFMDCLWPDFDEAAFREAVDIYRGRNRRFGGR"
FT   gene            complement(422371..422922)
FT                   /locus_tag="PB2503_02482"
FT   CDS_pept        complement(422371..422922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02482"
FT                   /product="putative ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02482"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08573"
FT                   /db_xref="GOA:E0TCI4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI4"
FT                   /protein_id="ADM08573.1"
FT                   /translation="MADGPDMKELEKRMDGAIASLKSEYAGLRSGRATISLLDPVTVNA
FT                   YGSEMPLNQVGTVGVPDARTLSVQVWDKGLVSAVEKGIRESGLDLNPVTDGQTVRVPMP
FT                   PMTEERRRDLAKLTGKYAEAAKVAIRNVRRDGMEEAKKAEGVSEDDQKRMSEEVQKLTD
FT                   AKVKEIDQMHAQKEKEIMQV"
FT   gene            complement(423037..423774)
FT                   /locus_tag="PB2503_02487"
FT   CDS_pept        complement(423037..423774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02487"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02487"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08574"
FT                   /db_xref="GOA:E0TCI5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI5"
FT                   /protein_id="ADM08574.1"
FT                   /translation="MTDQAAQTPRYRRICLKLSGEALMGEKEFGIDLETVERIAREVKA
FT                   AREMGAEICLVVGGGNIFRGLQMAARGMERASADYMGMLATVMNALAVQNALEAIDVET
FT                   RVMSAITMTEVCEPYIRRRALRHLTKGIVVIFAAGSGNPFFTTDTAAALRAAEMGCDAL
FT                   LKGTQVDGVYSADPKSDPSAQRYERLSYMDVLRNDLRVMDQAAISITRENAIPILVFSL
FT                   KDGIGGPVSGQGRFTTIADSDPA"
FT   gene            complement(423874..425328)
FT                   /locus_tag="PB2503_02492"
FT   CDS_pept        complement(423874..425328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02492"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02492"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08575"
FT                   /db_xref="GOA:E0TCI6"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI6"
FT                   /protein_id="ADM08575.1"
FT                   /translation="MAFQTNEGQFEAALMAVGLFYLMALTVSILFFRGTGRRGLSKMKW
FT                   IVLAGLGLGLSLFLSAPIAAYAAGYSFGDDTSLTLMAYGLQLGLAVFGIGGFGYLANRP
FT                   DCGVSTKLSAGVGPLVLAFLTGPVLLMGDGARWTVLNVAALVGAMSLMVVALTPACLLA
FT                   LSHRTRNRRIVFSLLFTAAMIIPYIALKRGGLSAPGVYPGAADYAFALVMSGIALPSLV
FT                   AQLVVFRRLSRRARQERHAREKKVAVDPGRGVADLKSAAMEASVTAHAMRSPLGGIASL
FT                   SELLLSTPLDEDQRRYVRMIAESAEGATSSLGFQAAPPAAARPNRPPPLKRVSMAAMVA
FT                   RLEAVLVGAALEAGVHLIFHVGRAVPAEIWAVEDKLLAALKTLLSDLLGSTAAPNMLVS
FT                   IDAERRNQEATIRLSVTDRATDEAALDRGAEETHRRAAEIGADLLISVREDNVRTAFLT
FT                   FVARLPHTQHSPMNTAPTSQPNASRE"
FT   gene            complement(425566..426492)
FT                   /locus_tag="PB2503_02497"
FT   CDS_pept        complement(425566..426492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02497"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08576"
FT                   /db_xref="GOA:E0TCI7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI7"
FT                   /protein_id="ADM08576.1"
FT                   /translation="MADITAKMVKDLRDKTGAGMMDCKAALNETDGDMEQAVDWLRKKG
FT                   LAKAAKKAGRTAADGLVAYAVDGAKGAVVEVNSETDFVARNETFQKMVGDIAQVALSVD
FT                   GDFGALTSADYPGAGKSVSDHIAEMVGQIGENLTLRRAAGLSVDEGTVVPYVHTQIADQ
FT                   AGKIVVLVALKSSGKGEALQSLGRQLAMHIAAARPLALNVAELDQEVVEREKSVLADQA
FT                   RASGKPENIIEKMVEGRLQKFYQESVLLEQIFVIDNERPVKTVVADAKAEVGAEVTLTG
FT                   FVRFELGEGIAKEEEDFAAEVAAMTQK"
FT   gene            complement(426791..427711)
FT                   /locus_tag="PB2503_02502"
FT   CDS_pept        complement(426791..427711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02502"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08577"
FT                   /db_xref="GOA:E0TCI8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI8"
FT                   /protein_id="ADM08577.1"
FT                   /translation="MALPEFTMRQLLEAGVHFGHQTHRWNPRMREYIFGDRSGIHIIDL
FT                   SQTVPLLHQALVKVRDIVAGGGRVLFVGTKRQAQQPVAEAAGRCAQYYMNNRWLGGTLT
FT                   NWETVSNSIQRMRVIEESLEAEARGFTKKEQLNMTRERDKLELSLGGIREMGGLPDLMF
FT                   VIDVNKEDIAIKEAKKLGIPVVAVVDTNCSPEGVDYIIPGNDDASRAISLYCNLVADAV
FT                   IDGLSASALEFGEDLGELEELPDETALAEAEVMDPAATEASEGVALGAEDQGAVTNAEG
FT                   EEVLAQELDAQAREAEKDQEPAPSS"
FT   gene            complement(428085..428948)
FT                   /locus_tag="PB2503_02507"
FT   CDS_pept        complement(428085..428948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02507"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08578"
FT                   /db_xref="GOA:E0TCI9"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCI9"
FT                   /protein_id="ADM08578.1"
FT                   /translation="MNDISRSMNLTPRNEHFHFEAAERVDWFNGDAGRSIVFNALSVLF
FT                   PEGEKFFMDSVKNFRDKVDDPTLQQQVKVFLTQEAMHTREHVQYNKQLDAQGYSATKLH
FT                   KQLGNFLRFLRKVTTKRTQLAVTCGLEHFTGILADEALKHEEILGGADERYRRAWTWHA
FT                   LEETEHKGVAYDVMQKVCGVFAYPIRAFIMIPTTIIFAYYIWKHIIVMMHDRGLLFSGK
FT                   TWSSVLDHMVGRVGLFRRMIPAWFDYFRPGFHPWDHDNRQLLDKTEKEVQQWTDLAPMT
FT                   TASAAA"
FT   gene            complement(429406..430272)
FT                   /locus_tag="PB2503_02512"
FT   CDS_pept        complement(429406..430272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02512"
FT                   /product="FF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08579"
FT                   /db_xref="GOA:E0TCJ0"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ0"
FT                   /protein_id="ADM08579.1"
FT                   /translation="MNAISRSIDLEPRNEHFHFETNERKYWFDGDPVKTVFWNALSIMF
FT                   PEGEKFFMESVKNKRKLVEDPVLQKQIDGFLTQEAMHTREHVMYNKQLDAQGFSATDLH
FT                   LELKAFLGALKKRIGKNRMLAVTCALEHFTAMMADRVLRDETIFGAADEQYRRVWTWHA
FT                   LEEAEHKGVAYDTFLAAVPNRQRRYLMRCAAMVGTSIIFNYFILKHTGRMMKDVGISRS
FT                   PKAWGNLAKYLLGKPGLYRQIFFPWLDYFKPGFHPWDHDNRQEMAKVERTVASWHAKEP
FT                   ALAGSAA"
FT   gene            complement(430404..431231)
FT                   /locus_tag="PB2503_02517"
FT   CDS_pept        complement(430404..431231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02517"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08580"
FT                   /db_xref="GOA:E0TCJ1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ1"
FT                   /protein_id="ADM08580.1"
FT                   /translation="MATWGYRGTAVITGAGSGIGRALAFALAEKGMDLALVDIREDRLE
FT                   ELRQALASNQRKVTIYARDVADRDAMRRLPSDVAADHDQVSVLVNNAGVALGGQFDQVA
FT                   EDDFDWLMNINFRSVVDLTRAFLPHLREAARARIVNTSSLFGIIAPPGQAAYSASKFAV
FT                   RGFSEALRHELDGSNVGLTVVHPGGIATNIATDARIKIDAPPEEIEKRKQSMNKLLRLS
FT                   PEKAAKAIVEGVEKHRGRVLIGNDAKAAALVARLFPETYYRLIGMQMKGNDGT"
FT   gene            431362..432201
FT                   /locus_tag="PB2503_02522"
FT   CDS_pept        431362..432201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02522"
FT                   /product="glycine cleavage system T protein,
FT                   aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08581"
FT                   /db_xref="GOA:E0TCJ2"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ2"
FT                   /protein_id="ADM08581.1"
FT                   /translation="MMTLTGSLTRDLVSVAGDDRFTFLGNVLTIRCDADGPPLRYGALL
FT                   TPQGKILDTYFMWARGDHYLFDLPKGRGEAFAGRLKRYALRAAVTIAPVDDINVGIRPD
FT                   HPTDQGPNGRDDAALTLLPDPRLPTLGARGLWAGSAAAGAPVEAEYRDHLIRLGIPDLG
FT                   TGFDEADAFPLDVNLDRLGGIDHKKGCFVGQEVASRMFRKGEIRKRTYCLSGAQIPALG
FT                   QSVMVGEIKLGTVTARSGDGRAALALVRLDRLGGREDSAVTTADGADLQLTAPFWLS"
FT   gene            432198..432797
FT                   /locus_tag="PB2503_02527"
FT   CDS_pept        432198..432797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02527"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08582"
FT                   /db_xref="GOA:E0TCJ3"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ3"
FT                   /protein_id="ADM08582.1"
FT                   /translation="MTGRCTWVPETDPVYVAYHDEEWGVPEWDSRALYEKLILDGFQAG
FT                   LSWRTILYKRPAFREAFEGFDPERIAAWESRQVDTLLGNPGIVRHRGKIEAAIVNARAW
FT                   LALEEEGAGAVAHLWSFFGGKPVQNQWAEGEDVPATSPAGTALSKDLKARGFKFCGPTI
FT                   VYAFAQAVGMVNDHLTTCPRHAPVAALAARSPSPSR"
FT   gene            complement(432789..434069)
FT                   /locus_tag="PB2503_02532"
FT   CDS_pept        complement(432789..434069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02532"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08583"
FT                   /db_xref="GOA:E0TCJ4"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ4"
FT                   /protein_id="ADM08583.1"
FT                   /translation="MDSNAPRSSSAPSLINWPPQGEFVSLVAILMAMNALSIDIVLPAL
FT                   GLIGESLDQSDGNAIQLIITIYIFSFGCGQLVLGPVSDRFGRRPLLLIALGLFAVANGL
FT                   AASASDFSHLLAARCAQGLTAAALRVSALAIVRDRYQGRQMAKTMSLVMMVFMAVPLMA
FT                   PLLGQILIGLGPWPLIFEASAVLSGFVFLWVALRLPESLPPARRRRISLSTLIDGYRLI
FT                   ISHRSAWGYMLASGFVFGVLFSFITASNQILLEVYEIGNKFPLAFAGVASGLAVSNFFN
FT                   SRLVEAYGMRALSHTALILFLGVNCLHAVLAFVGYQPFWLFTVMTALPFVMLGFLGPNF
FT                   TALALDPLGKVAGLATSVQGFISTGIAGLFGGWVAHLYNGTPEPYAYGVAILSAGAVAM
FT                   VTWTERGQLRAFRLVKEPPTPPESPSA"
FT   gene            434210..434428
FT                   /locus_tag="PB2503_02537"
FT   CDS_pept        434210..434428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08584"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ5"
FT                   /protein_id="ADM08584.1"
FT                   /translation="MSKTYNKGTTVEWEWGNGTAKGEVQESFTEEVERQIDGNSVKRNA
FT                   DQDNPAYMIEQSDGSRVLKSHSELRKA"
FT   gene            434560..435681
FT                   /locus_tag="PB2503_02542"
FT   CDS_pept        434560..435681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02542"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08585"
FT                   /db_xref="GOA:E0TCJ6"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ6"
FT                   /protein_id="ADM08585.1"
FT                   /translation="MSAAAPVARILSTGLFTPPHRVSNEELVEAYNAWAERWNANHPDN
FT                   QKPLSSAEFIEKASGIKSRFVLDKVGMLDIDRMRPSLPTRSNEELSIMAEIAVAAAKEA
FT                   MEAADLGPQDIDAVLCAASNMQRPYPAMAVEIQNALGIEGYGFDMNVACASAAFGIQTA
FT                   IGLLSTGARRVLMVNPEICTGHINFRDRDGHFIFGDVATAVILGHPEEDGAWNAFDVLD
FT                   TRLKTVFSNNIRNNMGFLDPSTDKIIEWDDPETDRLFKQNGRSVFKEVIPMVAEMICQH
FT                   LDDNDIATAAIKRLWLHQANLNMNVLIAKKVLGREATPEENPTVLDEYANTSSAGSIIA
FT                   FHKHRDGLAAGDIGVVSGFGAGYSAGSIIVRKS"
FT   gene            complement(435668..437518)
FT                   /locus_tag="PB2503_02547"
FT   CDS_pept        complement(435668..437518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02547"
FT                   /product="Mechanosensitive (MS) ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08586"
FT                   /db_xref="GOA:E0TCJ7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ7"
FT                   /protein_id="ADM08586.1"
FT                   /translation="MSLWRLFMIAVLWGGIAAAQPGMGGQDEGTGAYPEGHSGGVARDM
FT                   LDALGSGSKLLIGKIQTTEKRDPIDDPRFNGQDSPRATVMTFLNAMDLVGRGYVDLGFE
FT                   RAMACFPPGTPRTDAVRLYGVFLRLGPVSPVTLPGGEGVQQSGDTRFEYFPRGSDHIWV
FT                   WRALDTAPPANSEIAVQRYGEGTWLFSEATLSGLEALSEAMEPLPPRYGEDDGGAYFIR
FT                   AFSPLVEETGVRGWFLFLATTGLGVLAGIGIHRGVRWLSLRSRRQDHGMVAMTLNGLGI
FT                   TLGIFVFTVAFAIAMGFLTLGPVFLPLKYELPRFLLLTAFAMLVISGIDTITAFAHRNI
FT                   QKTGSGHYDRMVVTIVRRILRTVVITIFLIFVLENVLGVNVGALILGFGVVGLALGLAA
FT                   QDSVKNLFGAVTIFLNRPFFIGDWIQFGGRMDKHWGVVEDIKLQATKLRDLHGNIVTIP
FT                   NMLFIDREVENLSARGFIRREMSLALPYRPDTAELDRAVEALNDILTSDEVMADARAQG
FT                   RDADPHISFYGFEESWLSLRIYHYYFMDEGRADDLAAPAVQRDTERGWFTYLDHISMVN
FT                   RRIVDVFGERDITFAFPRQTVEFLPDKSFKGPVEDALSSS"
FT   gene            437638..438240
FT                   /locus_tag="PB2503_02552"
FT   CDS_pept        437638..438240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08587"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ8"
FT                   /protein_id="ADM08587.1"
FT                   /translation="MPQLTNPPRAWQRMLSGRRLDILDPSPLDIEIEDIAHGLARVARW
FT                   NGQTTGALPFNVAQHSVIVADFCTELSPQWPREWRLAALLHDAPEYVIGDMISPFKSAL
FT                   GEHYRRVERGLQQAIHLRFGLPAILPERVEKLIKKADRACAFFEATQIAGFEEEEARRL
FT                   FPVPQAVSPLNITAMTASESQQLFLERFTALIEEEAA"
FT   gene            438482..439441
FT                   /locus_tag="PB2503_02557"
FT   CDS_pept        438482..439441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08588"
FT                   /db_xref="GOA:E0TCJ9"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCJ9"
FT                   /protein_id="ADM08588.1"
FT                   /translation="MPEPRLVIGLNAVLSALDGTAPKVLCVERALGPSLPFGRFDPDRH
FT                   RTFEIGLREFIERQADVPVGYVEQLYTFGDMGREAPRARMKDGTPSDRVVSVGYLGLAP
FT                   EITEPAIERASWCHWYTYFPWEDLRNGPSKLLTEDLIPALLDWAGQRPGDRMRVDAAFG
FT                   LGDAPWEEERVLDRYELMYEARLVEEAARDVFGEGDGEREPSPGRYGQPMMSDHRRILA
FT                   TAIDRLRGKLRYRPIVFQMVPPVFTLTDLQRAVEAILGFPLHKQNFRRSVEAVGLAEKT
FT                   GEVTGSTGGRPAALYRASRLALQKHGPGLPLPRFRPKC"
FT   gene            439612..440712
FT                   /locus_tag="PB2503_02562"
FT   CDS_pept        439612..440712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02562"
FT                   /product="quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08589"
FT                   /db_xref="GOA:E0TCK0"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK0"
FT                   /protein_id="ADM08589.1"
FT                   /translation="MAAHGFDGEIPLTFTDEVRRKTDPLYPQVAKFMPRMEWELHAPII
FT                   ARINDLKAQKNAVILAHNYMTPDIFFAVGDFRGDSLQLAREAAATDADIIVQAGVHFMA
FT                   ETSKILAPEKTVLIPSLEAGCSLASSITGADVRLLKERYPGTPVVTYVNTTADVKAETD
FT                   ICCTSSNAVQVVEHICAEFGTDQVILIPDQYLAKNVAAMTDKKVITWAGACEVHERFTA
FT                   EDIREIRAGKPGVIVLAHPECPPDVLAEADFAGSTAAMSGYVSKNKPKDVVLITECSMS
FT                   DNVAAENPDVAFVRPCNLCPHMKRISLEGILRSLESGEHEVTVDPVIAQRARAAVERMI
FT                   DLPLTGSVSNYSVTTSGADVIAVEQR"
FT   gene            440720..442216
FT                   /locus_tag="PB2503_02567"
FT   CDS_pept        440720..442216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02567"
FT                   /product="L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08590"
FT                   /db_xref="GOA:E0TCK1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK1"
FT                   /protein_id="ADM08590.1"
FT                   /translation="MSSAAPPGRIIIVGAGIAGLAAAVSLAPSPVTLVTAGEIGHGGSS
FT                   AWAQGGLAAALSPDDSPEEHLQDTLSAGAGLVDPDAARLLCEEAPGAVHWLAELGVPFD
FT                   REKDGRFRLGREAAHHRHRIAHVGGDEAGAAVIDALTHAAQNTPSITIHERCVVHKLLV
FT                   DEDGVTGVMARDITAGENRLLPADHVIFALGGVGGLFAVTTNPLMAQGHGLAMAHEAGA
FT                   TLRDLEFIQFHPTGIDVGRDPAPLATEALRGAGATLHDGHGRRFMVERHPEAELAPRDI
FT                   VARGVADAIAKTGEAFLDTRQAIGADMKAQFPTVYAACREAGLDPVTKPISIAPAAHYH
FT                   MGGILTDLDGRSDVPGLYAIGECASTGVHGANRLASNSLTEAVVFARRAAADIHRHPRQ
FT                   AGPCIAEEIPLPLSPPPNDRDRRRRMAADCGLRRDHDGLSRLSASLAATSPTTEGDRLS
FT                   LLAAKMIVRAALDREESRGAHQRTDFPQTAIPHHTLTPGA"
FT   gene            442264..443124
FT                   /locus_tag="PB2503_02572"
FT   CDS_pept        442264..443124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02572"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08591"
FT                   /db_xref="GOA:E0TCK2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK2"
FT                   /protein_id="ADM08591.1"
FT                   /translation="MPPPPPLPLSVITPLIQKAFSEDFGEVGDLTTGATIAPSQIGTAR
FT                   LSAREKGIACGTEIAAHVFQLLDPEVTILRQVSDGTPVSAGDTVLELCGKATSLLSAER
FT                   TALNFLGHMMGIASLTAAYVEAVAHTPARIASTRKTLPGLRAIQKYAVQCGGGLAHRYG
FT                   LHDAVMIKDNHIIAAGGIGHALKAIRARVSHTVKIEIEVDTLAQLEEVLAAGDADIVLL
FT                   DNMSQASLREAVALVKGQLLLEASGNVSLETVGAIAETGVDVISSGRLTHSAPNLDIGM
FT                   ELSTG"
FT   gene            complement(443146..443946)
FT                   /locus_tag="PB2503_02577"
FT   CDS_pept        complement(443146..443946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08592"
FT                   /db_xref="GOA:E0TCK3"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK3"
FT                   /protein_id="ADM08592.1"
FT                   /translation="MNKKELGGQAGNSSLAAMVAIAAMTFVAAATAGFAYASTSSPSLN
FT                   ENTRFSFGEFFARKANRTASPEVVRAFEPDYVAEQEKQPDAFGQLESLGIDAGSIKKAA
FT                   LRLGIATAAVETMDLGAIDVTALDAKERRCLTEAIYYEARGETAAGRMAVADVVLNRVA
FT                   HKRYPNTICDVVYQGSSRRTGCQFSFTCDGSLNRPVEPKAMRQARALATSIMGGFRLPL
FT                   SKGALNYHANYVSPYWAPKLHQTAVVDNHIFYTPTRTIRYAGLN"
FT   gene            complement(444117..446786)
FT                   /locus_tag="PB2503_02582"
FT   CDS_pept        complement(444117..446786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02582"
FT                   /product="pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08593"
FT                   /db_xref="GOA:E0TCK4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK4"
FT                   /protein_id="ADM08593.1"
FT                   /translation="MTQYIYNFGGGSADGRTDMRNLLGGKGANLAEMASLGLPVPPGFT
FT                   ITTEVCTAFYDNNRQYPEGLKDAVDKALERVESIVERKFGDAEKPLLVSVRSGARASMP
FT                   GMMDTVLNLGLNKETVKGLAALAGDERFAYDSYRRFIQMYSNVVLQMDHHSFEEILDTY
FT                   KDDRDYVLDTDLTAADWQAVIVKYEAAVQAELGKPFPQDVHEQLWGAIDAVFGSWMNDR
FT                   SKTYRRLNAIPEDWGTAVNVQAMVFGNMGDTSATGVAFTRDPSTGENHYYGEFLVNAQG
FT                   EDVVAGIRTPQNLTIAGRQRQGNEDPSLEEVMPETFKELTAIFQTLENHYRDMQDIEFT
FT                   IQEGKLWMLQTRNGKRTAKAALKIAVDLAEEGKISEEEAVLRVNPAALDQLLHPSLDPK
FT                   ATRDLLTKGLPASPGAASGKVVFTADEAERLANDGQKVILVRTETSPEDIHGMHAAVGI
FT                   VTARGGMTSHAAVVARGMGRPCVCGAAEVRIDKAGTAFTVSGRTVSAGDQITLDGATGE
FT                   VFFGAVKTIEPELSGDFAKLMVWADKARRMKVRANAETPLDAKTARGFGAEGIGLCRTE
FT                   HMFFDAERITVVRQMILARDATERKAALDKLLPFQRDDFRELFTVMRGLPVTVRLLDPP
FT                   LHEFLPHTDKEIEEVAQGSGIAVDQLKARAKDLAEQNPMLGHRGCRLGVTFPEIYEMQV
FT                   RAILEAACEVAAETGDAVVPEIMVPLVSMKKELAFLKSRIDAVATEVFADKGRILDYLV
FT                   GTMVELPRAALIADEIAEEAAFFSFGTNDLTQTTYGLSRDDSGAFMPFYIREGLVETDP
FT                   FVSLDPKGVGALVEIGAERGRQTRADIKLGICGEHGGDPASISICERIGLDYVSCSPYR
FT                   VPIARLAAAQASLSGDDD"
FT   gene            complement(446846..448912)
FT                   /locus_tag="PB2503_02587"
FT   CDS_pept        complement(446846..448912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02587"
FT                   /product="glycyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08594"
FT                   /db_xref="GOA:E0TCK5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK5"
FT                   /protein_id="ADM08594.1"
FT                   /translation="MSDLLLELFSEEIPARLQQRGAADLQRLVTDLLSAEALAFDEAVA
FT                   FATARRLTLRVTGLPDAQADRREERKGPRVGAPDKAIEGFMKAAGLASIDEAIVKEDGK
FT                   GAFYVAVIDQRGRRTADLLAERLPQLLKTFPWPKSMRWGESENELRWVRPLHSILCTFG
FT                   GEVVPFTLENGERPITSGACTAGHRFEAPETFEATTFEDYCETLLARKVILDGARREEK
FT                   IWAEATALASAAGLEVIADPGLLAEVSGLAEWPVARMGRFDEKFLAVPDEALIAAMRGH
FT                   QKYFSVRDPKTGRLAPHFICVANIDPADGGQAMMEGYERVLAARLSDAWFLYHQDLKTP
FT                   LAQHAERLKDVTYFDGLGTTWEKVGRTADLAERLALALGAAPAAARGAALLCKADLPTE
FT                   MVGEFPELQGIMARYYYLAETGTAADPAIAEALRDHYKPAGQGDLVPTAPLSVTVALAD
FT                   KLTTLAMFWSIGEKPTGSKDPFALRRMALGVIQLVLENGARLSLRDSVAPLLDTKAQAD
FT                   LLGFFHDRLRVYLKEKGHRYDHIEAVLTPDSDDLGLIVTRLHAIDRFLATPEGGDLVAA
FT                   YKRAANILKAEEKKEGGPFGGEIDTAQLEAAEEQALYTALEGVEAALAAALPKDDITAA
FT                   LAALSSLREPLDRFFTEVTVNVEAPELRKNRLSLLHRLALAFGDVADFAKLEG"
FT   gene            449084..449872
FT                   /locus_tag="PB2503_02592"
FT   CDS_pept        449084..449872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02592"
FT                   /product="Beta 1,4 glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02592"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08595"
FT                   /db_xref="GOA:E0TCK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK6"
FT                   /protein_id="ADM08595.1"
FT                   /translation="MTDHAAARPPLSCYIRTKNEARLIGEVVEAALTVAREVVIVDSGS
FT                   TDDTVARAQAAGAQVYDVAWRGTGRQKRAAEDLCHYPWRLDLDGDEVLSPDLAKEIAAL
FT                   FEGEGPSAAVYALPMVIAPPIGPIWWRVDPDQRNKLYDARVIRMPDSAAWDQLDIPKTM
FT                   KVPKLRHPIIHHAFTDIGFLLRKQERNMTQRAKSAPLKPLWQLRIRIVLGLPVYFLKRY
FT                   VLKGLFLKGIYGFAFSLTIAYGRWLKDIKMYERHRLGEGR"
FT   gene            449872..450573
FT                   /locus_tag="PB2503_02597"
FT   CDS_pept        449872..450573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02597"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08596"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK7"
FT                   /protein_id="ADM08596.1"
FT                   /translation="MADRMTAEEFATPSGRRSAQRALWLDDHGWLRTLYDNTHELPGGM
FT                   RRTYQPSPGRIARYAQEGVKTLINLRGIKTDGRQSGVYWLEKEACEAAGIALVDLRAYS
FT                   REAPKPEFLVDLDACFRSIAYPAVMHCKSGADRAGLAAVLYLFLKEGWPLEEALAQLTY
FT                   RYGHVKSGKTGVLDHFFAVYREAARRDGVVPNRDHFLNWVETAYVRDEVTAGFTPGALG
FT                   SLLTEVILRRE"
FT   gene            complement(450642..451199)
FT                   /locus_tag="PB2503_02602"
FT   CDS_pept        complement(450642..451199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02602"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08597"
FT                   /db_xref="GOA:E0TCK8"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK8"
FT                   /protein_id="ADM08597.1"
FT                   /translation="MTLTVHPQHPTTSLRQVKYTLAYIFLIPLINWSFTWAPMVSVPGL
FT                   ANWVFNPVTIVTGLVLVVRDFAQREIGHEVLIAMGMALFLTYVTTGPALALASGVAFLI
FT                   SELVDWAMFTFTRFRLSTRVLLSSALAAPIDTTAFLLGASRIVEDIFTWPNVMMSIAGK
FT                   MVGALVIWWIIRTRMERRGVAD"
FT   gene            451241..452683
FT                   /locus_tag="PB2503_02607"
FT   CDS_pept        451241..452683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02607"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08598"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCK9"
FT                   /protein_id="ADM08598.1"
FT                   /translation="MDGVLPAGHRPIEPPLPLPRDETARDRPFSFAGAFLGEWAYAGEM
FT                   SHFIDRRLNPKGKSLANRQRFLRRAKTQIKDAVAKSLKDRSVKELEKSGKISIPSKSTA
FT                   EPRFRLDPASGRREHVHPGNKEFAQGDRLRKPPSSRGRGGKEASDSGDGEDNFSFTLTQ
FT                   DEFLDIFFEDLELPNLVKTSLKDMTTWKHRRSGITVAGAPTNLNLVRTMRNAQGRRLAL
FT                   GRPSSQEISELKERLFALEVIAQPTEEQRAEQQAVLTKLEELEARRRWAPYIDPLDVRY
FT                   NAFTPEPVPMTAAVMFCLMDVSGSMGEREKDLAKRFYMLLYLFLKRRYEKVEVIFIRHT
FT                   HHAEEVDEETFFYSRQSGGTIVSTAIEVMQDIQRERFPTGQWNIYVAQASDGYTQPGDA
FT                   KRCVELLNTEVLPIIQYYAYIEILDEREMDVFSDPDAGAELWRAYRSISDNRFAQTRIA
FT                   HPRDIFPVFRELFSKDREGKAA"
FT   gene            complement(452745..453332)
FT                   /locus_tag="PB2503_02612"
FT   CDS_pept        complement(452745..453332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02612"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02612"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08599"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL0"
FT                   /protein_id="ADM08599.1"
FT                   /translation="MRISQLSLLSGVTALASVAFSGAQAGETGTDLQMQAKDMLERCQA
FT                   ISESCMESTKDAAGILVFPEVLKADLIVGGAGGNGVLMVDGQPVGYYDIGKASIGLQAG
FT                   IDEKAMVYVFRDEESLASLTDGEEWEVGINAGVTLITANADAVAETGEPLLYAFDADGL
FT                   VAEFNINTFRIWEDPENAGMAMDDDEMMDVSG"
FT   gene            453544..454728
FT                   /locus_tag="PB2503_02617"
FT   CDS_pept        453544..454728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02617"
FT                   /product="hydroxymethylglutaryl-CoA reductase (NADPH) 1"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02617"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08600"
FT                   /db_xref="GOA:E0TCL1"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL1"
FT                   /protein_id="ADM08600.1"
FT                   /translation="MADAPRPPRIPRNRDDDYTAEMAADRARFAAAQTGAPLDHVTKGT
FT                   IDPALLKGNCENFFGVAQVPIGLAGPLEIDGEHAKGPFYIPLATTEGTLVASYNRGMRL
FT                   LSEVGGVKTTVIERYMQRAPVFHFANARDARAFGEWVADHEADIRTAAEATTTVGQLHH
FT                   IQRFQVAQMCFLRFNYLTGDAAGQNMSGKATYAACEWIAEHAPGQPWYTLSGAIDTDKK
FT                   HSHMNMLHSRGARVVAEVTIPDAVMQAMMGPSNAKLFRGRLVSNAGGMLAGTVNNGMHA
FT                   ANGLTALFIATGQDVANISESHAAITFVELLPNGDYYWSITIPSLIVATYGGGTGLPTQ
FT                   RECLEMLGCYGKGKVEKFAEICAATVLAGEISLAAAVQHGDWVSSHDRYGRNRP"
FT   gene            454805..456304
FT                   /locus_tag="PB2503_02622"
FT   CDS_pept        454805..456304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02622"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08601"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL2"
FT                   /protein_id="ADM08601.1"
FT                   /translation="MSATPKSDGLLFSDSAWTFSDLQRTFEAIEDIGLNDLGLDCYANQ
FT                   IEVITSEQMLDAYSSHGMPLMYRHWSYGKHFARDQMNYQKGYSGLAYEIVINSDPCIAY
FT                   LMEENSMTMQALVMAHACMGHNHFFKNNYLFRQWTDASAILTYLDFAKRYIARCEDEYG
FT                   HEEVELILDAAHALMDQGVFRYNRPPKLSGSERLEKIRARAEHERETFNDIWRTLPNTD
FT                   ETDEQVEERQTEVRNIKLPEENLLYFIEKASPTLLPWQREIVRIVRNVSQYFYPQKQTK
FT                   VMNEGCATFVHHYIMNELHRRGQISEGAVMEFLHSHSSVVFQPSFDDPRYSGINPYALG
FT                   FAMMQDIVRIVETPTAEDHEWFPALAGTKDWRAALKEAWANYRDESFILQYLSPKVMRD
FT                   FRLFALADDGKKTYYQVASIHDEAGYRRTRSALSSMYDLGLHEPNLQVMAADLEGDRKL
FT                   TIAHLRFNGRGLEPSTKATVLGHLKQLWGFEVELTEQDMTT"
FT   gene            456409..456834
FT                   /locus_tag="PB2503_02627"
FT   CDS_pept        456409..456834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02627"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08602"
FT                   /db_xref="GOA:E0TCL3"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL3"
FT                   /protein_id="ADM08602.1"
FT                   /translation="MTTEILAPAAALVLWSLFMLVWLLVVRFPAFRKAGINIAKVAPGS
FT                   RGSSLDGILPDNVMWKSHNYQHLMEQPTIFYPVVIILALVGATGLDIGLAWAYVGLRII
FT                   HSIWQAVANIVLIRAGIFALSTLVLMALALRAFFAVM"
FT   gene            complement(456857..457570)
FT                   /locus_tag="PB2503_02632"
FT   CDS_pept        complement(456857..457570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02632"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02632"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08603"
FT                   /db_xref="GOA:E0TCL4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL4"
FT                   /protein_id="ADM08603.1"
FT                   /translation="MARRDRGKLGKLMIAVLRLGLVFVAVTVIWVGFFRVVIPSHSFLM
FT                   SWRSLSGEEIRQATVPLSAVSDQLVLAVIAAEDTKFCTHHGFDVEQLRQALADAREGKG
FT                   LRGASTISQQTAKNVFLWAGRDWVRKGAEAYFTVLIEFLWPKDRILTAYLNVAEWGDGL
FT                   FGAEAAAQARFGKSARDLTRREAALLAAVLPNPNAWRVDPPGPYVARRARTLEARMRVV
FT                   ARDGLADCVLAKGGR"
FT   gene            complement(457574..458479)
FT                   /locus_tag="PB2503_02637"
FT   CDS_pept        complement(457574..458479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02637"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02637"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08604"
FT                   /db_xref="GOA:E0TCL5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL5"
FT                   /protein_id="ADM08604.1"
FT                   /translation="MQKTDSAPPSFQDLILILQTYWAERGCVLLQPYDLEMGAGTFHPA
FT                   TTLRALGPKPWRAAYVQPCRRPGDGRYGANPNRFQHYYQFQVVLKPSPTDIQELYLGSL
FT                   KAMGIDAAKHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGVDCRPVTG
FT                   ELTYGLERLAMYVQGVDNGYDLDFNGAGVTYGDVFHQQEREFSAYNFELANTEVLFDQF
FT                   REAEAACSAILDKGLALPAYDQCIKASHLFNLLDARGVISVTERQSYILRVRRLAKACC
FT                   EAWLASPQGRTEGAGLVEKV"
FT   gene            complement(458437..459168)
FT                   /locus_tag="PB2503_02642"
FT   CDS_pept        complement(458437..459168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02642"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08605"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL6"
FT                   /protein_id="ADM08605.1"
FT                   /translation="MCSIWHRFILRCFVLFVPALIALALTPLADLEVGDVQSEARLVVT
FT                   CGGTCGAELYGDTRFFLTGVAADFVVPTSDASAIVRQVTFAMERRGSVMSVDLTRAPRG
FT                   VVVTRCGSDKLCFDFETAEAPANTDSLTAIERDLSGMKRAKRRVLLATAQRDLSCEAAD
FT                   RRLAEEAWTVGRLPVRTDCAPRRVETPHDLPSDRPLTFAAVKAVIGRTRARRLGALPSS
FT                   RPRSIGGGCRKPTARRRPFRT"
FT   gene            459344..460204
FT                   /locus_tag="PB2503_02647"
FT   CDS_pept        459344..460204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02647"
FT                   /product="HAD-superfamily subfamily IIA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02647"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08606"
FT                   /db_xref="GOA:E0TCL7"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL7"
FT                   /protein_id="ADM08606.1"
FT                   /translation="MPSPRLLSGLSEIASQYDALLCDAWGVIHNGREVFDGVAEALIRF
FT                   RQERGPVIILTNAPRLSSVIPAQLDRLGLPREAYDGVVTSGDATRQSVIDHGHLDFYKI
FT                   GPAKDDTFFQSTDVRLVPFAEAGAILCTGPEDDERETPEDYRGLLEEAAARELPMICAN
FT                   PDKVVRFGDRLIYCAGAIADLYETLGGQVVMSGKPHPPIYAVARDALRQAAGREAARLL
FT                   AVGDGLHTDILGANREGIDVIFNVGGVSLEEGRGPTGDLDAGRLRRRLDEEGLVAQYAT
FT                   DSLKW"
FT   gene            460224..461168
FT                   /locus_tag="PB2503_02652"
FT   CDS_pept        460224..461168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02652"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02652"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08607"
FT                   /db_xref="GOA:E0TCL8"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL8"
FT                   /protein_id="ADM08607.1"
FT                   /translation="MTIAEVLHAPLECDVAAPYRGAVSVIGNLDGVHRGHQALIGRAKE
FT                   RAEAASRPLAVTVFDPHPRRVFSPEGPPFLLTKLETKAEILGSLGVDYVFVLPFNDYLR
FT                   TQTPETFVRHTLAERLGLHTIITGTDFRFGAGRSGDCTALARHAAASGMQAEAISPVLA
FT                   PGTEKYSSSGIRAALQAGDPQKAARWLGRPWSILGTVEQGRQLARTLDFPTANISLGPY
FT                   VRPKFGVYATSTLIDGERVPGVANIGVRPTVDGTAEWLEVHLFDVAADLYGRALDTQFL
FT                   AFLRPEQKFDGIDALKAQIATDGALARNIHAQS"
FT   gene            461220..461732
FT                   /locus_tag="PB2503_02657"
FT   CDS_pept        461220..461732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02657"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02657"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08608"
FT                   /db_xref="GOA:E0TCL9"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCL9"
FT                   /protein_id="ADM08608.1"
FT                   /translation="MERCVRIIGIDPGLRATGWGVIETEGTRLRFVASGFIRPATKTDL
FT                   AQRLYRLSCELAAVLDSHRPDEAAVEETFVNADPRSALKLGQARGICLAGPAALGCPVA
FT                   EYAPNTIKKAVVGVGHADKRQVAAMVARLLPKAGTPANDEADALAIAICHASHRGSFQG
FT                   CGQRVAV"
FT   gene            461729..462337
FT                   /locus_tag="PB2503_02662"
FT   CDS_pept        461729..462337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02662"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02662"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08609"
FT                   /db_xref="GOA:E0TCM0"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM0"
FT                   /protein_id="ADM08609.1"
FT                   /translation="MIAALHGTVSVLSGENAIIDVNGVGYEVAATPRLLSSLAQGQEVR
FT                   LITETLVAETYIRLVAFQTIEERLTFRLLQTVQGVGAKAALAILSALTPADLFDAVEAG
FT                   DKAMVARAQGVGPKLALRIVTELKGKCGGIVGAFPAVASPRATSAAAVDSPAEDAVAAL
FT                   VALGFDHGAARRTISTLPDLETSRTEDLITAGLKTLAAS"
FT   gene            462334..463356
FT                   /locus_tag="PB2503_02667"
FT   CDS_pept        462334..463356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02667"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02667"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08610"
FT                   /db_xref="GOA:E0TCM1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM1"
FT                   /protein_id="ADM08610.1"
FT                   /translation="MTEARLTDPQPQEDDQDRALRPTRLADFQGQAQVKANLSIFVNAA
FT                   RQRGEAMDHVLLHGPPGLGKTTLARIVAEELGVGFRSTSGPVISKAGDLAAILTGLDPH
FT                   DVLFIDEIHRLTPTVEEILYPAMEDFRLDILIGEGPSARSVTIDLPPFTLIGATTRSGL
FT                   LAKPLLDRFGIPLRLQFYTEEELKGIILRGADRLSTPLTTEGAGEIARRSRGTPRVAGR
FT                   LLRRVRDVATVEGTLPITEEVATKALRRLDVDQLGLEMLDRRYLEIIVTHFGGGPVGVD
FT                   TLAASLAEARDAVEDVIEPFLLQQGLIQRTPRGRKVTDRAYRHLGLPPPSAKETDPVLI
FT                   "
FT   gene            463353..463781
FT                   /locus_tag="PB2503_02672"
FT   CDS_pept        463353..463781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02672"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08611"
FT                   /db_xref="GOA:E0TCM2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM2"
FT                   /protein_id="ADM08611.1"
FT                   /translation="MTDTGNNSLSIRIYYEDTDAGGIVYHANYLKYFERGRTEALRRVH
FT                   GDISNLASDPASPILFVVASIQVDFKRPGHLDDIIRIKTDLVHAKGARLIFDQRAYRGD
FT                   TLLVRADVVVAATDGTGRPCRLPASLAAALLPNGSAAN"
FT   gene            complement(463767..464345)
FT                   /locus_tag="PB2503_02677"
FT   CDS_pept        complement(463767..464345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02677"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02677"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08612"
FT                   /db_xref="GOA:E0TCM3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM3"
FT                   /protein_id="ADM08612.1"
FT                   /translation="MTKANRPSRADAEEAVRTILSYIGEDPQREGLIDTPKRFIGAYDD
FT                   WFKGYSEDPEEFLSRTFEEVEGYDDIVLLRNIRVESHCEHHVAPIIGTAHVGYLPSDRV
FT                   VGLSKIARVVDAYSKRLQSQETLTNQIAGALDRVLQPRGVAVIIDAEHQCISTRGIHKD
FT                   DISCVTRSFTGDFKADPRMEDRFYRLIGG"
FT   gene            complement(464332..464820)
FT                   /locus_tag="PB2503_02682"
FT   CDS_pept        complement(464332..464820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02682"
FT                   /product="riboflavin synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02682"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08613"
FT                   /db_xref="GOA:E0TCM4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM4"
FT                   /protein_id="ADM08613.1"
FT                   /translation="MVKRIHPLATGTDRRVAIVDTAWNDFIVRNLTEGAIETLKRQGVA
FT                   DDHILHVTVPGAFELPIAVRQLAETGAVDAIVALGCVIRGATPHFEFVAGEAAKGVASV
FT                   MADTGVPVAFGVLTTDTIDQAIERAGTKLGNKGAEAASVAIEMIGTLAALKGMRRDES"
FT   gene            complement(464820..465449)
FT                   /locus_tag="PB2503_02687"
FT   CDS_pept        complement(464820..465449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02687"
FT                   /product="3,4-Dihydroy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02687"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08614"
FT                   /db_xref="GOA:E0TCM5"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM5"
FT                   /protein_id="ADM08614.1"
FT                   /translation="MSFVSVEEAAKAVAAGRFVIICDDEGRENEGDLMIAAEFADADAV
FT                   NFCTIHGRGLICCAVEPAIADRLGLQLMVPQKDNRSGFGTAFTVSVEAREGVTTGISAA
FT                   DRARTIEVLCDPKSTPEDLVSPGHMFPLRAHPEGTLGRGGQTEASVDLARIAGCRPAGV
FT                   ICEVMNEDGTMARRDDLMKVAAKHDIPMVTVEAIKAYRKAKKVEAA"
FT   gene            complement(465452..466045)
FT                   /locus_tag="PB2503_02692"
FT   CDS_pept        complement(465452..466045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02692"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02692"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08615"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM6"
FT                   /protein_id="ADM08615.1"
FT                   /translation="MFTGLIEEMGTLLDRSMTEGGATLTIEAAKVLEGVAFGDSIAVEG
FT                   VCLSVTSFTPSQFTVGLAPETLSRTTLGALSFGAPLNLERSLTPVSRMGGHYVQGHVDG
FT                   TGRIHTVKADGDALLIRIDCGPELLKYIVPKGYIAVDGTSLTVIDVDDAGFTLTLIAHT
FT                   QPLVTLGKKREGDPVNLETDILGKYAEKFLQGGK"
FT   gene            complement(466045..467145)
FT                   /locus_tag="PB2503_02697"
FT   CDS_pept        complement(466045..467145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02697"
FT                   /product="diaminohydroxyphosphoriboxylaminopyrimidine
FT                   deaminase +5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase (RibD)"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02697"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08616"
FT                   /db_xref="GOA:E0TCM7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM7"
FT                   /protein_id="ADM08616.1"
FT                   /translation="MTLTDDICMDRAAALGELGAGFTAPNPMVGCVLVKGGQIVGEGYH
FT                   PRPGADHAEIAALKAAGAEARGAVAYVTLEPCNHYGATPPCTKALIEAGVAEVVYAVAD
FT                   PNPLASGGRETLQAAGIAVRAHPTLAASRLTDAWRFSLTADRPWVAAKFAATLDGRVAT
FT                   RGGDSQWITGPAARARSHDLRQRSGAIVVGVGTVLADNPALNPRPEGRAAAETLKVIFD
FT                   SQARTPPHAACLSSPGPVLLITAEDAPGAAKSALKESGAHIISVQRENEGLCLRSALHC
FT                   LRADFGCLSIMVEGGGRLLGSFADAGLIDEVWAFLAPKILGGGQCAVDGHGPSRIGEAM
FT                   ALTDVSIEMAGPDFLIRGRVPRGSES"
FT   gene            complement(467455..468009)
FT                   /locus_tag="PB2503_02702"
FT   CDS_pept        complement(467455..468009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08617"
FT                   /db_xref="InterPro:IPR021395"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM8"
FT                   /protein_id="ADM08617.1"
FT                   /translation="MVRLSHLVLLSGAALALAACGSNRGVLGGGKSSPDEFAIVTKAPL
FT                   TVPPDFALRPPKPGETRPEALSTSERTRQLLIGDVNAAPPSNGELALLESAGAVEADSN
FT                   IREILDAENGGRAEKNASLANQLIFWDFAGGEIDDTDAPLRVEDAEAWKQERAEAIESV
FT                   TGGDPVVISRDRRILNLPGVR"
FT   gene            complement(468011..468667)
FT                   /locus_tag="PB2503_02707"
FT   CDS_pept        complement(468011..468667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02707"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02707"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08618"
FT                   /db_xref="GOA:E0TCM9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCM9"
FT                   /protein_id="ADM08618.1"
FT                   /translation="MSPLRRRGLGMTAIKEWLTAARGNPVFALTCGVAAVTILLDQMTK
FT                   MAILHLIDLPGRRFGHLDLTPFFDLTYVENRGVSFGFFAGGMTSRILLTVLALGVAAGF
FT                   VHWAGRLDRRIAALGAGLIVGGAVGNAIDRTFYGYVVDFLDFSAIGFPWKFNIADTSIN
FT                   LGVAALAYDAFFIVPNRDRTAAPNPTERKVQTGFPGEDHLPKQPDDDHAQTAEDR"
FT   gene            complement(468634..471522)
FT                   /locus_tag="PB2503_02712"
FT   CDS_pept        complement(468634..471522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02712"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02712"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08619"
FT                   /db_xref="GOA:E0TCN0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN0"
FT                   /protein_id="ADM08619.1"
FT                   /translation="MADDKAPDGPDYRSTLFLPETDFPMRAGLPKREPKTIEDWAVKDL
FT                   YRQIRQESAGRPPFVLHDGPPYANGHIHMGTAFNKVLKDFVVRSRQMLGYDANYVPGWD
FT                   CHGLPIEWKVEEDFAAKGRKKKDVPPTEFRKACRAFAERWLSVQRAEFRRLGIEGDWDD
FT                   PYLTMNYATEAGTISQFLDFVERGLVYRGSKPVMWSPVEQTALAEAEIEYHDHQSTMIW
FT                   VRFSFKPGQAPEGLEDASVLIWTTTPWTIPANRAVCYGPSLSYGAYRVDKVRDDLDFTP
FT                   WTKAGEVYCLADNLSETVRDAGFIEQWTRIADIPSKSLEGRFLRHPLDGYAGGYSFDVP
FT                   LLSGDHVTDEAGTGFVHTAPGHGQEDYFAWLGHGYSLDDIPYTVGPDGAYTNEAPGFEG
FT                   EKVLVTEGKKKGKDGGANAKVISALMEHGKLFGRARLQHSYPHSWRSKAPVIYRNTPQW
FT                   FIRMGGEGEGGLRDLALKAIEETAFYPEAGRRRIGAMVRGRPDWLISRQRNWGNPLTLY
FT                   VHKETGEPLVDKAVNERILSAIRERGADAWFDTPDETFLGTDYRPEDFEKVTDILDVWF
FT                   DSGSTHATVLEAREDLRWPADLYLEGSDQHRGWFQSSLLIGCGLRERAPFDGILTHGFV
FT                   LDAKGYKMSKSLGNTVAPEDIVKKYGADILRIWVASSDYSEDVRIGDEIIGSAVDAYRK
FT                   LRNTLRYALAALKGFEAAEKTPYADLDELERYILARVSEVHAEVVAGYSAFDFNAAWRA
FT                   VTEFASMDLSAFYFDIRKDCLYCDDPSLVKRRGVRTVMSIVLDYLLKWMAPIMPFTTEE
FT                   AFHSRYPAVDGSIHLGMFTEPDAQWADMPLLDRWAKIRRVRRVITGSIEAARRDDRLGA
FT                   SLEAKPLVFIEDPDLRGAVADVDWAEVAITSSAELAEGAAPDAAYRLPEIPGVAVVVDL
FT                   ASGKKCARCWRVLDEVADETGLCRRCAAVVSA"
FT   gene            complement(471693..472928)
FT                   /locus_tag="PB2503_02717"
FT   CDS_pept        complement(471693..472928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02717"
FT                   /product="Sel1-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02717"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08620"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN1"
FT                   /protein_id="ADM08620.1"
FT                   /translation="MAFSLLTGGGAVPTALAAVQAEEDLLAQAVSAFRQEQYAAAYAAA
FT                   SPLAERGIPEIDYILGALYTNGQGVAQDLQKGIGLYVRAASNGQVNAQYALGDLAFDGQ
FT                   GVEKDLTRAAEWFNLAASAGHTLAKTRLGIMYAEGLSVPQDPQRAAQLLEAAAEEGNPT
FT                   AQFRLGRLYLEGEGLPTNYRLAAKWFRAAADQGDAESMYNYALLLESGRVGGADLSEAV
FT                   VWMRRAAEAGVLPAKVSMGLLAFNGRGMERSDQEALKWFRESANEGSPEGMFLYAVGLT
FT                   EGLAGDPQLDEALRWATRAVEASTDEPRQAQIERVALRDTLRKVIAETEAVEERRRQAV
FT                   MANRSVVVPWRPGVTPPARPQRQVPKPPVLASNDRGGTPSPVPYRPGQRPVSTPTPDPT
FT                   PPAEEPKRGLRF"
FT   gene            complement(472988..473629)
FT                   /locus_tag="PB2503_02722"
FT   CDS_pept        complement(472988..473629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02722"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02722"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08621"
FT                   /db_xref="GOA:E0TCN2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN2"
FT                   /protein_id="ADM08621.1"
FT                   /translation="MADRALYLITPNFSDSAAFCSELDAALRAAAKDDIPVACVQLRLK
FT                   EKSDEVILAAATAVREVTAAHGVAFLVNDRADLAARLSADGVHLGQQDGDIGEARRLLG
FT                   EEADIGVTCHASRHLAMIAAEEGADYVAFGAFYPSETKDSQYRAELSLVEDWTLMTTMP
FT                   CVAIGGLTAENSAPVLAAGADYLAVCGAVFAHPEGAAAGIRKFAPLFGHA"
FT   gene            complement(473709..474602)
FT                   /locus_tag="PB2503_02727"
FT   CDS_pept        complement(473709..474602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02727"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02727"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08622"
FT                   /db_xref="GOA:E0TCN3"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN3"
FT                   /protein_id="ADM08622.1"
FT                   /translation="MTDTEMKTQAAEKDGFIAALDQSGGSTPKALKLYGIDEGAYANDE
FT                   EMFGLIHEMRARIIKSPAFNGDKVMGAILFERTMDGEIDGTPTAEYLWKSRGVVPFLKV
FT                   DKGLAEPENGVKLMKPMPDLDALLERAVAKGIFGTKMRSVIDAADETGIEAIVAQQFEV
FT                   AKQILGHGLMPIIEPEVTITIADKAAAEDLLLKAITKHLDTLEKGQQVMLKLSLPSKAN
FT                   HYKSLVDHPLVLRVVALSGGYSREEANAKLAENTGVIASFSRALTEGLSAQQDDAAFDA
FT                   TLAKTIDSIYEASKAG"
FT   gene            complement(474625..475836)
FT                   /locus_tag="PB2503_02732"
FT   CDS_pept        complement(474625..475836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02732"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02732"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08623"
FT                   /db_xref="GOA:E0TCN4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN4"
FT                   /protein_id="ADM08623.1"
FT                   /translation="MAAFKTLDDLDVGGKRVLVRVDFNVPMDGDRVSDTTRLERAVPTV
FT                   RELVDRKARVILLSHFGRPKGARVPEMSLRPVADAFAGVLGRPVSFVEESRGEIAERAV
FT                   AGLADGDVLLLENTRFEAGEEKNAADYADDLAKLGDFYVNDAFSAAHRAHASTEGIAQR
FT                   LPSAAGRSMQRELDYLALALAAPKRPVMAVVGGAKVSTKLDVLENLIEKADKLVVGGGM
FT                   ANTFLLAKGMDIGKSLAEPDLAATARSIADKAAAQGCALLLPKDVVVAKEFAPNPDTRV
FT                   CAPDDVAADEMILDVGPESVDQYAAELEGCATLLWNGPLGAFETPPFHTATVELAKFGA
FT                   KLSVAGALTSIAGGGDTVAALNVAQAAEDFTYVSTAGGAFLEFIEGKTLPGVAALETSA
FT                   ASSA"
FT   gene            complement(475908..476915)
FT                   /locus_tag="PB2503_02737"
FT   CDS_pept        complement(475908..476915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02737"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02737"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08624"
FT                   /db_xref="GOA:E0TCN5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN5"
FT                   /protein_id="ADM08624.1"
FT                   /translation="MTVKVGINGFGRIGRLALRSMLEHGRTDIEVVAINDLGPVETNAH
FT                   LLQYDSVHGRLPMTVSTGDGKLTVDGKSIAVFAERDPKALPWGDHGVDVVMECTGIFTD
FT                   RDKAAQHLAAGAKRVLISAPGKDADKTIVYGVNHDVLTADDHVVSNASCTTNCLSPVAK
FT                   VLNDAIGIEKGMMTTIHSYTGDQPTLDTMHKDLYRARAAAMSMIPTSTGAAKAVGLVLP
FT                   ELNGKLDGFAMRVPTPNVSVVDLKFIAARDTSVEEINAAIREAADGPMKGILGYTLVKN
FT                   VSTDFNHDSHSSIFHMDQTKVMDGSLVSVLSWYDNEWGFSTRMADTALAMAKFI"
FT   gene            complement(476912..478879)
FT                   /locus_tag="PB2503_02742"
FT   CDS_pept        complement(476912..478879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02742"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02742"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08625"
FT                   /db_xref="GOA:E0TCN6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN6"
FT                   /protein_id="ADM08625.1"
FT                   /translation="MAAALSVLAADAVEAAKSGHPGMPMGMADVATVLFTKHMVFDAGA
FT                   PDWPDRDRFVLSAGHGSMLLYGLLHLLGYEDMTLEEIKQFRQIGAKTAGHPEYGHAKGI
FT                   ETTTGPLGQGLANAVGMAIAEAHLAARFGADLVNHYTYVIAGDGCLMEGISQEALSLAG
FT                   HLRLNKLIVLWDDNGITIDGKVSVADRTDQLARFKASGWATLSCDGHDPDAIDAALTEA
FT                   KSLDAPVLIACKTTIGRGAPQKAGTAGIHGAPLGADELAGLRKALSWEDDPFVVPDDIV
FT                   GAWRAAGTKGRAARSEWEARLEANGQKEALTALFSGDTSSAQAAVLDYAARLTTEDAKP
FT                   VATRKASQNVLEVINETTTLTMGGSADLTGSNNTKTGATSPFTADSPAGRYLHYGIREH
FT                   AMAAAMNGMALHGGVLPYGGTFLVFSDYMRGAMRLSALMGIQVIYVLTHDSIGLGEDGP
FT                   THQPVEHLASLRAMPNMTVLRPADAVETAEAWAVALGHRTGPTALALTRQNLPLLRGEA
FT                   GGENRTARGGYVLAEAAGAAATIIATGSEVEIAVDAAKQLEAEGHAIRIVSMPSVDLFA
FT                   SQDETYQQQVLGTAPRVAVEAGVAQGWDRWLFAFGGRGAFVGMDSFGASGPYKDLYQHF
FT                   GLTAERVAETVRALVKREDA"
FT   gene            479050..479289
FT                   /locus_tag="PB2503_02747"
FT   CDS_pept        479050..479289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02747"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08626"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN7"
FT                   /protein_id="ADM08626.1"
FT                   /translation="MSSLIELRRASSRLDRALVRLDSSLKQSSASRLKEVSLHLELRRI
FT                   EDWLAEVETALSAVISPEESGTVDPPPKEGSDRA"
FT   gene            479282..479587
FT                   /locus_tag="PB2503_02752"
FT   CDS_pept        479282..479587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02752"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08627"
FT                   /db_xref="GOA:E0TCN8"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN8"
FT                   /protein_id="ADM08627.1"
FT                   /translation="MPDVRITINGQGYTLGCGPGEEERVRALAAYFNDHVEVLAKEIGR
FT                   TAEKRLLILAGLRVCEELFDRRDEKTEAAITEAVAVLDRAADEIEALAATLDLPDP"
FT   gene            complement(479754..480002)
FT                   /locus_tag="PB2503_02757"
FT   CDS_pept        complement(479754..480002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02757"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08628"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCN9"
FT                   /protein_id="ADM08628.1"
FT                   /translation="MGRLVTGLKGAFAEKPLPINRYNGGFSVQGPVLRLSCLVSHASLG
FT                   PLIEGCPPGGQALPPKSPHRPSDGIVALDPKDQVGTA"
FT   gene            480045..480524
FT                   /locus_tag="PB2503_02762"
FT   CDS_pept        480045..480524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02762"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02762"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08629"
FT                   /db_xref="GOA:E0TCP0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP0"
FT                   /protein_id="ADM08629.1"
FT                   /translation="MKDFAPDQPSAIALYAPKGQELDTAPLAKRLSERGHAILLPVVTA
FT                   QDAPLEFRLWEIDRPLVEGRFGIPVPPADSPKRLPQIIVTPLLAVRPDGARLGHGGGYY
FT                   DRTLSALRTEGPGALAIGYGYEGQVMDRFPVETHDQFLDGFASEVQSRIFPQRPA"
FT   gene            complement(480430..482313)
FT                   /locus_tag="PB2503_02767"
FT   CDS_pept        complement(480430..482313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02767"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08630"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP1"
FT                   /protein_id="ADM08630.1"
FT                   /translation="MIVCAVGLVSACSTPPRETQPTSLPAGDRPSAPGVSGEIDPLVLE
FT                   FRRLVAETDPFSIAAPLPYSPRLPALDDNALTRRSERLARLRGQIRDLPPPLLTKEAQW
FT                   KREALLVELDRRGDRLLTTPSFLILGPTSGPDLVVTQLPDLLPFTSAADYRVYFALLRD
FT                   TPRFLREAQGRLDARRQAVTAQPCLSLYGVEARLATFSELEQIETILMRPFTPPAPALG
FT                   ERQAAQLRAEAAAIIAQDVGPALAEFRRYVETTITPTCQPGEDLRLAGLDLAAYQGRLG
FT                   DAYGAPISPAEAYGWGLARIGDLRADLTARVLPLGYGSLPAYQAGRDRLAADGFPLDSA
FT                   IALLSAITPALSREFLALPEARLGIGPMAPGVPAAGRLAVYSPASPDGRRPAVLWLAAN
FT                   NDQPWVREDIPALIFHNAAPGQHFAYTAVLAGHGGQSFIVDQPAFFEGWGLYATGLGAA
FT                   FDLDNAGRTQISSVSHELLLVSQMVVDLGLHIDGWTPDRARDYLMDVNGLSRERAMAMV
FT                   ADIVARPGRAAAPVLGARRLREERAAAAAALGPAFDEAAFHQQIFALGPLPMSVLSRAL
FT                   TAWRLEGGRPPIPEARPDRPFTPDAEEISDSEPRWQTRRGIGRGSRLETGP"
FT   gene            complement(482424..482711)
FT                   /locus_tag="PB2503_02772"
FT   CDS_pept        complement(482424..482711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02772"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02772"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08631"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP2"
FT                   /protein_id="ADM08631.1"
FT                   /translation="MSVEFDHGMIGDAEKIVSPEEMYRLGIAASTPGEDRQTDLVTAHK
FT                   WFNLAAMSGNQVAKEYRQQLTLEMSGRQIAEAQRKAREWLASRRAAMTAA"
FT   gene            482936..484297
FT                   /locus_tag="PB2503_02777"
FT   CDS_pept        482936..484297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02777"
FT                   /product="DNA Repair Protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02777"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08632"
FT                   /db_xref="GOA:E0TCP3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP3"
FT                   /protein_id="ADM08632.1"
FT                   /translation="MARSTESYVCQSCGAVYAKWAGRCDACGSWNTIDIELSDAPPGSV
FT                   GAKSGGTKGRALTVEGMIGEAAPLPRLSTKNAEFDRAVGGGLVPGAALLIGGDPGVGKS
FT                   TLLLQLAAGLAAQGTDTLYISGEEASGQIRMRAERLGLQQTAARLATGTALRDILQTLK
FT                   DETPGAVIIDSIQTLWTDTLPAAPGTVTQVRACAQELVRHAKQRNMILILVGHVTKDGQ
FT                   LAGPRVVEHLVDTVLYFEAEKGRAFRLVRAVKNRFGAAHEIGVFEMTARGLEEVSNPSA
FT                   LFLGEGGDPVAGSVVFAGIEGTRPLLCEVQALVSPSSLGAPRRAVVGWEASRLSMILAV
FT                   LDTRAGLDFARHDVFLNVAGGLRISEPAADLAAATALLSSRLDIALPPQMVAFGEIGLS
FT                   GAIRSVPQAETRIGEAEKLGFTAALVPQGLDLKTTLTLEEVGDVTALLTAMKKH"
FT   gene            484369..484869
FT                   /locus_tag="PB2503_02782"
FT   CDS_pept        484369..484869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02782"
FT                   /product="Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02782"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08633"
FT                   /db_xref="GOA:E0TCP4"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP4"
FT                   /protein_id="ADM08633.1"
FT                   /translation="MTLFDLAIILVIGLSTLFAYLRGLLREFITLIALGVGTLCTLYFG
FT                   DTLARLFGEGTLALLLGYGLSGLIGFIAATIGLEILIARLSGTTPHKWDQVGGAIFGIL
FT                   RGWVLMGLVYFSVINYIPEDNPPRWVANSALRGIAASAAGVLESLGLDAELTSPARTDG
FT                   DTA"
FT   gene            484912..486447
FT                   /locus_tag="PB2503_02787"
FT   CDS_pept        484912..486447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02787"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02787"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08634"
FT                   /db_xref="GOA:E0TCP5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP5"
FT                   /protein_id="ADM08634.1"
FT                   /translation="MSSHRGADPRTAAALRFARRAASGPRAPLPRALNEECGVFGLIGN
FT                   DGPAASRVAMGLHALQHRGQEAAGICTFDGEQFYAERNLGLVIPHFTQAHVLEQLEGQA
FT                   GIGHTRYSTTGAPNRRNVQPFYADLDIGGVALAHNGNLTNARVLRQRLIQQGRIFHTTS
FT                   DSELFLKLIAQSRAPQITDRVREALGVVEGAYGLLVLSQDCLIGVRDPVGIRPLVLGRL
FT                   NGAPVLASETCAFDLIGAEFERDIEPGEMVICSADGTVKSVRIFPAPAHPRPCIFELIY
FT                   FARPNSFIDGQSVYALRKRLGQRLAMESPVEADLVAPIPDSGIAAAIGYAAQARLDYDM
FT                   ALIRGHYAGRTFIEPTQEMRELGVARKLSANKGVVDGKRITLIDDSLVRGTTSKKITAM
FT                   LREAGAREVHFRIACPPIVWPDYYGIDTPDRDELMAATHTIDQMRDAIGADSLAFLSLD
FT                   GIYDALDKGPRGEAPAFTDHCFTGDYPTSLADQDSGADCRPSGTLSYLKERTA"
FT   gene            486533..487117
FT                   /locus_tag="PB2503_02792"
FT   CDS_pept        486533..487117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02792"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08635"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP6"
FT                   /protein_id="ADM08635.1"
FT                   /translation="MRFVLKIAALMGLLCAAGFFVFVAALPRSSNEQAALRSLSADART
FT                   GMVILTGGAGRRIQHGLDLFAQGYGDRVLISGTHPLVDKEDLEGLGVRDSLHCCVDLGP
FT                   RARTTIGNALEARDWARRRGYDTILLVTSDFHLPRALLELEAVAPELTVIGIAVDTRSA
FT                   PSANWMRSPSAWRVLAEEYIKYILAWTRHRA"
FT   gene            487127..488791
FT                   /locus_tag="PB2503_02797"
FT   CDS_pept        487127..488791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02797"
FT                   /product="1-Acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02797"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08636"
FT                   /db_xref="GOA:E0TCP7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP7"
FT                   /protein_id="ADM08636.1"
FT                   /translation="MAYLRGLFFTLFMIVVTLVMGIIFLPALVRPSWTWAIAKLWARTL
FT                   LAGLHGICGIGDRISGKDRLIAPAIVAANHQSMWETLRLTLLLPRPVFVLKKELRSIPI
FT                   FGQWTASLGFIFIDRAAGANALRQMLADAVTAIEKGASHIVIFPEGTRAAPGEDVPFQP
FT                   GVAALARQLDLPVIPMVHNSGHYWLTPGPRKEPGHIHLSILPLLSAELKRAELQRRLKT
FT                   TISTEKERLFAMTKSPPSSEAAPRAQRRFLIIPLIVAGLLLGGYSFLWFRGAEMMKREL
FT                   ASFVATQQAMGREITYDDLSIRGFPLSLRAQVDRFSWRAPEAWRWSGDRLHTIAMPWEL
FT                   DRLILAPRGLQTIEYRGVKAQVTPGTLRLGIAAHAFSAEARDLSAALPEGTLKVEQVST
FT                   NAQTTEDHRTVLVVTAAGLRFTDPTGASAILNGLNIAAEITPSGGVMLDLGEMAIAGTA
FT                   DKGGVTYLRLEGEVTSLDPATASGRLTLTYRDPRALIDTLRRFDLAPDETLNQAEVALN
FT                   TFRAGQTQASVPLRLEEGVVFLDILDGLPLLRLPPNR"
FT   gene            complement(488808..489920)
FT                   /locus_tag="PB2503_02802"
FT   CDS_pept        complement(488808..489920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02802"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02802"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08637"
FT                   /db_xref="GOA:E0TCP8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP8"
FT                   /protein_id="ADM08637.1"
FT                   /translation="MKTPRPLPGIAEIAPYVPGKGSTHKGVWKLSANESALGASPLAAA
FT                   AFIDAAKSIHLYPDGDAADLKAAIAEVHGLRKDRLTIGSGSDELISLIIRAYADGTDKV
FT                   LYSRHGFSYYPVAAAAALVGRLDAREADLTIDVEAMIEAANDPAVKVVFIANPNNPTGT
FT                   WLSSVEVRRLRSGLRSDVMLVLDGAYAEYIDDHAYSDGADLVTEAEAAGADNVIMIRTF
FT                   SKIYGLGGLRVGWAYAPLSATDTLNRLRPPFNVGGPSLKAAEAAVRDQAFVAENKAFTD
FT                   KERRRVAKGLGALGYKVRETATNFVLFEAPGATQEDRDREAQRLIDHLETEGVLVRSPK
FT                   SSGLIGYLRVTIGPAEANDDFLAAMAAATR"
FT   gene            complement(489954..490727)
FT                   /locus_tag="PB2503_02807"
FT   CDS_pept        complement(489954..490727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08638"
FT                   /db_xref="GOA:E0TCP9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCP9"
FT                   /protein_id="ADM08638.1"
FT                   /translation="MRLAVSELERFYAGPLGPAVERSLTAKFYEAWGQGDRLRIAGYGY
FT                   AQPYLRLFTKAERLAALCPAGSGVRAGGPVPAVLVDDYAWPLPDASIDRLLIVHGLEEA
FT                   TDTRRLLREVWRVLTDDGLVIFAVANRRGPWSLVETSPFAAGRPFSRRQLDLALKAAMF
FT                   APTAYAAALHFPPIPNRGLLRLAPLWDRLGDSLDALSIGRLLPNIAGVNLVEARKTTSL
FT                   PIGSARAEVLRPGLFAPGGRLDPSGAVARRDEDGS"
FT   gene            490773..491555
FT                   /locus_tag="PB2503_02812"
FT   CDS_pept        490773..491555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02812"
FT                   /product="hydroxyacylglutathione hydrolase, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02812"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08639"
FT                   /db_xref="GOA:E0TCQ0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ0"
FT                   /protein_id="ADM08639.1"
FT                   /translation="MECRFSSLIVDQFPCLSDNYGFLLHDTRTGLTATVDTPQHTAITE
FT                   RLTERGWSLDIILNTHWHFDHTGGNLALKKHFGCEIIGPEAEGDRIPGRDRAIKDGDRL
FT                   TFGESPVEVIGTPGHTKGHVIFYFPEEGIAFVGDTLFSLGCGRLFEGDPAQMWQSLSRL
FT                   RALPEDTVLFCAHEYSAANARFALSLGLDNSALTARAAAIFAARDRDEPTVPIKLGDEK
FT                   AANPFLRADDPALAAAIGCPNAAPAEVFGEVRARKDRF"
FT   gene            491707..492174
FT                   /locus_tag="PB2503_02817"
FT   CDS_pept        491707..492174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02817"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08640"
FT                   /db_xref="GOA:E0TCQ1"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ1"
FT                   /protein_id="ADM08640.1"
FT                   /translation="MDDDDLTAAKTVRFATFLGALGVISFAVGALAAWVPLFGEASGAL
FT                   LSWILVYGAVILSFMAGTIWGVAIKESRAGRLVWAVIPALVGWAATLPPYLLPGDGGSD
FT                   VWRLATLIVAFGALLISELIDRDWDSWYLTLRVRLSLAVMTFLLITMLRLV"
FT   gene            complement(492152..492892)
FT                   /locus_tag="PB2503_02822"
FT   CDS_pept        complement(492152..492892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02822"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02822"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08641"
FT                   /db_xref="GOA:E0TCQ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ2"
FT                   /protein_id="ADM08641.1"
FT                   /translation="MRLLSPPAGVTRLTLCGVEVWLDPAGALVVPGESLVVVSDLHLEK
FT                   GSHFAARGQFLPPYDTAKTLRRVAAVVSTYGPATILSLGDLFHDPQAEHRMLAEDVASL
FT                   RSLCEGCEWVFVLGNHDPLPPALFKGAAHDEVTVGPLHFVHEPDPRPGSVAGHLHPCAV
FT                   VEREGRRVRRPCFVHDGERMILPAMGAFAGGLNVLSPAVRSVFPVDMATVLCSRDRTYR
FT                   VPPHALRSDIRQAPTAQLRRASAS"
FT   gene            complement(492953..494059)
FT                   /locus_tag="PB2503_02827"
FT   CDS_pept        complement(492953..494059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02827"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02827"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08642"
FT                   /db_xref="GOA:E0TCQ3"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ3"
FT                   /protein_id="ADM08642.1"
FT                   /translation="MRRRSLDTPHPLGVFAEDDLAALVAAETITLSAQCGECQIQPASF
FT                   DLTLGQRAWRIRAAFLPGPARSVKSCLDEGLGLHVLDLTDGAVLETGCVYLVELREGLA
FT                   LPPTLSARANPKSSTGRIDVFVRLVTDDGTAYDEVPAGYTGPLYAEVSPRTFSIVVRPG
FT                   SSLNQLRIRHGETRLSDEALGERARREDLTGPRHHGHIHQGLCVSVDLSGDLGPVAAWR
FT                   AKKHTGLIDVDRVAALRPEAYFDPLPVMQDQFLILDPGEFYILASQEELRLPDDLAAEM
FT                   APIDADLGAFRVHYAGFFDPGFGLEAPSRAVLEVRGYDAPFLIRHGQTMARLTFERLTR
FT                   PVSRRYGEALKSHYHGQGLRLSKHFAAP"
FT   gene            complement(494085..494582)
FT                   /locus_tag="PB2503_02832"
FT   CDS_pept        complement(494085..494582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02832"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08643"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ4"
FT                   /protein_id="ADM08643.1"
FT                   /translation="MVLFAVLLGLAAILFAFWEWGRMYRHRQGTARRPGRLVETLSDPR
FT                   EAAAILLVKVAAGEDGQVTVEQKHTIEALMTTNFAITDDEAEGLYSFGRMAVSQIDDIE
FT                   GSVPRLLKPIQGRLTLEEMKDLVQMMEDVAGEEAERDETAQTLITKTRKRLHLDSVVVE
FT                   GP"
FT   gene            complement(494582..495109)
FT                   /locus_tag="PB2503_02837"
FT   CDS_pept        complement(494582..495109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02837"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02837"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08644"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ5"
FT                   /protein_id="ADM08644.1"
FT                   /translation="MRLICFSLLAMLLCAFAPRPSLEQAFAALHHDPASAAEAQSEIED
FT                   AWRTADETGIDILKNRAVAAIDQERFDLAAVLLANVTQLAPSFNEGWVLYGDVLQRQGH
FT                   FGPARTAFTQALRAEPRDYRAMVKLGELARSQGQTTEALGHFQDALRIHPYLPGLKARL
FT                   DDIERDAYGREI"
FT   gene            complement(495206..495331)
FT                   /locus_tag="PB2503_02842"
FT   CDS_pept        complement(495206..495331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02842"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02842"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08645"
FT                   /db_xref="GOA:E0TCQ6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ6"
FT                   /protein_id="ADM08645.1"
FT                   /translation="MKVRSSLKSLKKRHADCQVVRRKGRVYVINKTQRRFKARQG"
FT   gene            495633..496448
FT                   /locus_tag="PB2503_02847"
FT   CDS_pept        495633..496448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02847"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02847"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08646"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ7"
FT                   /protein_id="ADM08646.1"
FT                   /translation="MFISDRLVFIELHKTGCTHIRKVLSEVIEGVISGKHNQATPDLFT
FT                   EGRLFVGSIRNPWDWYVSLWGFGCDGNGGLRQRVAMPSSGIRGLKWRTAPASSLIRVLK
FT                   RPKNERAWQSVYRNSDDPGAFRDWLHMMHDQAYIGDIGEGYSDCALRHVAGLLTYRYLK
FT                   LFSTRGGEEERLNDLSTKPQIDEWDAAQTFVEAFIRMESLEADMFRILDDHAFDFTEEH
FT                   QSRIRSLPKTNASSRQRKLSHYYDPDTVALVAEREQLIINKFSYTPPDL"
FT   gene            496647..498422
FT                   /locus_tag="PB2503_02852"
FT   CDS_pept        496647..498422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02852"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02852"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08647"
FT                   /db_xref="GOA:E0TCQ8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ8"
FT                   /protein_id="ADM08647.1"
FT                   /translation="MYDRQDLTFQLFDVAKLDHLLAHPRFDALDRSAIEGFLDAADHIA
FT                   ETAEPLAARLDETPPTYRDGKVDMLPEAQSAFDALREAGLIGGPLPETYGGLGLPETVH
FT                   QALAFVLSAANIGLTAHGMLTLGAARLIESFGTTAQKEKYLPPLAEGRFTGTMCLSEPH
FT                   AGSSLADITTKAIPQEDGSYKIIGRKMWISGGDHELSENIIHLLLAKIPGGPEGIKGIS
FT                   LFIVPKKRVDDEGGVGERNDVALAGLNHKMGYKGITNCALNFGENEACIGELVGEPHNG
FT                   LRYMFQMMNEARVAVGLGAAALGQSGYQASLAYAKERPQGRHPDEKTPGSGQIPIIEHA
FT                   DIRRLLLAQKAAVEPALALGLFCAILLDRIELGEETAETDALLLDFLTPIAKSWPSEFC
FT                   LEANKHAIQVLGGAGYTKDYPVERLYRDNRLNPIHEGTHGIQGQDLLGRKVTIKGGAAA
FT                   QAFVAAVTADLKRPTDDKDIAAFQESLKQALDRFGQTTMAILGKTQEVGVRRMLSNATL
FT                   YLDFTGHLVMAWMWLRICLAAEEVRRNEGDSDFLKGKVQAARYFFNRELPRTKGWAETL
FT                   SSLEDSAFAMQADWF"
FT   gene            complement(498540..500192)
FT                   /locus_tag="PB2503_02857"
FT   CDS_pept        complement(498540..500192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02857"
FT                   /product="Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02857"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08648"
FT                   /db_xref="GOA:E0TCQ9"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCQ9"
FT                   /protein_id="ADM08648.1"
FT                   /translation="MATAEPADGGSGNLKEYSVSELSGAVKRTIEDGFGYVRVRGELGR
FT                   VSRSGNGHCYLDLKDERAVLSSVIWKGGWSRLKVKPEQGMEVIATGRMTTFAGQSRYQL
FT                   VIDTLEPAGAGALMALFEARKKALEAEGLFAAERKRPLPPMPQVIGVVTSPTGAVIRDI
FT                   LHRLRDRFPVHVLVWPAVVQGEQCPKSVVAGVEGFNALPTDGPVPRPDVLIVARGGGSL
FT                   EDLWGFNDEAVARAVAASSIPVISAIGHETDVTLIDYVADRRAPTPTAAAEMAVPVRMD
FT                   LSGRLDALNVRLTQRIGHHLEAQSLALQSAARGLGRKESLIEPAEQRFDRAVSHLTQSL
FT                   KVRVERATQRMERAAGGLSAALVTAAVAMKAETLKGMSQRLITAPPRRWEQARSKVISA
FT                   RLSPHLVRRSLDRGGEEVKKIGGRLGRLTRENVDRKSARLDDQARLLHSLSYQGVLARG
FT                   FALVLDESQGVIRSPRQMRAGETYHLRFAEGEVPVRHLIEGETKGPAAASSAARKTPQA
FT                   KTSRKSDGSQRGEPSSSDGGSLPPQASLFGDET"
FT   gene            complement(500213..502831)
FT                   /locus_tag="PB2503_02862"
FT   CDS_pept        complement(500213..502831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02862"
FT                   /product="PII uridylyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02862"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08649"
FT                   /db_xref="GOA:E0TCR0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCR0"
FT                   /protein_id="ADM08649.1"
FT                   /translation="MMDGADIQLRLADELRRTIADGASSSELGRYLANERRRIVDTAFA
FT                   GGGDGVDIARSISAGTDWILQAMIEAAAVTDCAVFAVGGYGRGRLAPHSDIDLLIITGS
FT                   DDVSISQLLYPLWDSGLTISQSVHTVRSAIESLKEDPVFHTALLDARPLSPANKLAAQF
FT                   LDKLKAQTRRRSRALIAAKMQERDERYAANNSSLYTVEPDIKQGRGGLRDLDTLRWFCK
FT                   ALDREACLAELFDDKEQARLDRADRFLWSVRVHLHQICRRADDRLTFSHQPLIADRLGF
FT                   TARTELLATERFMRSYFLATRAVASLTGYAIDRLAETVDRRRRPIRPRRTVPEPIVWSH
FT                   KRLDFAEGTVPSVADGLLLFALAAETGCTIHPRALQLLSRTVRSITFAETVEETLADRF
FT                   VAIIRSAKRLGPLLSQMAECGLLGLMMPGFGGVIGKVEYGLYRRFTLDDHVLRSIYALD
FT                   ELIEGTLKGVETMPFADKARELRVEICMALLLQEAEAAMPGLGVEALRQRLTRRVGLFT
FT                   HDSQTGEDVAFCVVNRMMLIRSARRRNIMDIEVIERLSHQVGTLQRLMILSLVTFCRQR
FT                   VVGLGSWEDFARRDIGVLIDLVRLQIEGGEGEVERYLNRYSEKLRGRVQRLIDADGAAA
FT                   LDHLIEAVGASLWVYADVPAIADLATLFAGIISGKEHVGLHIDPGTEGLLDIVVVSTDR
FT                   PTLFAECTGAASVIGGSVFSACGFSVDLAGRRVAVILLQLQRVGNLSLEFVPGPEEKAR
FT                   IEELFSAIAEDRCPDIALPSPSIDDRRHVFDVETQVRIDDTASSKALVVEVETRDRPGL
FT                   LHLLAVSLAEIGVDIEFALVATYGHRAVDTFYLQDAPGYKIEDPRRIEAIKRGLLRALD
FT                   D"
FT   gene            complement(502828..505449)
FT                   /locus_tag="PB2503_02867"
FT   CDS_pept        complement(502828..505449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02867"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02867"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08650"
FT                   /db_xref="GOA:E0TCZ1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ1"
FT                   /protein_id="ADM08650.1"
FT                   /translation="MTPMMAQYHAIREDAGEALLFYRMGDFYELFFDDAIKASAALDIT
FT                   LTHRGKQEGEAIPMCGVPVHAAETYLARLIRKGFRVAICEQTEDPKEAKKRGSKAVVAR
FT                   EIVRIVTPGTLTEEALLSPRAANRLVAVALDDTEFGLATVDLSTGEIGLEAGKGESLGD
FT                   RLSALSPAEWLLSDRQALPPLPVDLPAPTRHPARDFRSVVGREWAQTIFGVQSLDAFGE
FT                   LTELEAGALGALLAYLDLTQKGHLPPLSPPKRAISSAYLSIDAATRRSLEVTRTADGQR
FT                   EGSLLATIDRTLTGPGARRLEALLTAPLTDPRAIGDRLDAVAAFVDDRQRREGMRDLLK
FT                   GVPDLSRALTRLGVGRGGPRDLKAIATGLISARAIMAVMEDAPSRFALPPLLRDLLSTL
FT                   KERAAVWAPLAEPLAAALVEDPPHLVRDGGIFVDGIDAELDAARRLTKDSRQVIAEWEG
FT                   RYREVTGVRSLKIKHSRILGYFIEVTAANADHLRSLEVDDPFRHRQTLANAVRFSTETL
FT                   DHLDGQIAAAGETTLMRETALFEERRAEILAAHGAIQSTASALAEIDVFTALADLADDR
FT                   RYVRPQIDDGLGFQVEAGRHPVVEAALPAGASGFVPNPCLLSEGEAPSLAVVTGPNMAG
FT                   KSTFLRQNALIAILAQCGSFVPAARVKIGIVDRLFSRVGASDNLAQGRSTFMVEMLETA
FT                   AILNQATVRSLVILDEVGRGTATYDGMAIAWATLEELHDGIGCRALFATHYHELTALSD
FT                   KLGRMRNLSMAVKEWKGEVVFLHEVREGAADRSYGLAVAKLAGLPRRVVRRAESLLAQL
FT                   EEGRGPIPTIEDLPLFAQSDTNEREGSEIAEFQDTLSQLDPDSLTPKQALERLYELKER
FT                   WG"
FT   gene            505619..506380
FT                   /locus_tag="PB2503_02872"
FT   CDS_pept        505619..506380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02872"
FT                   /product="zinc metallopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02872"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08651"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ2"
FT                   /protein_id="ADM08651.1"
FT                   /translation="MARVFDISPLKINGQTVPMAVRVDARAKRLILRMDNHGKLTVTCP
FT                   GDRYVDAAIQMARSRTGWIADRLAELPEPAHLRPGVAVPVLGKERMITFSPSIQTGVVT
FT                   PDSVSVPAAVDNVGDVVVSTLAKELKRYCRNCADHWQDSLGVQYSRVRVRDMKTRWGSC
FT                   TARGDLTFNTRLVFAPPQVLDYVILHEMCHLRFLDHSPEFWSLVENHCQDYLVQEAWLK
FT                   SEGRSLFRYGAVGDVSLPPKRTSVTELPPPG"
FT   gene            complement(506355..508259)
FT                   /locus_tag="PB2503_02877"
FT   CDS_pept        complement(506355..508259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02877"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02877"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08652"
FT                   /db_xref="GOA:E0TCZ3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ3"
FT                   /protein_id="ADM08652.1"
FT                   /translation="MALRASSLLLPLIAVLLGASVIFLGELPPIDGLETARKQPRIVVL
FT                   DRRGDVIGIRGQDRGEPIDAATLPDHVKAAFLATEDRNFYHHIGINPVAITRAIVVNMR
FT                   AGTVQQGGSTITQQLVKNLLLTPERSMKRKVQEMILALRIEAAYTKDEILSFYLNAVYF
FT                   GNGAYGIEAAARRYFQKAPASLSVPEAALLAGLLKAPSRYAPTADKDRAIQRAKVVINA
FT                   MVETGAIDSDDAATYSFEGVASIEQADSPTAWAADAAIAELYGLVDEAKGRDLTIHTTI
FT                   DSELSRRTAAAQERLWATDSLLTDDVELAALILDENGAIRVMIGGRSYRSSAYNRATRA
FT                   NRQPGSVFKPVVYLTALEQGWRPDDKIADTPFTVDGYAPTNYSRRYSGIVTIEEAMRRS
FT                   LNVATVRLQEQIGRERVVETAQRLGLPARDVGPSLALGTLQAAPLDIASAYLPLSAGGQ
FT                   RAVPFMVTKATGAEDQLIYRRRPPRPMAAVVDKDDLVAFDHMMRAVVERGTGRAAAVPG
FT                   HYAAGKTGTSQDNRDGWFAGYASGRVGVVWIGRDDDRPVRGGGRALTGGGPPAKLWGEM
FT                   MTAALRGVPPRQPTPWVPETDGMRLFDHLTRILAGREEDLPRRRDGISALINRAEEAR"
FT   gene            508222..508509
FT                   /locus_tag="PB2503_02882"
FT   CDS_pept        508222..508509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02882"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02882"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08653"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ4"
FT                   /protein_id="ADM08653.1"
FT                   /translation="MSGSRRLDARRAIRLKGRLEGEDRLPLRRGVRAADFGLRRPDVPA
FT                   AVFFVAGFFGEEITRFEAALRVEPLRPFLRRAEDGDDPPLADAMLSSVPG"
FT   gene            complement(508759..509952)
FT                   /locus_tag="PB2503_02887"
FT   CDS_pept        complement(508759..509952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02887"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02887"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08654"
FT                   /db_xref="GOA:E0TCZ5"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ5"
FT                   /protein_id="ADM08654.1"
FT                   /translation="MKLKLAMLAATGAAALNIAAFAQEETGYYGALGAGYTFENEETTV
FT                   STDGAVRAGLTPFEFETDAEIEDAVNIYGAIGKYFPYAFRGELELSTRTQDVALVPGQA
FT                   GVFAGFPNSGDDLGDITVTTLMANLYKDFPIDAAGRLRPFVGVGVGAAYVEANIENTIG
FT                   SLPAVPSEPNSVSVDDEDYVPAVQGLAGLTLAFTEQLNVDLRYRYLWLSEGEFDGFVND
FT                   GGAALAYEYDAHEITAGLRWDFAPVAAAPAAPAPVQYKTCFDGSRIPVTQTCPPRPVDT
FT                   APEVTELEPLVVYFDYDKSNLTDAANTLIAARAEEAIDADVASVTVQGNTDTAGSASYN
FT                   QALSARRAKVVSDALVANGVDQSAITVEALGESNPAKPTGDGVREPLNRRTEVTFGF"
FT   gene            complement(510168..510254)
FT                   /locus_tag="PB2503_02892"
FT   CDS_pept        complement(510168..510254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02892"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02892"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08655"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ6"
FT                   /protein_id="ADM08655.1"
FT                   /translation="MGVCCLLVTFADLFAKDRHIFRITAFQY"
FT   gene            complement(510254..511105)
FT                   /locus_tag="PB2503_02897"
FT   CDS_pept        complement(510254..511105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02897"
FT                   /product="RNA polymerase sigma-70 factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02897"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08656"
FT                   /db_xref="GOA:E0TCZ7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ7"
FT                   /protein_id="ADM08656.1"
FT                   /translation="MVIDNDEYLKATIRQAMSAPLLSIEEERSLMRRWVDDQDERALGK
FT                   LTRAHMRMAVSTAIKFRGYGLPLADLIQEGAIGLLEAAKRFDPDREVRFCTYAGWWIRA
FT                   SMQDYILRNWSIVRVGSKSAHKTIFFNLSRIRSMIEDADTAPRTARIKAAERFNVSESD
FT                   IEFMTSRLGRRDQSLNAMLTDDGDIERQDLIPDEREGPDSLAEGTLDQARRKSWIGKAL
FT                   KTLSNRERMIIEHRFFTEEKMTLSRLGDDLSLSKERVRQIEKQAMGKLKACLAAEASEE
FT                   AI"
FT   gene            511212..511943
FT                   /locus_tag="PB2503_02902"
FT   CDS_pept        511212..511943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02902"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02902"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08657"
FT                   /db_xref="GOA:E0TCZ8"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ8"
FT                   /protein_id="ADM08657.1"
FT                   /translation="MYKMSQGEDPKAMMGVDPRVPSPHFHRYTFVTIKVGAMTGRTKKL
FT                   FGGAGISLVALTAAMALSDRSDATMTTAPTLDRGEVIVVDPQATASVMTPAAIDELSAP
FT                   ALTDRPALLPSDRHMRWALGAAFGALLGTAFAAFGAHRLLRWITEGRQTVGQLTQTAAR
FT                   HSRAIAKSASQTLGRSLKTPARRLAKGSGYLTLAAVTLLLLDLSWKASLTVGIGTLGVA
FT                   AIDRWSLQHRKRVHGKETGAT"
FT   gene            512218..512955
FT                   /locus_tag="PB2503_02907"
FT   CDS_pept        512218..512955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02907"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02907"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08658"
FT                   /db_xref="GOA:E0TCZ9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E0TCZ9"
FT                   /protein_id="ADM08658.1"
FT                   /translation="MRGKGEEEGVVLRRSAPYSMDMPTPLISPSILSADFAQLGQEVRA
FT                   ITEAGADMIHVDVMDGHFVPNITIGPSVVKALRPHSSLPFDVHLMIAPVDPYLEAFAKA
FT                   GASILSIHPEAGPHLHRSLQTIRQLGVKPGLALNPATPLETVTPVLDEIDLILVMSVNP
FT                   GFGGQKFIDGQLARIERLRRMVDATGRDITIEVDGGITPETARRVLDAGATALVAGTAV
FT                   FKDGPDSYRANIAALKAAGDVLA"
FT   gene            513176..514423
FT                   /locus_tag="PB2503_02912"
FT   CDS_pept        513176..514423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02912"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02912"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08659"
FT                   /db_xref="GOA:E0TD00"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD00"
FT                   /protein_id="ADM08659.1"
FT                   /translation="MVTAAKAGEDHLAATVGQWFHYYGTYEQTAWHPYLVARRSIALLR
FT                   HIEDLFVRMDNPGRAAVLDHLARSARHLARRTGYARGRRRNVTIASARTLLSLCLPPER
FT                   LIGQPGETGLAEALKPLTEGTLPFGWRSHTSLLDTGYTLLTVKESFRGRRLSPPGALDD
FT                   SLKTIRLLAGALLETTGGLRLPGQSAPSPSLLSALSPSDHSAADRLLTDLGMGRVTAGT
FT                   VKVLLDGGNHEDEETAIPGALSISADGQPLIVNCGAPSPIAAAFARRLRPWREALLAQA
FT                   AGSTLSDLPIEGTPSLIRPDPLTLLFDHKGRTARHARRIVLSPDGHDISGDDAIEAPAS
FT                   GTLRFHLAPEARVDREEDSLLIRIGRERWRFSGPSTIEIEESVSAWIDGTIVDSKQIVV
FT                   PLFPGHPVQWTLGRDR"
FT   gene            514463..516109
FT                   /locus_tag="PB2503_02917"
FT   CDS_pept        514463..516109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02917"
FT                   /product="AICARFT/IMPCHase bienzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02917"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08660"
FT                   /db_xref="GOA:E0TD01"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD01"
FT                   /protein_id="ADM08660.1"
FT                   /translation="MTARPIHAFLLPEIAPVTAPHDRRPFTRALISVSDKTGLVPIAEK
FT                   LVAAGIALLSTGGTARALREAGLDVTDVAEVTGFPEIMGGRVKTLHPRIHGGLLGDRAI
FT                   PSHREAMDAHGIADIDLLIVNLYPFEAALEAGKEPDALVEEIDIGGPAMIRAASKNHAH
FT                   LTVITDTEDYVLLEKALTAGGTTLAERRSLAATAFARTAAYDAAIAGWLEGEAHPADAA
FT                   PLPRRVSVAGTQILPLRYGENPHQRAALYRTAPPHRPGIVTARQHQGKALSYNNINDGD
FT                   AAIELVAEFEEPAVAIIKHANPCGVATGPSVTAAYERALACDPVSAFGGIVALNRPLDR
FT                   PTAERITEIFTEIVIAPGLEEGVEAVFAKKKNLRLLTLDAMPDPTAPRFLMKPVAGGFL
FT                   FGDADLRREDPALIRTVTEKSPSPQEMRDLLFAFTVAKHVKSNAIVYAKGGASVAIGAG
FT                   QMSRLDSTRIAVRKSQDAAEAMGASTPLVEGSVVASDAFFPFADGLIAAAEAGATAVIQ
FT                   PGGSIRDEEVIAAANARGLAMVFTGQRHFRH"
FT   gene            516242..517663
FT                   /locus_tag="PB2503_02922"
FT   CDS_pept        516242..517663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02922"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02922"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08661"
FT                   /db_xref="GOA:E0TD02"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD02"
FT                   /protein_id="ADM08661.1"
FT                   /translation="MTEEMTRELTFRQNVNMMFDRATTYLDIDEGLKHKIKICNSVYTV
FT                   RFGVKLRGSIHTFTGYRAVHSEHMEPVKGGIRYALSVNQDEVEALAALMTYKCALVRVP
FT                   FGGSKGGLCIDPTQWDADELERITRRFTYELAKRDLIHPSQNVPAPDMGTGEREMAWMA
FT                   DAYKRMHPTDIDAMACVTGKPPHAGGIRGRVEATGRGCQYALQSFFSFPEDVAACGLDG
FT                   GIEGKRVIVQGLGNVGYHAAKFLSEEDGAKIVGVIERDGAILHDDGIDIEEIKHFLTRN
FT                   GGIKGYPHGKYIEDGLSALTADCDILVPAAIEGVINGANAADIKARIILEAANGPVTAN
FT                   ADTILREKRVEVIPDLYTNAGGVTVSYFEWVKNLSHMRFGRMQRRAEEKRAMALITELE
FT                   RATGQPLNDQFKARFAQGDQEIDLVRSGLDDTMRTAYARMRQTRVTTKGIEDMRTAAYA
FT                   TALTDIAKSYESLGL"
FT   gene            517919..519637
FT                   /locus_tag="PB2503_02927"
FT   CDS_pept        517919..519637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02927"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02927"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08662"
FT                   /db_xref="GOA:E0TD03"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD03"
FT                   /protein_id="ADM08662.1"
FT                   /translation="MITRYLLSAALLCYPAAQAEEAIQRSSTGVVLPAAVSAQATLATE
FT                   NALAGAIETIVTDDTFRQALDDAWEAGAGEAVGLAYAEQLYRPIWTPSGARQFEAMFDD
FT                   MASHGIAARASDRRDLQQLVEQRFSGTSPKRQAIADVDLTIAWVDLLSHVSAGLGDEGQ
FT                   MASSATDRPVHSQLVKSVRDAGQGKIERSISPFIPSNPQYERLQETLKTYRQIEEDGGW
FT                   EALDVGPIVKPGDRHAVISPLRTRLAKEGFLDRQHDNGSPLLDRPLRSALIAAQAQHGI
FT                   DEDGVFGPETARALNEPVESKIARLADSLYRWRELGDLGDKYVWANIPSFRAEGWKNRR
FT                   KEISMRAIMGQPDRPTPTFSDKVDYIVANPKWYVPSSIMQRDKLPKLQRDPGYAARGEY
FT                   TVIDKTTGEAVSPYEVDWFADDVTARYRLVQGAGKGNALGRIKIIFPNQYSVYLHDTPT
FT                   KSLFDHATRAFSSGCVRLEHPQEMAEWIARTNGQEKVDQIEMALRDKETERVELSAELP
FT                   VHITYMTVTVDEAGTPTFWRDIYNKGQDEQLVAMEAPFFELSTGKVAKISTQKKG"
FT   gene            519654..520526
FT                   /locus_tag="PB2503_02932"
FT   CDS_pept        519654..520526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02932"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02932"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08663"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD04"
FT                   /protein_id="ADM08663.1"
FT                   /translation="MLSMVLPSLLILIGATGRTDMTTVGPLTIDGDVIPYETWHHTAMP
FT                   GERVAIGGTHTVINMDGERVASSFDAPTTPGHYAVTISRADAPPVDLSLFVLQPTDNMD
FT                   SRQFLNGYRIGTYPQTPPEGFIEVSAEDYDIAVSPRFKLGQFLCKQQPEHFPKYVLLSQ
FT                   PNLVRLETLLTALQEDGLTDTESFVVMSGFRTPFYNTAIGSARLSRHMYGDASDIYIDV
FT                   APADGVMDDLNRDGQLTKADANFLYDYAADLFANSNVDAGGIGAYGTNAVHGPFVHIDG
FT                   RGRPARWGR"
FT   gene            complement(520556..521806)
FT                   /locus_tag="PB2503_02937"
FT   CDS_pept        complement(520556..521806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02937"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02937"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08664"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD05"
FT                   /protein_id="ADM08664.1"
FT                   /translation="MPQPVPEPEAEISLPEAPQDDLVRVAVLLPFSNESQNIETIAAAM
FT                   LKAAQMVAFESDDDRYVLIPKDTRGTAAGAAEMTEEAIAAGADIILGPLFSESVAATAD
FT                   IARPAGVPVIAFSSDSEVAGQGVYLLSFPPEAEIDRVASYAMSKGYARFGLMAPYSEFG
FT                   DRVAKAFSADVYALGGDIVHTERYERSADAMIAPAKRMAQYAAKNFVPSYPEPRAVTGQ
FT                   ARFVSGAESMMRGQLNEPSTGMAPIVSGGSGGQYQAVLLPEQGRLLRALAPLFPYYNVN
FT                   IREVKLLGVSGWNNPLLTREPALNGGWFAAPDPALAEGFKRRYERAYGEQPPRLASLAY
FT                   DAALLTSRLSVLPVEERFTVETIANPNGYLGADGLFRLRPDGMVERGLAVLEIRPSGII
FT                   VIDDAPQSFVMTSPVGY"
FT   gene            522131..523009
FT                   /locus_tag="PB2503_02942"
FT   CDS_pept        522131..523009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02942"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02942"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08665"
FT                   /db_xref="GOA:E0TD06"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD06"
FT                   /protein_id="ADM08665.1"
FT                   /translation="MASSPPDRPPPRAATARLLAPGLYVAATPIGHLGDISQRLRETLA
FT                   SADLILCEDTRVAGRLLQAMAIDGVPLRRYDDHTGEQVRPLVLSRLAAGEALVLISDAG
FT                   TPLISDPGYKLVRAARDAGAAVMTVPGPCAAIAALSIAGVPTDSFTFRGFPPAKAGARQ
FT                   RLIDRLAATEETQIFYETGPRLAGFLTEIAARLGDDCPVVIARELTKRYEEVVDGAAAA
FT                   LAKRYADAPPKGEIVVILPPQPPIEITEEEVEARMAKALQSLSLKDAAAEVAAATGRKR
FT                   RDLYQAWRDRT"
FT   gene            522991..523431
FT                   /locus_tag="PB2503_02947"
FT   CDS_pept        522991..523431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02947"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02947"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08666"
FT                   /db_xref="GOA:E0TD07"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD07"
FT                   /protein_id="ADM08666.1"
FT                   /translation="MAGSDVSARQSAKRQSAEYLAAERLGRRAERRAALFLQLKGYAIR
FT                   DRRVRTPRGEIDLIVTKGSTLAFIEVKARTSADALQDPATLVPPQNWARIAAASAIWRA
FT                   RASLMPKIVRFDLILVRRGIPCHVKDAYRPDAPTGRDGAGLF"
FT   gene            523524..524075
FT                   /locus_tag="PB2503_02952"
FT   CDS_pept        523524..524075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02952"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02952"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08667"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD08"
FT                   /protein_id="ADM08667.1"
FT                   /translation="MPTRLLILVALLSALVAGCETNRTLGTSIDDTGIDLQLKRALLAD
FT                   RTYDTSDIDISVFEGRVMLTGTVRTAEARRELGLKTRSLPGVIEVLNEVRVGAPTTAGQ
FT                   GLRDAVMDEKLGAAMRADNAIYRTNYQIAVSQGTIYLLGVAQGPVELERVTGHAQTIDG
FT                   ANEIISHVIFVGDPRRPGVR"
FT   gene            524159..525718
FT                   /locus_tag="PB2503_02957"
FT   CDS_pept        524159..525718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02957"
FT                   /product="ComM protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02957"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08668"
FT                   /db_xref="GOA:E0TD09"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD09"
FT                   /protein_id="ADM08668.1"
FT                   /translation="MVTEVTSFAFDGIEARPVTVQAQITGGNPKFFIVGMAEKSVSEAR
FT                   ERIWAAFSAIGLGVPPKRITINLAPADLRKEGSHFDLPIALALMAEMGAIARDALVGWA
FT                   VTGELGLDGSLAPITGALPAAMAANARELGLICPAASGAEAAWAGEETGILAPATLLEL
FT                   ANHFKGTAVLDRPRPGALREPEDAPDLKDVKGQETGKRALEIAAAGGHNLLMVGPPGSG
FT                   KSMLAARLPGILPPLSAREMLDISMIHSVAGMIENGTLTRERPFRAPHHSASMAAMVGG
FT                   GTRAKPGEASLAHHGVLFLDELPEFSAPVLDSLRQPLETGDVRIARANAHVRYPAAFQL
FT                   VAAMNPCRCGYGRASGRACGRGPHCETTYQARISGPFLDRMDLTIETQPVSALDLTRPG
FT                   DGDPSAVVAQRVAAARAAQAARQPEGPFLLNARLSPAALDRVATPDAAGQALLTRACES
FT                   LGLSARAYGRLLRVARTLADLDGKEAVSRPHIAEALSLRGRQAMQAMGPPPLREAVSHQ
FT                   ES"
FT   gene            525815..527770
FT                   /locus_tag="PB2503_02962"
FT   CDS_pept        525815..527770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02962"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02962"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08669"
FT                   /db_xref="GOA:E0TD10"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD10"
FT                   /protein_id="ADM08669.1"
FT                   /translation="MRSALAVLDRITLFAVLTDRNGVIRFRNKVSAGIGGLRTGQIFTE
FT                   EQLPPTIRCIRTTDQDRFTTSVIVNNDNRLIEWNPSRFTDGETLYLGTDVTRDRKNYAV
FT                   MRELARTARAVSEEKMRYLATMSHEMRTPLNGILGMNGLLLDSPLDVNQRAYAEAVQQA
FT                   GTALLTLINDVLDYSKIQAGHLDLEEKPFSPGALLKEVAEILAIRADEKGIDIALLLHP
FT                   DIPEELVGDPARLRQVLVNLATNGVKFTTEGGVSLEILPGTGSTDDDLIDHRRYSFRVR
FT                   DTGKGIAADNLDRLFEEFDQGSDPSAEEGTGLGLTIARQLVNAMGGNIDVTSALGKGST
FT                   FEFDIALKGQAPTAVQIVENPARTVVVASPSAFLRAALTTTLQYLGINRLHTAQDEREA
FT                   ISLLSDHPDAILLCDLPLAESSGSILTKGTQHAIVLLSQRTRGRFDSFAKNGFADFLVK
FT                   PVFPAQLRRRLETIGRPAISAAEEPVASASASGEGVNGDDQPPSEAAPSSAPASSASQK
FT                   PLNILLAEDNSINAVLAETILRRDGHQVDLVRNGKEAVEAVDLSVYDLILMDMRMPVMD
FT                   GIEATVRIRQMPTGEVLPIIALTANATTADRQACLEAGMNDFLSKPFEPKSLSDIVNRW
FT                   RSPPPSPSKTATAGRS"
FT   gene            complement(527765..528895)
FT                   /locus_tag="PB2503_02967"
FT   CDS_pept        complement(527765..528895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02967"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02967"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08670"
FT                   /db_xref="GOA:E0TD11"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD11"
FT                   /protein_id="ADM08670.1"
FT                   /translation="MTPPTGLYLHWPFCDRICPYCDFVVARGRDVDEKAWISAFLADLD
FT                   DSAARWGRRQIVSVYFGGGTPSLLSPHGLNRLLGGIADRYDLASSAEVTIEVNPTALEA
FT                   QRLRAYRALGINRVSIGVQSFDDEHLRFLGRNHDGGTARGVIDQAAALFDRVTADFIYA
FT                   LPGETIEDWTRRLRAILSLPVSHLSLYQLTIEQGTAFGLQVDKGRWTPASDAMAADLYQ
FT                   ATLEETMAAGMPAYEISSHARPGHEAVHNRLYWMEGDWIGIGPGAHGRITHQGQRIATA
FT                   PRVPIRAYCSTPPADRVERAPLTPSEMRVERLAGGLRTLDGVATSDLSFLPPERLEDFL
FT                   REGWLIPRADRMTIPRTHWILADGLIARLCDAMEDL"
FT   gene            complement(528892..529512)
FT                   /locus_tag="PB2503_02972"
FT   CDS_pept        complement(528892..529512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02972"
FT                   /product="putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02972"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08671"
FT                   /db_xref="GOA:E0TD12"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD12"
FT                   /protein_id="ADM08671.1"
FT                   /translation="MTVINVLRARGLLLATHNQGKVREFSAWLAPYAISISSAADHDLP
FT                   EPEETATDFLGNATLKAEAAMAATGLPALADDSGLAVAALGGAPGLYSARWAGPDRDYQ
FT                   RAFDRIAAELGGAQAMEGAAAAFVCVLVLTLPGDTPLVAEGQVEGTLTASPRGAAGFGY
FT                   DPIFRPEGEARTFAEMTMAEKAQFSHRARAMTNLAQVINVPAP"
FT   gene            529663..530811
FT                   /locus_tag="PB2503_02977"
FT   CDS_pept        529663..530811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02977"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08672"
FT                   /db_xref="GOA:E0TD13"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD13"
FT                   /protein_id="ADM08672.1"
FT                   /translation="MTTLISTLPEAAAPQRRRLFGLSRAALQSLFAADLGLAPKAAKMR
FT                   ASQVWQWIYSHGVREFDQMTNIGKALRAQMDALYDLSRPEVAERQVSQDGTRKYLIRFA
FT                   PGIEAEAVFIPGVGRAGALCVSSQVGCTLNCTFCHTGTQALVRNLTAEEIIAQIIVCKD
FT                   DLGEWPSSRDDRQLSNIVFMGMGEPLYNLDAVAQAIDIIADGEGISISRRRITVSTSGV
FT                   VSQMRALGERTEAMLAISLHATHDALRNELVPINKKWPLDALLAACRDYPGTSNAKRIT
FT                   FEYVMLKGINDSDAEARELVRLLRGIPAKINLIPFNPWPDSPYECSSWDRIERFADIVN
FT                   QAGYASPIRTPRGRDISAACGQLKSESVKERASARRRTETVS"
FT   gene            530923..531309
FT                   /locus_tag="PB2503_02982"
FT   CDS_pept        530923..531309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02982"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02982"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08673"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD14"
FT                   /protein_id="ADM08673.1"
FT                   /translation="MMGRTESVFAVFFILVVGALVAVALVRNGDAREMASYRPLGADTA
FT                   TTTFGTGGIQFSGNVERDLCTCYRQAYAYGSAYQGSKGLERIEYQGGFRYCSTELGAEG
FT                   GEFWSQGWFKGVSGERPDRSCRSL"
FT   gene            531615..532313
FT                   /locus_tag="PB2503_02987"
FT   CDS_pept        531615..532313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02987"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02987"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08674"
FT                   /db_xref="GOA:E0TD15"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD15"
FT                   /protein_id="ADM08674.1"
FT                   /translation="MKFSPLRIGIAIFGAVAFFAMENDPQEVSSNLCKWTIELAAVEQC
FT                   PAWMNNPDWLLLFRCALGIVGLCLIWPLIPRGLAQLYDAWLFLTRGLFAIRKGARRVVV
FT                   ATMEKIKDEPVLVDENRAVKIIERSQWARYRNDMGKKPKSVADFFADEYAFSRVDNPRS
FT                   NAEHSIFWSWCERVLKESFTRAATDEHDDNYRGGMVTTDEGEKLFSERILLKWLDDKWT
FT                   AEMLDRFGKI"
FT   gene            complement(532434..532760)
FT                   /locus_tag="PB2503_02992"
FT   CDS_pept        complement(532434..532760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02992"
FT                   /product="ISSpo3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02992"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08675"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD16"
FT                   /protein_id="ADM08675.1"
FT                   /translation="MVMAEKGGNVVTRVLEDRKQDKLFDAIEDKIKTGSTIHTDELRAY
FT                   IALRDNPNYIHKSVNHSGGEYVAKCGATTNELEGFWNLFKAAYRGTYVCPCVEEVSSPI
FT                   LWQV"
FT   gene            complement(532800..532991)
FT                   /locus_tag="PB2503_02997"
FT   CDS_pept        complement(532800..532991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_02997"
FT                   /product="ISSpo3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_02997"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08676"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD17"
FT                   /protein_id="ADM08676.1"
FT                   /translation="MHLFSASRNGVSAKEVERQIGVTYKTAWCMCKLILAYMTAVDGDD
FT                   SIGGDGKSVQVDETFVGG"
FT   gene            complement(533292..534326)
FT                   /locus_tag="PB2503_03002"
FT   CDS_pept        complement(533292..534326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03002"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03002"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08677"
FT                   /db_xref="GOA:E0TD18"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD18"
FT                   /protein_id="ADM08677.1"
FT                   /translation="MMTNADPFRRLFVQGAGSWGTALALLGLQTGAEVVLWTRREDHAA
FT                   AMRGDRENQRYLPGVSLPPALTITADRGAIAGCDAVLSVVPAQFAGGELAALREASGAA
FT                   ALPVALCSKGIEAETRRLMPEVLKAAWPEAAPAMLSGPSFAADVAKGLPTAVTLADADR
FT                   DRGERWLATLGTLTFRPYWSADLTGVAIGGAVKNVLAVACGVVEGQGLGESARAALMAR
FT                   GFAEAARFAVALGAKVETLRGLSGLGDMILTCVSPQSRNYSLGVALGQGETAADILSKR
FT                   HTVAEGAKTAPVLTALAREHGVEMPVAEAVAALVAGDIEVDDVVDSLLSRPLRPESPLL
FT                   RDKT"
FT   gene            complement(534323..535435)
FT                   /locus_tag="PB2503_03007"
FT   CDS_pept        complement(534323..535435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03007"
FT                   /product="Glycoprotease (M22) metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03007"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08678"
FT                   /db_xref="GOA:E0TD19"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD19"
FT                   /protein_id="ADM08678.1"
FT                   /translation="MTMQAASGPLVLGIESSCDDTAAAVVRAGPPGQVEILSSIVVGQE
FT                   KAHAPYGGVVPEIAARAHAAKLPSVVATALREARVELGELDLIAATAGPGLIGGVVSGL
FT                   TFAKGLALATGVPLVPVNHLAGHAVSVALEHPIAFPYLLLLVSGGHSQILLVRGAADFL
FT                   RLGTTIDDAAGEAFDKTAKLLGLPGMGGPAVEAAARGGDPGAYALPQPLAGRPGCDFSF
FT                   SGLKTAIRQCVVAAGELTETQRADLAAAFQAAAVGHLTKRTHRGLLAARALAPEVTHLV
FT                   AAGGVAANQALRRALEGVAEQEGWTLVVPSLRYCTDNAAMIALAGAYQLEAVGAGMIDD
FT                   TLTSVPRSRWPLDMAATGPVVGTGKRGRKV"
FT   gene            535461..536435
FT                   /locus_tag="PB2503_03012"
FT   CDS_pept        535461..536435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03012"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03012"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08679"
FT                   /db_xref="GOA:E0TD20"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD20"
FT                   /protein_id="ADM08679.1"
FT                   /translation="MSFKPLRIASRRSPLAVAQALWVRDRLAEALGIDEVDRDAAFPHE
FT                   TFVTTGDRMLNPTLADIGGKGLFTKEIEIALLDGQADIAVHSMKDMPAQMPPGLVLAAV
FT                   PVREDPRDAFVTLDGRPLDQMPAGARIGTSSTRRRAQLARLRPDLALVPMRGNVGTRLQ
FT                   KLAAGEAEGTFLAEAGLRRLGMTDVKREALSPARMLPALGQGALCVQARSGDHETLSAC
FT                   AHINNRPTALAAAAERALISGLDGSCKTPIGGLARQTGDSLILEGQILTPDGRRVLRGE
FT                   RTVAIGGMTWEAVLDSARAAGADLAAYMRAEAGADLAAMLGDQ"
FT   gene            536432..537145
FT                   /locus_tag="PB2503_03017"
FT   CDS_pept        536432..537145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03017"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08680"
FT                   /db_xref="GOA:E0TD21"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD21"
FT                   /protein_id="ADM08680.1"
FT                   /translation="MTVFVTRPEPDATRTVAALASAELKAIPTPLLDIVIADAAAPPLA
FT                   KGEALVFTSRNGVRAWSATGGALTAPAYAVGTATAEAASEIGLTVADIGGGDVDTLLPV
FT                   LMAAPATGFLHIRGRHSRGQLVERLAATGRPARGIPLYEAKAATVLPAPLLDALRAGET
FT                   PHGPCRIALFSPRTATILLRLLDDCLGRISVPAQIFCLSPAVAAALDKDRFAQVVIASE
FT                   PTLPAFIDSLRSGST"
FT   gene            537218..539086
FT                   /locus_tag="PB2503_03022"
FT   CDS_pept        537218..539086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03022"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08681"
FT                   /db_xref="GOA:E0TD22"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD22"
FT                   /protein_id="ADM08681.1"
FT                   /translation="MSSTNPPSDNNDPNKPEEPKKPEESVDASSAETPKTDEAIDAEIV
FT                   DETARVEERASGEATTEEAEVLDDGEAAGETSAEAPVEDGTSRAGTFGILVGAIVVVAG
FT                   LVYFLNRDGGGTPTQAEGEQTLFAEGAGEIASPIVRDPVGRDNVGDENDAESAAPETAM
FT                   TEAENTADTAPAPEQDAAEETASAAEEAPSEDPAAASATESEATTEDEGAEAVTAEADS
FT                   GADETPTETDAVADDQDMAQQTPAEEESPAAAAPEGDDARQSSLVALAAERNRARREAM
FT                   EEEAGAEDEAPATEMAAAEDEAAEMAATEDAATDAAAEAAAEADADADQAEPSAETEAQ
FT                   SVQAPATEAPSAENTAQETTQEMAAEDQSTNQPQSAAPTEAPAQPQLAERAPGGPNLED
FT                   IKSDVLAQTEQVIDRKLARTEQEVRQLREEQQQSNERLAELNDRIETITSTDLTAARQS
FT                   TLLLALSDLDDGINSGETFVRQLETINQIAPDMNFPRELSDFAATGLPTQAELMASYQL
FT                   AARQALSGVKREEADGPIARFSANLSSLFTVRKVGDIPGDTPSAIIARAESRLEANDLD
FT                   AAIDELDALEGEAAEAFDSWIDAAEAKAAARQEIRAMQQRIASQAG"
FT   gene            539135..540673
FT                   /locus_tag="PB2503_03027"
FT   CDS_pept        539135..540673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03027"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08682"
FT                   /db_xref="GOA:E0TD23"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD23"
FT                   /protein_id="ADM08682.1"
FT                   /translation="MIRILVFLTIIAVLAAAITGLASVEGFAVIRFGDTNITARSSVLF
FT                   GAALIGAVLLICATLILSGIVRLPSSIRRQRAERRRERGLIALTRGLEAVAAGDASDAQ
FT                   RLARTAQKQLGQQGNEAGLSRLLTAQAAQLAGDEETAQQSFAAMLQAPETEFLGLRGLY
FT                   LQAMASGDRKEARQYAERAFKLRPGASWAFQSVYALQLERGAWGEARDALLKAQQHGLE
FT                   KGEPSRRREAALLTAMAYGAEAAEDTDTAIKEAEEALRKAPGFAPAAVLAAELETKAGR
FT                   RSRAGKLLDEAWAISPHPALAKTMDEIYAKEKLERRTDRLIALANKRPEADESQLLIAE
FT                   QENRLGKFTEAKARLEPLLTRNPRARTFSAMAAAVRGLYGSEAAQIWLDRAANAPLDPV
FT                   PGADGSFVFTTDGWQRLIREFGDHGRLAPPPLDVIRTSLTLEEVKLLSAPASLDTVQEV
FT                   AADETATSAPSTPATGEGLMDQLSKDKGLAPEGQPEEPSNDKPGQRKTDDPAKA"
FT   gene            complement(540961..541290)
FT                   /locus_tag="PB2503_03032"
FT   CDS_pept        complement(540961..541290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03032"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03032"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08683"
FT                   /db_xref="GOA:E0TD24"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD24"
FT                   /protein_id="ADM08683.1"
FT                   /translation="MATKTVTDASFEQDVLKGTGLVLVDFWATWCGPCRQIAPALEEIA
FT                   DEMGDDLTVAKLDIDENPTTMMQYGVRGVPTLMLFKEGQLVSTKVGADAKGAILAWVKE
FT                   TASAA"
FT   gene            complement(541380..544880)
FT                   /locus_tag="PB2503_03037"
FT   CDS_pept        complement(541380..544880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03037"
FT                   /product="helicase, UvrD/Rep family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03037"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08684"
FT                   /db_xref="GOA:E0TD25"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD25"
FT                   /protein_id="ADM08684.1"
FT                   /translation="MGRDGWVGGWRGGGMTNSALDPLAETTAIQQTVSDPRRSAWLSAN
FT                   AGSGKTHVLIGRVIRLLTDLADGGREIDPSSILCLTFTNAAAAEMKNRLFDILGEWSLL
FT                   SDEALSDALTTRFGRSPAAPSLMRTRRLFARALDTPGGLRVQTIHAFCESLLRQFPLEA
FT                   GVMPGFSVLDDAEYAALIHRCRWQALRALQAEGFAGDHLTVQEKFSQESAVMKALAGIE
FT                   ASDLMPTEDLIEQLGEGGDSDVDDIKRHCLQTLDREFVRQFSRIAPDIAKGAKERTFRA
FT                   REALSAWEADDPSAFDHLCSAFLKADGQRPADKTMAGNKDIRGILPSVAAEWAELATAL
FT                   EAARHRITACAIIRTHAATERLLRRTTDFCRAEKARRGLLDYDDLVASAASLLTRTDHA
FT                   WLQFKLSHGLHHLLVDETQDTGPSQWSVLNPLRQALLAHNGEVPKTVFFVGDRKQSIYA
FT                   FQGADADLFERERAETETLASRDHFVSRQLFLSFRSSQAILDVVDESFTPEEARRGLSD
FT                   DAPIRHVAAKPDLPGKVELWPLERRDETLTEDPWSAPVDAVRPEHPTRKLAKRLAADIK
FT                   KRVGRDDCILKNGDKRPLAYRDILLLCQTRGPIFHEVLRALSEAAIPTAGADRLPLMED
FT                   IAVRDLLSALRFAVNHEDDLSLAELLKSPLVGIDDDLLFALAHGRDQGVTLWSRVREAA
FT                   GSDDRLAAAVAMIEEAEGTGHASGPFALLSSYLDGGQPSGWLRFHRRLGLGVDLALEEL
FT                   LTDAIAFEQAEPRSLVGFVHYLERSLSDGRIIKRDSEDTEDVVRVMTVHGAKGREAHTV
FT                   YLIDANKPSELKADFIKGDGGKLICPPSGVSHPLLDLAKEKAKAREREEYRRRLYVGMT
FT                   RAEQRLVITGTAGTSKDDPEAVAEAKPPAEASWYGLVAQAMTRLGERVERQSSPGEAPL
FT                   RVLSVASSRDRRVQPDKARQSAASAIPNWLFRAADREVEERTLAPSHAVDQDQGRSIST
FT                   IGPLAMVEGQGARRRGILLHGLFERLPPLAPAQRRPLGARYLACHGGDIPAEERARWLE
FT                   EVLGILENEAFAEVFSPAAKTEMAIAGRLGNRRISGQIDRLVLREEEVVFVDFKTHRPP
FT                   PRRVEDVESATLSQMALYHMLLRQRFPGRRVTGALLWTYTAQLMPLPEAVLLSALEKAL
FT                   "
FT   gene            complement(544835..547882)
FT                   /locus_tag="PB2503_03042"
FT   CDS_pept        complement(544835..547882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03042"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08685"
FT                   /db_xref="GOA:E0TD26"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD26"
FT                   /protein_id="ADM08685.1"
FT                   /translation="MTAKSDTWLTHRLRADPAIFTIPQGVPFLEALVAPLMRAFEGDPA
FT                   GLADLTIYLPNRRAARRLIDHLAASAPTGTVILPQLRVLGDITEDDLMFSAPDMVADEE
FT                   VPLAVDPMDRRLILAHLLAQRKAAEGDTAAPARMSAAASPDWPSLLAGADALASVLDSF
FT                   HREALPLSALLSMTPEDLAGRAADHWHEHLRFLSILAEAWPAILSKQGCIELSDRQTRL
FT                   MTALADHLSATPDGPPILIAGALGATEATAHLMESVAKSPRGAVILPGAMPMAADQSTL
FT                   LPPSHPQAAFQRWLRRVGGGASVDLSPWDERMTDRKQATRAFLSLALTPAEETGDWHRR
FT                   FADFRDAYSLDEALAPLSFATAGTPNEEADFVALLLREVLETEGKTALLVTPDRDLARR
FT                   VCAKLRQWDIRLDDSGGTPLYGAYRGTYIRQWAHWLGAPDDPVALAALVAHGLFLRGLT
FT                   RSDKERLARRVDRRLRGMRPRDWQDTQRRLAGEGPSPLETELLQDLDAALRAFQAATTQ
FT                   HERLRALIEIADRFARSADGDQLLWQDQDGEALAAQLSAMMQTAFLPDCPPAAFASLFE
FT                   ALLGSAVIRTYGTHPRLTVLGLVEARLQSADRVILAGLTEGTWPKLTTADPFLPHNVRL
FT                   ALGLPTHDAEVGRSALDFVDHALGEEVILIRSEKSDRGPALPSRWLTRLYNLIEAAKQT
FT                   EATDITGRLRGWVGALRHPASVDPALPPMPRPAAALLPARLSVSDIGQLIRDPYSVYAR
FT                   RLLRLFPLDPLAQEPAERERGTLFHAVYERLAKVAPDRVTQEVFAHALAETIDDCLYPS
FT                   ECHDLYAMMGQRAGKAFSVISQTQRRDGATATFAEIEGELTVMAGGRSIDLYGRADRID
FT                   LYPDGTYTIIDYKGGSAPTFKQDASFEPQLSVLAMMAAAGGFKDLRRGQVRRLAYTPML
FT                   RKEAWSVPFTEEKVPWMVAGEDLKAHLLETAQNLNRMMTEFVSGQFVFHSQLRPFKSNS
FT                   EGDYDHLARRREWAGMDGSADGGGEA"
FT   gene            complement(547879..548586)
FT                   /locus_tag="PB2503_03047"
FT   CDS_pept        complement(547879..548586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03047"
FT                   /product="nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03047"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08686"
FT                   /db_xref="GOA:E0TD27"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD27"
FT                   /protein_id="ADM08686.1"
FT                   /translation="MIDTAMVLAAGLGTRFREVAGDRPKPLVPVAGRPLLDWVLAMLDD
FT                   GGVKRAVVNIHYQPEMMRAHLQGIEVPKVDISDETTALMETGGGLMKATPLLGEGPVFC
FT                   TNTDAIMPFEGGRPVEALRSAWHDERMDALLLLIPLGQTSGYKGSGDFTLDTDGRLSWS
FT                   GPGERFVYSGLQIIHPRLWSGLRPEAQSTTVFWNQAMAAGRLCGLVYDGRWMHIGDRPG
FT                   FDRAVEELEGHAA"
FT   gene            complement(548583..549674)
FT                   /locus_tag="PB2503_03052"
FT   CDS_pept        complement(548583..549674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03052"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08687"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD28"
FT                   /protein_id="ADM08687.1"
FT                   /translation="MSLVRKETGIDRSAQLAAFVEGAGWQGDVTAPLRADASTRRYIRL
FT                   TGGAAPALLMDAPPRAEAPACPPSASEADRRALGYNALARLAGPRLEAFTSIAAYLNAH
FT                   GVRAPQVFAADPDLGAAIVEDFGDTLLVHAATDSVAEARLYRAALSTLRPLRQVDLAPC
FT                   QVGTWPLQTYDALAMATEARLLPEWYADYRGVELSRDALAAWDEAIADLLAGLSPPKKL
FT                   VLRDFHAENVLVPEDGRLAVIDFQDALIGHAAYDVASLIEDARRDLDPGLGAELLAEEA
FT                   RHIETPDVFLSDYAILTTQRNAKILGIFARLIRRDGKAQYRQFFPRVEAHFAKDLRRDA
FT                   VAPLRRWAEIYMPALLTPSGAET"
FT   gene            complement(549658..550125)
FT                   /locus_tag="PB2503_03057"
FT   CDS_pept        complement(549658..550125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03057"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08688"
FT                   /db_xref="GOA:E0TD29"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD29"
FT                   /protein_id="ADM08688.1"
FT                   /translation="MAFLSFLSSCPKATETFGRRLGQVLRPGDVVSLAAEMGAGKTVLA
FT                   AGVVRSLMGEDIDVSSPTFTIIHDYPGSPPVKHADLYRLAEPDEILELGLFDDDAAIVL
FT                   VEWAEKGAAFLPPGYLEVGIHLVPEGRMIALSGDREWQERLTGRGIDEPCS"
FT   gene            550221..550553
FT                   /locus_tag="PB2503_03062"
FT   CDS_pept        550221..550553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03062"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03062"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08689"
FT                   /db_xref="GOA:E0TD30"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD30"
FT                   /protein_id="ADM08689.1"
FT                   /translation="MAKHMVKVTYIEHDGKEHEIDGDDGLTVMEVAVKNSVPGIDADCG
FT                   GACACATCHVYVDPSFSEKVGAPNDMEDSMLDFASDRRENSRLSCQIKLDAELEGLVVR
FT                   LPKFQG"
FT   gene            550721..551134
FT                   /locus_tag="PB2503_03067"
FT   CDS_pept        550721..551134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03067"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08690"
FT                   /db_xref="GOA:E0TD31"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD31"
FT                   /protein_id="ADM08690.1"
FT                   /translation="MTEDVTRGAARVMMEGGYAILTEMRLPNGLRADLMAIGPRGEIAI
FT                   IEVKSCQADFDADSKWQGYRDYADLFYFAVPEDFPQDLLLPSAEGLIVADRFGGAILRP
FT                   PIKRKLAAARRKALTLSFARRAALRQWPDVPSP"
FT   gene            complement(551375..552070)
FT                   /locus_tag="PB2503_03072"
FT   CDS_pept        complement(551375..552070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03072"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08691"
FT                   /db_xref="GOA:E0TD32"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD32"
FT                   /protein_id="ADM08691.1"
FT                   /translation="MPLSALLFDCDGVLVDSEIVGLADAAMFLQSRGFSWSAQEVITRF
FT                   TGMRSDLFVANLRESYAAILGRSPDEAELADLVSGLLETRRAQLHTMTLVAGATMAVRT
FT                   AGEVFAGRIAVASSSGKAQLADKMSRFGLAGHFGPHIYSADDVERGKPYPDIFLHAAAA
FT                   LGVAPATTLIIEDSVNGVLAARRAGAEVWGFVGGGHCAADHAQQLTESGASRIVADHDD
FT                   LATQLRELS"
FT   gene            complement(552200..554917)
FT                   /locus_tag="PB2503_03077"
FT   CDS_pept        complement(552200..554917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03077"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08692"
FT                   /db_xref="GOA:E0TD33"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD33"
FT                   /protein_id="ADM08692.1"
FT                   /translation="MIFSKRRASTVLTACLASGLGASPNAIAVAQQADDVVVVTGTFIR
FT                   RQDQSNLPSPLESVGAGDIEDVGAVNVSDITETLTINTGAENNPDAFTQNQTTGTSSIN
FT                   LRGLGLASTLVLLDGHRQVTTAAQSNDGVSFVDTASLVPLIAIERIEILKDGASALYGS
FT                   DAVAGVVNFITRENYDGVLGSVNYLAHPQGGSYDETLVQGLFGKTFDTASVLGAVSYTR
FT                   RNALTTEERRLSRVGMDDVSVIGNPGAFLAAPPTDPLGAAPAGAPVIDPTGCAEVGGVP
FT                   LPASPTAPPPSSGIGFCGFDFGDYYSLVPEEEKLLFFGKAEFDVTDTIHFQAEVGYADN
FT                   EATRNNSPTFPYLLTPIVPASNPFNVFAQDAVFIGRVLGNGGEAATNGFDSETFRTSLT
FT                   LTGDAFRNGYWEMSYVYGQNEHVLMTPDVIADRFQCSLFGFDATTAALYGITSCGAVAT
FT                   DAAAAGVAGETFNPFATSFTVAPNSDELVDFLIGTQVRETKSELNVINALVSTDLAELA
FT                   AGPVSIAIGTQYRKEELEGNFDEISLNDGFGFLIGEQPYSGTQNILAVFGELSVPVTDM
FT                   LDLQFALRFEDYEDIGSTTDPKVAALFRPNDWLSLRASYSTSFRAPSTFQLQGQSTSLE
FT                   QVSDPANGGATAFAAVRTLGNEDLKPEESDAFNIGFSLRPASGLELDVDYFNFDFTDVI
FT                   VQENPQSLLLNDPLDPAIIRGPGGNVQQIFTDFVNASSLKTSGVDVSASYPIDIREGTL
FT                   TPTFTGTYLLEYELEDPTLPGGSGTIDGAGRRNFNNFGTSAPEIRFNAGLLWESGPHAA
FT                   NVFARYIDEYVDDEDEFADTPVLRDIDSQTRVDIQYSLQLGELMERAKMTRFTAGVRNL
FT                   LDEEPPQVFTNGGYDSKVHDPRGRMLYLAVDHEF"
FT   gene            555329..555922
FT                   /locus_tag="PB2503_03082"
FT   CDS_pept        555329..555922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03082"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08693"
FT                   /db_xref="InterPro:IPR008325"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD34"
FT                   /protein_id="ADM08693.1"
FT                   /translation="MLPRLLLAAVAPLALVACQTAPTNDVERVETKRDLQYPTYARGTV
FT                   VSEAENFFGQSSAELAELLADIFEDEGQPQAYIAGEEIGGAVGVGVTYGRGQLYRPGQP
FT                   PLPIYWRGPSLGFDLGADASKVFTLVYDLGPTANLFQRFPGGEGAAYFIGGIGAEALTD
FT                   GTTTIVPIRTGIGARTGVNIGYMHFSNKRSWIPL"
FT   gene            complement(555997..556527)
FT                   /locus_tag="PB2503_03087"
FT   CDS_pept        complement(555997..556527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03087"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03087"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08694"
FT                   /db_xref="GOA:E0TD35"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD35"
FT                   /protein_id="ADM08694.1"
FT                   /translation="MDITKIAAGKDVPKDINVIIEVPLGGEPIKYEIDKDSGAMMVDRF
FT                   LYTSMRYPCNYGFVPHTLSGDGDPVDVMCLGQRPLVPGAVLRARPIGVLLMEDEAGVDE
FT                   KILAAPHQKLTRFYDNIETYEDVQPILLERIWHFFEHYKDLEPNKFVKVREWQSKEMAE
FT                   QLISQGLENAKKG"
FT   gene            556607..558235
FT                   /locus_tag="PB2503_03092"
FT   CDS_pept        556607..558235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03092"
FT                   /product="alpha amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03092"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08695"
FT                   /db_xref="GOA:E0TD36"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD36"
FT                   /protein_id="ADM08695.1"
FT                   /translation="MAAVAENWWRGGVIYHIYPRSFLDTNGDGIGDLPGILRRLDYVAS
FT                   LGVDAVWLSPFFTSPMRDFGYDVSNYRDVDPMFGTLEDFIALLEAAHERDLKIIIDQVY
FT                   SHTSEDHPWFRESRVNRVNPRADWYVWADAKPDGTPPTNWQSVFGGPSWQWEGRRKQYY
FT                   MHNFLSSQPDLNLHNPEVQDALLEVARFWLELGVDGFRLDAINFAMHDLELKDNPPSEW
FT                   PPEWVTRPFDMQIHRYNRSDAAIPQFLERLRSVLDAYDARFSVAEVFGPTPLVEMQTFT
FT                   SPGRIHSAYNFDFLYAEKLTGDHVRQCIEAWAGDQVESWPSWAFSNHDAPRSASRWARS
FT                   AEPADLKRQAKLNLLLLLALRGSLFLYQGEELGLPQSDVPFEALQDPEAIANWPHTLGR
FT                   DGARTPFPWTEDRDAGFSTVPPWLPVDHRHPQLSVTSQETDPKSVLNFLRRALALRRAM
FT                   PALQDGGMTFIEGAADEDLLVFLRGTAPDETLCTYNFGDHAITWQPEDPEAWEIVLATG
FT                   SRAHGPPGSTIPPRSGYWAVRRRYI"
FT   gene            complement(558226..559362)
FT                   /locus_tag="PB2503_03097"
FT   CDS_pept        complement(558226..559362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03097"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03097"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08696"
FT                   /db_xref="GOA:E0TD37"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD37"
FT                   /protein_id="ADM08696.1"
FT                   /translation="MTKTALILSGGGARGAYQVGVLKALASAVPKGTMPFSVISGVSVG
FT                   ALAAVMLGSAPHDFREGVARLESVWRQLHSDDVFVTDNSLVRGRIFEWMRAALPGIGKA
FT                   TAPASLLDNSPLWDLVRRHADFDTINEIGAGEGGLDALAVTASSYRSGRAVTFFAGRPS
FT                   YADWSRARRMGVRTRFGPEHVLASAALPLIFPSVAVGERYFGDGALRNSFPLSPAIRLG
FT                   ADRLVVIGARDKKTDAEEGAMTEPSVGYLAGQMLDILFNDNLEADVEIAERFNRSYRSL
FT                   PAHRKAQSSIRPIDILPIDPSIDIRPIAGDFLHEMPGSARLMLRTIGGLKAPYILPSYL
FT                   LFEPGYIQTLMDLGEADGYRALNKELLLGEVACPASQI"
FT   gene            complement(559427..560338)
FT                   /locus_tag="PB2503_03102"
FT   CDS_pept        complement(559427..560338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03102"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08697"
FT                   /db_xref="GOA:E0TD38"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD38"
FT                   /protein_id="ADM08697.1"
FT                   /translation="MLFTSKTPQQKRLAFRHMLDDGKLHQVPGAFSPYVARMIEDKGYE
FT                   AVYIGGAMLTADLCLPDIGLATLSEFADRGEQIARVTDLPAFIDVDTGFGEPMSAARTV
FT                   RMLEEKGLAGCHIEDQVMPKRCGHLDGKEIVDTEVMIQRVRAAVDAKRDPNFCVIARSD
FT                   SRAIEGLDKAIDRMKAYVDAGADMIFPEAMKDEAEFEAVRKAIDVPILANMTEFGKSRL
FT                   LTRKELEDLGFNIVIYPVTTFRLAMGEVERGLDHILAAGDQSEILDRMQHRKVLYQYLR
FT                   YEEYNRFDQDLFNFEVGDTPTK"
FT   gene            complement(560521..562062)
FT                   /locus_tag="PB2503_03107"
FT   CDS_pept        complement(560521..562062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03107"
FT                   /product="methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03107"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08698"
FT                   /db_xref="GOA:E0TD39"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD39"
FT                   /protein_id="ADM08698.1"
FT                   /translation="MIDHSVHAHPSKDDLPREKQLAWKMAEVAADPVEVEEEVTEMIIN
FT                   RIIDNASVAIASLNRGPIKTARAQAVAHRLSGGATLFGVGGDLRVGAEWAAWANGTAVR
FT                   ELDFHDTFLAADYSHPGDNIPPVLAVAQQTGRGGKDLIRGIATGYEIQVNLVKGICLHE
FT                   HKIDHIAHIGPSASAAIGTLLELDKETIYQSIQQGLHCTVTTRQSRKGEISSWKAFAPA
FT                   YAGKTAIEAVDRCMRGEGAPSPIYEGEDSVISFILNGRTARDQGKSPYEPTYVVPLPGA
FT                   GEAKRAILDTYTKEHSAEYQSQALIDLAFKMGREIEAKGGFDKVKSIVLHTSHHTHYVI
FT                   GTGSGDPQKMDPKASRETLDHSIMYIFAVALQDGEWHHVRSYAPERAQREDTVRLWHKI
FT                   STTEDPEWTRRYHSHDPSEKAFGARVVVTMEDGTVLEDEKAVANAHPLGERPFKREHYI
FT                   QKFKTLTGDILDAAESARFLDLVQRLPELGPEEILALNPVAPAGYLEENLATGIF"
FT   gene            complement(562251..565475)
FT                   /locus_tag="PB2503_03112"
FT   CDS_pept        complement(562251..565475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03112"
FT                   /product="cobalt-zinc-cadmium resistance protein
FT                   (CzcA)-like"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03112"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08699"
FT                   /db_xref="GOA:E0TD40"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD40"
FT                   /protein_id="ADM08699.1"
FT                   /translation="MRSLIAFFINNRVAANMLAIFLVLVGYFASTTLVVRLFPDINLYS
FT                   VNITVPYPGATPEEVEEAIVEPIEERISGLEGVRKYSAVAAENVANIVVELYESEDVNE
FT                   LTNDIRTEVSQITVFPEEAEEPQIGELESSELIAQVVLSGPVDTVTLKKTAQTLRNRIA
FT                   GREGVSRVDVVGVPEYLIEIEVSEPRMQALGLSLPQLADTIGRESLDLSGGEIEGLNRR
FT                   TLVRTLGENEIGEEFREVVVASTAAGSPIRLGAIADINDGLADSPLETNYDERPAVVVN
FT                   VYRVGAEKVFSLIEAVREEVERLQPDLPPAVETVIWRDQSLDLQSRIDLLVRNAIIGLI
FT                   LVTAILLLFLDVRIAFWVAVGVGISFAGSLILMALFGISINQLTLFGFILAIGIVVDDA
FT                   IVVGENIYTTLEEGEHKGARAALVGAYRVARPVLFAISTTICAFLPLLFLPGQFGQFLG
FT                   AIAAVVIFVLLLSLTESFFILPQHVSHIDGSPPPRISVRRFTDPLKDWTTKRLDRFSTE
FT                   RLGPAITWCVKFPLTTLMIAFGALFATFTLMSTSIVKFDFFPEVEGNYVTATVVLAESA
FT                   SDAETRRATRQIVDAVAAASEKIAGPLKTDPEDIVEGTLWSIGQAVGDEAPGAVAASGG
FT                   PAANAGYAIVKIQDAAVRKFKAVDFEQAWREATGDLPGAQELTFSSDLVGGGADVTLEL
FT                   TGPNEENVRAALGRLREEVVKLPGTYAVRDDRFRTTEEFQIRLLPTGRSLGLTNADVAS
FT                   QVRAAYFGAEAVRVQRDREEVEVRVRYSEAERQTVETIRNQRIRVADGYVPLSQVATVE
FT                   VGEAPSVINRENGARVYTLRADVDLNISTGGAITSAVFQRIWPEIQEDYPNVSIGYGGD
FT                   QEEEARSMSALGRNFLIAMFAIYTLLALSFGSYTQPLIVLVLIPFGLIGALWGHALLGI
FT                   NLTLLSLFGIIGLSGVIINDALLMVDYINEALEKGVERGKAIVDSAVGRFRPIILTSVT
FT                   TFLGVTPIISEQSVQAAFLVPTAVSLGFGILFGTFILMLVVPAAASLHGIAHDNARWLK
FT                   TKGGEAVRRTVHKVRGKEKTDLSRLR"
FT   gene            complement(565472..566785)
FT                   /locus_tag="PB2503_03117"
FT   CDS_pept        complement(565472..566785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03117"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03117"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08700"
FT                   /db_xref="GOA:E0TD41"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD41"
FT                   /protein_id="ADM08700.1"
FT                   /translation="MNQEVLTAESKNPGAPIRWRIFLIGVAVLAVGYLSVSVVPALLGR
FT                   DETAGETPPPPLVEVVRAEAEDRTFTVTEEGFLQPAMEVDLVAEVSGKIVYVSEKLAVG
FT                   GRFAEGEVLLRIQDEIYAAEVERAEANLASARANAAQATAELTRQKELSSIGASAQAQL
FT                   EQVRASALSAEAAVSQARAGLRVARENLADTELRAPFDAVVSREQVSIGQYVSPQTVLA
FT                   QLISSGEAEILVGISPDDAAAVARAYTHSGGRLEARVQPAQGSALQDRLTGRVLEVGTS
FT                   IDPQTRTVDVVVMVPDAFSAARQGQVFARDFVAVALPARSPDPLYSAPSAALRRQSYIW
FT                   RINDDQRLHRVAVRPVSIAADRVIFASDENLGGVPVLTTALTEEAEGMEVRIKNEAPQG
FT                   GDPTAWLNQRPTGEAYRVAEIVPSERGVRMGPGEAVRP"
FT   gene            566852..568069
FT                   /locus_tag="PB2503_03122"
FT   CDS_pept        566852..568069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03122"
FT                   /product="outer membrane efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03122"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08701"
FT                   /db_xref="GOA:E0TD42"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD42"
FT                   /protein_id="ADM08701.1"
FT                   /translation="MKKLGAIIFLFLPACASVGPDLSTAPAESWQGEFYYGDDSAYTSD
FT                   APAKIAPWWQAAFDDDRLNRLVVLADNNNRDIGAALYRVEEAEARLSRARRALLPQGSG
FT                   SESYSRTNEFMQGQGGQRQETDVYTLSADLQWELDVFGRIRRQRDIARAGAAERLALYE
FT                   DVMRVVHAGTAQAYFNWLEADRRRAVAQQNLGLQEEALRLTQELVNLGASPRFDYDRQL
FT                   TQARLTEAALVQLTAARADALSALALLCGVTVPELVGLFPEFSGDSGTIDVPDMTPTLG
FT                   IPNPAVVIRQRPDIASAEAQYAQALYQIGVAQAELFPQLTFSGSVSQTAFEPEALYDQE
FT                   SFGFSYGPRLNWNVFSFPQLLAEVDATGKAAGAAKMAYENTVLNALTETDSALAQLLPP
FT                   SNGRLC"
FT   gene            568063..568257
FT                   /locus_tag="PB2503_03127"
FT   CDS_pept        568063..568257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03127"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08702"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD43"
FT                   /protein_id="ADM08702.1"
FT                   /translation="MLSEAEEAANRSLSLAEARYRAGADSLLSFIDSQRTALDTADQAV
FT                   SAQLAARRARVDVHRALAQ"
FT   gene            complement(568399..569151)
FT                   /locus_tag="PB2503_03132"
FT   CDS_pept        complement(568399..569151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03132"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08703"
FT                   /db_xref="GOA:E0TD44"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039647"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD44"
FT                   /protein_id="ADM08703.1"
FT                   /translation="MTTLKVSLAGTIAVTAFAAAFASAQPPMERGGMAPMARADVETRL
FT                   EERFADLDQNSDGYLEASEAAAPARDRYAGMKKRMAKGREAMSFEALDTNDNQVVTPTE
FT                   FAAPALASFDRLDRNGNGVIDEEERPQKGGMQRGQAAMADGASREDVVALAEARFQTLD
FT                   ADQNGTLTEAELTEARAATKEQMAARRDMMVDRAEDAFDQGDTDGDGRISLEEFKTTGL
FT                   ERFDRHDANSDGVISPDERRAASMQRRG"
FT   gene            569400..569476
FT                   /locus_tag="PB2503_t07284"
FT   tRNA            569400..569476
FT                   /locus_tag="PB2503_t07284"
FT                   /product="tRNA-Met"
FT   gene            569629..570324
FT                   /locus_tag="PB2503_03137"
FT   CDS_pept        569629..570324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03137"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08704"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD45"
FT                   /protein_id="ADM08704.1"
FT                   /translation="MTTITVFGAAGATGTQVVKEAVTRGYTVRAVERAWPARAPSLTGV
FT                   TTFTADVLSDPLDPAIDGSDAIISCLGLAFSPQTAIAPPPLYTEGTLRIIEAMRQREQR
FT                   RLVVISAAFVDPHTEMPTWFRHSAYRALRPIFSQMADMERVLRASEGIDWCAVRPGWLL
FT                   NEPATGDFRVFDKALPKGVFRTRHADLAAFLIDNALNDRWLRSTPAIGRKESVRFTTPP
FT                   ALLKEVLKL"
FT   gene            570431..572278
FT                   /locus_tag="PB2503_03142"
FT   CDS_pept        570431..572278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03142"
FT                   /product="ABC transporter, fused ATPase and inner membrane
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03142"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08705"
FT                   /db_xref="GOA:E0TD46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD46"
FT                   /protein_id="ADM08705.1"
FT                   /translation="MSPRLSNSAEAPHAESSLREQLGSIATLFPYLWRKDRPGFRPRII
FT                   GAVIVILTGQMITVAAPLLLAMGINRLAEQDEALGLTAAIGGFILGYGIFRLLSAALPQ
FT                   MREFLFSVVSQTAQREVAVTVFDHLHSLSLRFHLERRTGGLSRVIERGIRSIDFLFRFL
FT                   LFNIGPTLVQLLIVSIAFGLRYSWSLVIIVVVTVVLYFYFTATSTEWRLKFRRQMNEKD
FT                   QLANTRAVDALLNYETVKYFTAERYESGRYDEALTDYQDAAVKSQNSLAVVNIGQALII
FT                   NLGLVSAVFVIARGVANGIYGIGEITGVSLIMMQLYQPLNILGFAYREIKQALIDMERM
FT                   FGLLKLRPEIDDAPTAQPLVVTGGTLVFDNVHFAYDREREVLKGVDLTVEAGKKVAVVG
FT                   PSGAGKSTLARLLYRFYEATDGEIRIDDQPITMVTQTSLRHSIGVVPQDTVLFNDTIGY
FT                   NIAYGRPNASHEDIEEAARLAQIHDFIIGLPKGYQTMVGERGLKLSGGEKQRVAIARTI
FT                   LKNPPILILDEATSALDSATEQSILGALKRIEHNRTTLVIAHRLSTIIDADLIVVLKEG
FT                   AIVETGTHDSLLEQAGLYAELWQRQLDGYTAGADIQAAQ"
FT   gene            572310..572723
FT                   /locus_tag="PB2503_03147"
FT   CDS_pept        572310..572723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03147"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08706"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD47"
FT                   /protein_id="ADM08706.1"
FT                   /translation="MSDLPDFEAIKDDMAFLEDWDERYRYIIDLGRQLPPLAEEERSED
FT                   TRVRGCASQVWLVFDTGEAGHLRIRGDSDAAIVKGLIAILLSLYKGKSAADIAAIDPKA
FT                   ALGELDLEAHITSQRSNGLASMIARIRTVASAG"
FT   gene            complement(572814..573398)
FT                   /locus_tag="PB2503_03152"
FT   CDS_pept        complement(572814..573398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03152"
FT                   /product="cytochrome C oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03152"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08707"
FT                   /db_xref="GOA:E0TD48"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD48"
FT                   /protein_id="ADM08707.1"
FT                   /translation="MMMTDPKRRTVMITLGAIGAMTTLVAVSPQLYRTFCQVTGWGGTT
FT                   QRADTAAGEVLDRTITIRFDATTAKGLPWRFTPAQGPQTLHVGETGLAYYEAANTADYP
FT                   VIGTASYNVQPAKAGPYFMKVACFCFTEQLLQPHETVKMPVTFFVDPSIADDPSMDDVR
FT                   EITLSYIFYRNERAEEKMTQATAPSETAAVY"
FT   gene            complement(573395..573595)
FT                   /locus_tag="PB2503_03157"
FT   CDS_pept        complement(573395..573595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03157"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03157"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08708"
FT                   /db_xref="GOA:E0TD49"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD49"
FT                   /protein_id="ADM08708.1"
FT                   /translation="MSDHPQQAPEIEAREGVPTGELQPLSEEEAVARSRRNKSIAFGVV
FT                   AFIVIVFATTVLRLAQNTGGV"
FT   gene            complement(573588..574541)
FT                   /locus_tag="PB2503_03162"
FT   CDS_pept        complement(573588..574541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03162"
FT                   /product="putative heme o synthase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03162"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08709"
FT                   /db_xref="GOA:E0TD50"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD50"
FT                   /protein_id="ADM08709.1"
FT                   /translation="MVDPHPSQLADPPPHRGGGPASGQPNSRLSGPRDYLQLLKPRVMS
FT                   LSIFTAFAGMIAAPGEVTNWPLALISLLAIALGAGASGALNMWWDADIDAVMQRTKDRP
FT                   IPRGAVPRDEALIFGGLLSLLAVWLLALSGTYLAAALLAGTILFYVLVYSMILKRRTPQ
FT                   NIVIGGAAGALPPVVGWAAITGDAPLAAWVLFSIIFVWTPPHFWALALVKQDDYRAAAI
FT                   PMMPNVRGDAHTRRLILWYSVLLAPLGVLPVAFEMAGWLYGSVAVLGGVVFVALAVNIQ
FT                   RDERAKPAWRLFGFSIFYLFALFLALIIEGGGATNV"
FT   gene            complement(574547..576223)
FT                   /locus_tag="PB2503_03167"
FT   CDS_pept        complement(574547..576223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03167"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03167"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08710"
FT                   /db_xref="GOA:E0TD51"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD51"
FT                   /protein_id="ADM08710.1"
FT                   /translation="MTEQTAVQSGDAHHGADHDHKPSFFVRWFFSTNHKDIGILYLIFA
FT                   IGAGIVGGAMSGLIRWELAEPGIQVLTQFTSDAKTLAEQETSAKNFYNVLITYHGLIMI
FT                   FFLVMPALIGGFGNYFIPIMIGSPDMAFPRMNNISFWLYCASGVLLTLSLFAPSYGAEL
FT                   GYGGGWVLYPPLSTSTSGPAMDLLIVSLHLAGVSSILGAINFITTIFNMRAPGMTLHKM
FT                   PLFAWGVLVTAFLLVLSLPVLAGAITMLLTDRLFDTAFFDAARGGDPVLYQHLFWFFGH
FT                   PEVYILILPAFGIISHIVSTFSKKPIFGYLGMAYAMVSIGFVGFIVWAHHMYTVGLSVN
FT                   MKAYFVAATMIIAVPTGIKIFSWIATMWGGSIEFKTPMIWAIGFIFLFTVGGVTGVLLA
FT                   NAGIDTYMHDTYYVVAHFHYVLSLGAVFGIFAAWYYWHEKMFGVRYNELLGNLHFFVMF
FT                   VGVNLIFFPQHFLGMQGMPRRYIDYPEGFALWNKVSSIGYAITLVAMLIWVVVEIEAFL
FT                   MRKKSSRVARDNPWGEGATTLEWTLPSPPPYHQFNELPVIK"
FT   gene            complement(576233..577411)
FT                   /locus_tag="PB2503_03172"
FT   CDS_pept        complement(576233..577411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03172"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03172"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08711"
FT                   /db_xref="GOA:E0TD52"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD52"
FT                   /protein_id="ADM08711.1"
FT                   /translation="MKLALPAFLSSLALAPMAVAAQSLGEPGFEDVPHNSVIALREAAT
FT                   PVAEEIHFFHDFVILPVMVGISLFVLALLIWVVLRYNAKANPVPNTFSHNTLVEVVWTV
FT                   VPVLILVFIALFSFDLLYLQDRVPDAQVYEYDEGTQRARIPNAEVASRRVTQERHLEVA
FT                   LVDKRSRQKQLLSPEQYDVQGYGEEELVIALADPVPNGQLLRVTGGRSRAGRKPFLGLF
FT                   GEDESQVIPAPSVTIKAIGFQWGWSYVYPDFGDFEFDALMAPKDSVPSNLYRLATTNDV
FT                   VVPAGETIRIATVGRDVIHSWAMPAFGIKIDAIPGRYNETWFYTENEGTYYGQCSEMCG
FT                   LDHAFMPISVRVVSRPEFEAWVNEQAELNGLDPFFDLPNEQLAAAPAPAAAN"
FT   gene            577643..579058
FT                   /locus_tag="PB2503_03177"
FT   CDS_pept        577643..579058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03177"
FT                   /product="TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03177"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08712"
FT                   /db_xref="GOA:E0TD53"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD53"
FT                   /protein_id="ADM08712.1"
FT                   /translation="MTFSFFDRTDLHQDRTQRLLDDTLTGCDDGELFLQFSQSEAFVYD
FT                   DGHLKTASYDTAQGYGLRAVLDETTAYAHSSDFSEEGLKRAAQSVSAIKSGHGGSIADG
FT                   PVRTNRHLYSDESPLAGLAFDRKVGLLSEIDAYARAKDPRVRQVSASLTGEWRVVEIVR
FT                   PGGHIVRDIRPLVRLNVSVTAGEGDRQESGSTGAGGREGYSRLIAPDFWQSQVDEALRR
FT                   ALVNLEAVPAPAGEMPVVLGPGWTGVLLHEAVGHGLEGDFNRKKTSAFAGLLGERVAAP
FT                   GVTVIDDGTLEGRRGSLTVDDEGTPTEKTVLIEDGILKGFMQDRLNARLSGVAPTGNGR
FT                   RESFEYAPMPRMTNTYMLGGAYDQGDLIESVKDGIFAVNFSGGQVDITSGKFVFNCTEA
FT                   YKIENGRLGAPLKNVALIGDGPTVMRQASMIGNDFSLDPGVGVCGKAGQGVPVGVGQPS
FT                   LKIDRLTVGGAAA"
FT   gene            complement(579073..579546)
FT                   /locus_tag="PB2503_03182"
FT   CDS_pept        complement(579073..579546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03182"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03182"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08713"
FT                   /db_xref="GOA:E0TD54"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD54"
FT                   /protein_id="ADM08713.1"
FT                   /translation="MFEKTEIRRKRTEVPVIITLASGRTIEGALFVAGGERISDLLNDT
FT                   RQFVPIETHAGVEVVAKGQIAAVVPAHADDAESSGTGTPKTDPYTLLRVDPSASDEELR
FT                   AAWMKRLKASHPDRLASLDLDKEIIAAARVVSARINAAYDEVMAERKLRASAA"
FT   gene            579622..580575
FT                   /locus_tag="PB2503_03187"
FT   CDS_pept        579622..580575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03187"
FT                   /product="glutaminyl-tRNA synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03187"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08714"
FT                   /db_xref="GOA:E0TD55"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD55"
FT                   /protein_id="ADM08714.1"
FT                   /translation="MSPAQLEASTSQPKGEKTVTKMRTRFAPSPTGYLHLGHAFSALLA
FT                   HRTALSLGGTCLLRIEDIDHTRCRPVFESAIFEDLAWLGMTWPQPVVRQSSRLAHYDEA
FT                   LAGLLDRGLVYRCFRSRADLAEAASAPHGPIGPVLRAGPLPPRQERALLDAKEPFAWRL
FT                   WSDEVRAYLGAELSHLSATAWTPAGMHHIPVDLAAVGDVVLGRKDLGTSYHLASVIDDI
FT                   DQTVSHVIRGEDLAPIAGLHRLLYRLFEAAAPVYYHHPLILGPQGKRLAKRDQAETLRA
FT                   YRERGVTPDRLKARLGLDTTVLPFSNGLSQTRPQDR"
FT   gene            complement(580551..580952)
FT                   /locus_tag="PB2503_03192"
FT   CDS_pept        complement(580551..580952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03192"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03192"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08715"
FT                   /db_xref="GOA:E0TD56"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD56"
FT                   /protein_id="ADM08715.1"
FT                   /translation="MTQGSATGDEVNWHAFTARRLVAGEFGVSEDEMMGASRAKAPIAF
FT                   ARQVAMYLAHVVYQLTYNEVAEAFGRERTTVAHACAVVEDRRDDYAFDARITKLEERLD
FT                   QLNRLRIGRKVDRCGCLAVLIDQRSCGRV"
FT   gene            complement(581110..582873)
FT                   /locus_tag="PB2503_03197"
FT   CDS_pept        complement(581110..582873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03197"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03197"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08716"
FT                   /db_xref="GOA:E0TD57"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD57"
FT                   /protein_id="ADM08716.1"
FT                   /translation="MTPFPLDWSPAAIVMALGLLALFLPRAGRNLIGLVAMGAGLLHLL
FT                   AYGVPEIGGQRLYGAWSILDFEMTTVRVDRLSFVFALIFTIAGFLNVIYGWRHATRVEA
FT                   STGLIYAGSAIGGALAGDLLTLFFFWEAAALSSVFIIWQAGTKEATFAGVRYLVLHVFS
FT                   GLLLLTGVVLVWGQGGDLTFGALSLWDEAGALNLAALLILASFAIKAAFPLVHTWLPDT
FT                   YPKASAVGAVILSAFTTKLAIYALARSFAGLDLLIGIGVAMALFPLLFALLEDDLRKVL
FT                   AHALNVQLGFLVCAVGIGTPLAINGAAAHAFIHILYKALLFMSMGAVLLRTGTTRASEL
FT                   GGLHKSMPWTAGFCLVAAFATSAVPLFSGFITKSMITGAASEAHLIWVYTLLLIASAGV
FT                   VENSGIRVPFFAFFATDRFAPSRTGQRRPEEAPAPMMIAMGMAAGLSILIGVRPDLLEA
FT                   ILPYETDYHAFSWGHVTAQLQLVLGAVLTFAVLYRLGVYPVARRTPVVDVDWLWRVPGK
FT                   SLLLLSVSVTASLWHAVWGVISQGVQAMVSRLYYSHGPEGRMARTWPVGYTALTTAIVL
FT                   GVVLFSVYFAR"
FT   gene            complement(582870..583241)
FT                   /locus_tag="PB2503_03202"
FT   CDS_pept        complement(582870..583241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03202"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08717"
FT                   /db_xref="GOA:E0TD58"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD58"
FT                   /protein_id="ADM08717.1"
FT                   /translation="MSDRQPSLPSDEQSLLDRPFTRRLVGGGLVGGFILTLGAGVILGM
FT                   NGLMVYKPHFDGKTGFAGLLGAAADHFPAFYASLGILGFLLLVAVGRVLAPLLSGASEP
FT                   YGPKADKAVSDEGDRGGRA"
FT   gene            complement(583238..584725)
FT                   /locus_tag="PB2503_03207"
FT   CDS_pept        complement(583238..584725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03207"
FT                   /product="putative NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03207"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08718"
FT                   /db_xref="GOA:E0TD59"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD59"
FT                   /protein_id="ADM08718.1"
FT                   /translation="MILPITPEHSILYALFLPLISFFGILLADRAPNLRETVILGFAAV
FT                   TFLFVLNVAGAVGQGARPTVTLFEILPGLSLSFQAEPLGAMFAVIASGLYIVNSLYSIG
FT                   YMRGNGEAHQTRFYGCFAIAIAAAIGIAFAGNLLTFFTFYEILTLSTFPLVTHKENQAA
FT                   KRGGAIYLGILIGTSIGLLLPAIIWTWVLTGTTDFVPGGVLAGSPDFRGLLPAVLLGLY
FT                   LFGIGKAALMPVHPWLPNAMVAPTPVSAFLHAVAVVKAGVFGVLKIALYVFGMDVLREA
FT                   DLTDIFIVIAAFSILAASAIAMTQDNLKARLAYSTVSQLSYVTLGALLATQYGVLGGAS
FT                   QIAAHALGKMTLFMCAGAIYTAAHLSLISDMRGTGRAMPLTWTMYIVGACSIIGLPPLA
FT                   GTWPKFLLMVGAMDAGHQLVFAVLILSSLMNIVYLLTPAIRAFTDPPPPGMKPGVREAP
FT                   IFCLIPLTLTGVGTIVLFFAMDGLLDYLAPLVGGGGQ"
FT   gene            complement(584722..586227)
FT                   /locus_tag="PB2503_03212"
FT   CDS_pept        complement(584722..586227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03212"
FT                   /product="NADH dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03212"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08719"
FT                   /db_xref="GOA:E0TD60"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD60"
FT                   /protein_id="ADM08719.1"
FT                   /translation="MTLADHLAVLPVLLPLLAAPICVLLPRGNLPWAFATLIAWLSFWA
FT                   AAALLVQVRSVDVVDYALGGWPAPLGIVYRIDVLGALVMALISGIAAAVLPFARQSLAR
FT                   ETSAVQSSHIYGMILVSVAGLLGVVATGDAFNLFVFLEISSLSTYTLVAMGARQDRRAL
FT                   TAAFTYLVLGTIGATFFVIGIGLLYQATGTLNMIDLHERLSGQDDRVVRAGFAFVVTGL
FT                   ALKLAMFPMHRWLPDAYTFAPSVVTAILAATSTKAAIYALMRFLFTVFGFTFPFLETAL
FT                   FLLMAFGLAGMVIASLIAVFRDDVKQILAFSSVAQVGYMLLGISIATSDGVSASIVHVF
FT                   NHALMKAALFMAVGAVFYAVGSHRIAAYRGLFKTMPFTACCFISAGLSLIGVPFTAGFV
FT                   SKYVLIEAALAATLPVPSLLLVGFVVVSSLIAVAYVGRVAYAILLDPPPENQVKIRSSV
FT                   PLGMLIPMGLMTFANLYVGFDAEGLIALADHAADILTREGLGR"
FT   gene            complement(586224..587036)
FT                   /locus_tag="PB2503_03217"
FT   CDS_pept        complement(586224..587036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03217"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08720"
FT                   /db_xref="GOA:E0TD61"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD61"
FT                   /protein_id="ADM08720.1"
FT                   /translation="MVEFILARYNYWIVIILMMTGLYIVFARGNLVKTVIGLNVFQTSV
FT                   FIFYITIGKVFGGTAPILVSSKEKSNGHGAPYDEPHHAPMGEGQHGDSDHGGVPALSQD
FT                   EAAAYASGARVNSLGAADQPEGAGSAVLGDSLHDAPDLPSNALSAELRPGRLSPPSGGE
FT                   EIVLSVGEHPGEATLAHGADSAATVPATVPALDPSPIPAESLDAVYSNPLPHVLILTAI
FT                   VVGVATTAVGLALAVRIREAYGTIEEDELERMDNEAATGSPFGEGGTA"
FT   gene            complement(587040..587480)
FT                   /locus_tag="PB2503_03222"
FT   CDS_pept        complement(587040..587480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03222"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08721"
FT                   /db_xref="GOA:E0TD62"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD62"
FT                   /protein_id="ADM08721.1"
FT                   /translation="MGHLILRITIKLLFAPIILFAFYVQFHGDYGPGGGFQAGVVLAVA
FT                   FILHALGFGLVATKKVVPPALLPWAMAMGVLLYGGTGVLTLLLGGNYLDYDVLQPDSHH
FT                   HAGQHMGIFFVELGVGLAVAATMLQIFYAFSGREPEPRDEEW"
FT   gene            complement(587481..588158)
FT                   /locus_tag="PB2503_03227"
FT   CDS_pept        complement(587481..588158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03227"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08722"
FT                   /db_xref="GOA:E0TD63"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD63"
FT                   /protein_id="ADM08722.1"
FT                   /translation="MMPTPIESGFDTPLSPTVALDVFLLSLLVVCAFAMVVQRRLFAVA
FT                   MLSGIYSLLSAVFFVLMDAVDVAFTEAAVGAGVSTVLVLSGMMLASRREKKVSRTRAFL
FT                   PLLIVGVVGVGLVYSTIDMPHFGDPNSPANAHVGRLYLENSPQDIDVPNIVTAILASYR
FT                   GFDTFGEVVVVFTAGLACLMLLGPGSMRGGRNVSDQRPQHLAAPEGEPLQMVVEETGVK
FT                   EER"
FT   gene            complement(588155..588523)
FT                   /locus_tag="PB2503_03232"
FT   CDS_pept        complement(588155..588523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03232"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08723"
FT                   /db_xref="GOA:E0TD64"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD64"
FT                   /protein_id="ADM08723.1"
FT                   /translation="MIEIVLDILSWVLLLAGGALVIIGSLGILRFPDFYTRLHAAGITD
FT                   TFGADLVLLAMALQAPDLITAIKLFMIFVFLVLTSPVSTHAAAHAAFVGGQRALLGPKL
FT                   IPAQSHHAMEAIDEEREA"
FT   gene            complement(588520..588846)
FT                   /locus_tag="PB2503_03237"
FT   CDS_pept        complement(588520..588846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03237"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08724"
FT                   /db_xref="GOA:E0TD65"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD65"
FT                   /protein_id="ADM08724.1"
FT                   /translation="MFVAIAAAIAVALCLVMIRAIAGPTLYDRVLAVNSVGTKTVLLLG
FT                   VIGFLTNRPAFLDIALLYALLNFVTTIAVLKFFSYQNLTPAMSGGRGMARFPMDESAEE
FT                   KAEP"
FT   gene            complement(588848..589402)
FT                   /locus_tag="PB2503_03242"
FT   CDS_pept        complement(588848..589402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03242"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08725"
FT                   /db_xref="GOA:E0TD66"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD66"
FT                   /protein_id="ADM08725.1"
FT                   /translation="MLSFLTGIAGRIFALLGALFLLWFALSGYFDKATLVMLGAFSVLI
FT                   TVWLCLRSGVMDGEGVPTRVFPGIVSYMLWLTLEIGKANLAVAREVVRPKMRLSPRMIR
FT                   VKAHQTSDLGKTIFGNSITLTPGTVTVDLTSTGEVLVHALSDDFAEDLGAIEDMGARVC
FT                   AFDGPEGREWAAQRALAEERS"
FT   gene            complement(589591..590751)
FT                   /locus_tag="PB2503_03247"
FT   CDS_pept        complement(589591..590751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03247"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08726"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD67"
FT                   /protein_id="ADM08726.1"
FT                   /translation="MTTAPAYNLQPSAPEAPGQASGGAGNIAQRTELARRLTDVLALPS
FT                   GQVNDHERAFTADMLNELLHDVTLAIRVEVAERLAQVLPPPAMLLRRLLLEPIEVAGPL
FT                   LKAYRSIPEGMLIEAARRSEAHRRAIAQRISISDVVADVIFEEGDVSLVVQLLQREELV
FT                   IAEYRIDELVSRSMSEPAICGPLMQRLELQPRHGFTMFWWLCSEDRQKILARFSIERTV
FT                   VQDALKKLFCEVFPDPEPDLVVKRILVLCDRRHRPRGKNGEAVSIDVVEKMLVRARAHP
FT                   RPELVQATGLLAGVEATTAHRVMMDEGPEPFAVMAKSVGVSRGAFRQILEKAQLAQSTD
FT                   GSRASITDLSIEESVAVFDSMARDYARTILRYWDWRMRITREDVAP"
FT   gene            590850..591146
FT                   /locus_tag="PB2503_03252"
FT   CDS_pept        590850..591146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03252"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03252"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08727"
FT                   /db_xref="GOA:E0TD68"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD68"
FT                   /protein_id="ADM08727.1"
FT                   /translation="MRRALLIAMGGGLALAGCMSTPVDTDGPFYPSGFSDGCRTAQAID
FT                   SSFAVEDYRDKTLFDSEPSYRTGYRAGLVQCGDATAPGSFRNLDGDLGNWNSL"
FT   gene            complement(591365..591547)
FT                   /locus_tag="PB2503_03257"
FT   CDS_pept        complement(591365..591547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03257"
FT                   /product="50s ribosomal protein L32p"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03257"
FT                   /db_xref="EnsemblGenomes-Tr:ADM10866"
FT                   /db_xref="GOA:E0TD69"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E0TD69"
FT                   /protein_id="ADM10866.1"
FT                   /translation="MAVPKSKVTRAKRGMRRAHDALGAPSFIEDRESGNLRRNHHIDLK
FT                   AGTYRGRQVLPPQDD"
FT   gene            complement(591729..591938)
FT                   /locus_tag="PB2503_03262"
FT   CDS_pept        complement(591729..591938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03262"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08728"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH3"
FT                   /protein_id="ADM08728.1"
FT                   /translation="MGSAALALGGGDGEHSGDDEPPKQERAAESGEGERNAKGHESTLK
FT                   LAQGLPFQMSQSRHFKGLSFIGFQ"
FT   gene            591946..592185
FT                   /locus_tag="PB2503_03267"
FT   CDS_pept        591946..592185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03267"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08729"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH4"
FT                   /protein_id="ADM08729.1"
FT                   /translation="MQDLARASWPILSPAQKRLVDLLAEAAFEEELSPTQRARIGGTPS
FT                   ARFTSLPEWRKTAFRGMAIKQLGFAAPDALRQAI"
FT   gene            complement(592311..593390)
FT                   /locus_tag="PB2503_03272"
FT   CDS_pept        complement(592311..593390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03272"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03272"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08730"
FT                   /db_xref="GOA:E0TDH5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH5"
FT                   /protein_id="ADM08730.1"
FT                   /translation="MNGALSPGATIGILGAGQLGRMLATAAARLGFRVHTFSPETSPPA
FT                   AQVAAHHVPAAYDDEDALAAFAEGVDAATFEFENIPPQTVSFLRDRGVPVRPDDKVLAV
FT                   CQDRLAEKAFLEAQGIVPAPHAQVDGRSDLEAALARLGPDAILKTRRFGYDGKGQKRLS
FT                   ADTPLGAVDDLLTQPCVLEQKVPFTAEFSVIGARGEAGDVAFYEPSRNDHAGGILRRST
FT                   VPASLPPAPLAAAQAAVRNCLMSLDYVGVLAVEFFWGEETGLIANEMAPRVHNSGHWTH
FT                   EACLTSQFEQHIRAVAGWPLGLTDRHSDAVMENILGAEVDDWARLAGTPGLAVTLYGKA
FT                   DQRPGRKMGHTVRLSPKRG"
FT   gene            complement(593387..593902)
FT                   /locus_tag="PB2503_03277"
FT   CDS_pept        complement(593387..593902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03277"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03277"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08731"
FT                   /db_xref="GOA:E0TDH6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH6"
FT                   /protein_id="ADM08731.1"
FT                   /translation="MVVSSPDAAPVAIVMGSTSDWPTMGEAAAILDDLAVAHDDLIVSA
FT                   HRTPDRLFGFAKEAASRGTKVIIAGAGGAAHLPGMVAALTPLPVLGVPVKSSSLSGLDS
FT                   LLSIVQMPGGVPVGTLAIGAAGAKNAGLLAAQILALGDADLAARLGAWRAAQTESVVDM
FT                   PPQEPLHP"
FT   gene            594112..594681
FT                   /locus_tag="PB2503_03282"
FT   CDS_pept        594112..594681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03282"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08732"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH7"
FT                   /protein_id="ADM08732.1"
FT                   /translation="MNEHMIAAIRRQFPATETASSSLDKLLTERRPVGQESLIEKLARL
FT                   EQERLRIQGAEGLPRLRILGKEPFLRLMAGLSGTPRANGCLARIELTGLAPISAAHGDE
FT                   AAAELTDFLGQWMRAYLRESDVLGRIGPQSYAAFLPQARKGGTETKLAQLAWRLGRTPC
FT                   TQGLGNLGLDLVSQVVPVGPHAQLTL"
FT   gene            complement(594678..596339)
FT                   /locus_tag="PB2503_03287"
FT   CDS_pept        complement(594678..596339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03287"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03287"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08733"
FT                   /db_xref="GOA:E0TDH8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH8"
FT                   /protein_id="ADM08733.1"
FT                   /translation="MVTDPSARAFSWKKLTALAAEGPPPLSDLFDHNPGRVAHFSLEAA
FT                   GVYADYSKTPVNQTILDALYGLARACDFEARRDAMFGGQRINETEERAVLHVALRDTSD
FT                   RIYTVDGQNVTTDIHAVKDRMKAFVEKVHDGRHDGYGGAPLDTVVNIGIGGSDLGPAMV
FT                   SRALDPYTVDGRRTFYVSNVDGADIASVLRQIDPERTLFLIASKTFTTQETMTNAETAR
FT                   NWFLSSGGNEAAIAKHFVALSTNEAAVTDFGIDPENMFAFWDWVGGRYSLWSAIGLSIA
FT                   LQIGWSGFEDLLSGARGMDRHFETMPLEGNLPASLALIDVWHRSFLGYSARAVLPYDQS
FT                   LARLPAYLQQADMESLGKRIDRSGQVVDYPTGAIVFGEPGTNGQHAFYQLLHQGTDVIP
FT                   CDFIAAACGQVEVGDHHEKLLANFLAQPEALMAGRSVEAARSEALATGKNPETADRLAI
FT                   HRSFPGDRPTISLLVERLTPEALGALLALYEHRIFVQSILWDINAFDQWGVELGKGLAK
FT                   TILAELEGEVDVASHDPSTADLIRRIKRLRREGGVA"
FT   gene            complement(596329..596922)
FT                   /locus_tag="PB2503_03292"
FT   CDS_pept        complement(596329..596922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03292"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08734"
FT                   /db_xref="GOA:E0TDH9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDH9"
FT                   /protein_id="ADM08734.1"
FT                   /translation="MLTAFALSALALLAGPRIGETAPDFTARTTTGETITLSDLSDKRV
FT                   ILEWSNHLCPFVQKHYSSGNMQTLQKRSRADDTVWITVVSSAPGKQGFVTAEEANALTK
FT                   SRGANPSYVILDSEGDIGRLYEAKTTPHMFVIAAGEQQALRYAGAIDSIPSADKNDLAR
FT                   ADNYVEQAMRSLDNDRQIVVPQTKPYGCSVKYGD"
FT   gene            complement(596944..599163)
FT                   /locus_tag="PB2503_03297"
FT   CDS_pept        complement(596944..599163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03297"
FT                   /product="thio:disulfide interchange protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03297"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08735"
FT                   /db_xref="GOA:E0TDI0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI0"
FT                   /protein_id="ADM08735.1"
FT                   /translation="MFTLHLSALFPLVPVLILRRLLGAVGLIFLWAGLASGALAQSSET
FT                   VRSGHAASRLVAGQTAGVPGETMTLALIQDLDAHWHVYWRNPGDSGLPLRLTWQVPDGF
FT                   VAGEPAYPLPQRLPVPPLVNYGHEGRVVFLIPFRIPEAAIPGTTVDITVKADFLICKIQ
FT                   CVPETATLTLPLPIAAMSTGGVEAAVTIERARRALPQPAPFDAAYYDGDRGPVLVMEGA
FT                   PMGQATFFPYAPSLIEPAGEVYRASRNGRDYYGFEAGFAYRARLPESLSGVVVIEGENG
FT                   RRGYRISATQLAPPEDPPRLTPPHTTLSEGGQAGDTSDQMVSAAPSLADAPGRPSLLAG
FT                   MVLGLLGGVVLNLMPCVFPIVFLKALGFAALSREERPTIRRHGLLYTAGVLTTFGGLAA
FT                   LLFGLRAAGEGLGWGFHLQSPLAVGIFAVILFLVALNLLGVYEMGTSVQGTGDQLTKKP
FT                   GAAGAFFTGVLAVAVAAPCIGPFLGGATGLALAADPVIGLVIFLSIGLGLALPYLGLSF
FT                   VPKAVRVLPRPGPWMVILRQLFSFALFAALVWLIWLLSVQTGPTGVLLLGLALLASGLA
FT                   AYLFGLSQSQTHAGSRWRALAAFSALLAVVPLARIPAVSAAPASGGAETMTAIPWSPDT
FT                   VAGLIAEGRPVFVDFTAAWCITCQVNKLTVLDTARVKSAFAAANVAYVVADWTRADPQI
FT                   TAELERLGLGGIPVYLYYDQRGESRMLPQILSVDLVVATVAAPGT"
FT   gene            complement(599211..600275)
FT                   /locus_tag="PB2503_03302"
FT   CDS_pept        complement(599211..600275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03302"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08736"
FT                   /db_xref="GOA:E0TDI1"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI1"
FT                   /protein_id="ADM08736.1"
FT                   /translation="MVLGEACGGKAGYPGEDMESIFIWGLFFVVLFVLPILARRQRRAA
FT                   IETVFARTQRARKSRIIAIVHRQEPMGLLGIPQLRYIDLNDAEDVLNAIRSTPAGTPLE
FT                   IILHTPGGLVLPALQIARAIKAHAGPKTVFVPHYAMSGGTLIALAADNIILNDHAVLGP
FT                   IDPQIGGLPAASIAHVTETKSPDTIEDFTWVLADVARKAQQQLERAAKDLLSGTVSPNA
FT                   AHAIAEELSSGRWTHDYPIDAAEAREIGLHTSTEMPEEIAALMELFPDKLSKQSVSYTQ
FT                   EPTLLTRLFGRRRPPQALPPPPAPEGMRIPFHGFAPGPGARSFSYGPWNPRDLNLGPGR
FT                   GEVRPSAPRQDGRR"
FT   gene            600346..601476
FT                   /locus_tag="PB2503_03307"
FT   CDS_pept        600346..601476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03307"
FT                   /product="Predicted carboxypeptidase, Zn dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03307"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08737"
FT                   /db_xref="GOA:E0TDI2"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR040626"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI2"
FT                   /protein_id="ADM08737.1"
FT                   /translation="MTDLMITAPADSGNIAVLDAKNPKAVRLAIVPDGKAAFHQWFYFR
FT                   VAGGEGVPVTYHIENAGQASYAFGWPDYRVCVSTDLEEWTRIDTQYKDGCLSFSHRAEQ
FT                   NAVYFAYFAAYPLERYRQLAAELVAAAVPCDPLGPSVDGEPIDVFRFGDPGKDKKPLWV
FT                   IARQHPGESMGSWWMEGFLERLTDPGDATARALRDRVTLYVVPLVNVDGVRRGHLRTNA
FT                   AGTDLNRAWADPSEDTSPEVFSIRQRMDETGCDFFLDVHGDEAIANNFIAGAEGVPGWT
FT                   PRQQDRLDGFRDALSALSPAFQTVEGYPVDPPGRANLSIAANQIAHRFDCLSMTLEMPF
FT                   KDAKVLPDPEVGWSPERCRALGRTCLSALWTTLPLL"
FT   gene            601533..602390
FT                   /locus_tag="PB2503_03312"
FT   CDS_pept        601533..602390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03312"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03312"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08738"
FT                   /db_xref="GOA:E0TDI3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI3"
FT                   /protein_id="ADM08738.1"
FT                   /translation="MSRLSPSPQTPPWPLHNEEDFEGMRRAGQLAASCLDMLTREVVPG
FT                   VDTLTLDRLAREFVLDHGAVSATIGYRGYRHALCISPNHVICHGIPGQKPINGKPLREG
FT                   DIANIDVTVVLDGWHGDTSRMYTLDPISVKAQRLVDVTFECLWKGIDTVRPGATLRDIG
FT                   QAIQSHAESAGFSVVRDFCGHGLGRAFHNAPNVVHYGEVKDHLGRTQTTPDTPLTEGMF
FT                   FTIEPMINAGKPDVRMLKDGWTAVTRDRSLTAQFEHSLGVTADGVDVFTRSPEGLDRPP
FT                   YGAS"
FT   gene            602377..603114
FT                   /locus_tag="PB2503_03317"
FT   CDS_pept        602377..603114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03317"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03317"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08739"
FT                   /db_xref="GOA:E0TDI4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI4"
FT                   /protein_id="ADM08739.1"
FT                   /translation="MAPPDRSSPTSVAAPGPTGHRQRLKSRFRQAGVDGIHDYELLELI
FT                   LFAAIPRKDVKPLAKALLSRFGTVADVLSAPRTRLLEVKVDLGSGKTLAMTDASVDQFH
FT                   LIKAAALRLSQQNLLERPVLSSWDKLLAYVRAQIAYETVEQFRVLYLNAKNVLIADEVH
FT                   GSGTVNQTPVYPREVVKRALHLDASALILIHNHPSGDPTPSTADIKVTAQLVAAAATVG
FT                   VTVHDHLVIGREGHASFKSLGLL"
FT   gene            603188..603409
FT                   /locus_tag="PB2503_03322"
FT   CDS_pept        603188..603409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03322"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08740"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI5"
FT                   /protein_id="ADM08740.1"
FT                   /translation="MSEKLTDSRMRIQLAQFCFANSIAVDELYAALGVDMSTADAEVLA
FT                   HMAGIIDGMTVAANRIRQHGLDNWASQN"
FT   gene            603391..603630
FT                   /locus_tag="PB2503_03327"
FT   CDS_pept        603391..603630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03327"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08741"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI6"
FT                   /protein_id="ADM08741.1"
FT                   /translation="MGVAELIKRSVTLRGHRTSVALEAAFWAALDEWAVRRGVPVAQLI
FT                   LDADLKRGSQGLASTLRVELLAAARRGELSPHKP"
FT   gene            complement(603753..604280)
FT                   /locus_tag="PB2503_03332"
FT   CDS_pept        complement(603753..604280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03332"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03332"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08742"
FT                   /db_xref="GOA:E0TDI7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI7"
FT                   /protein_id="ADM08742.1"
FT                   /translation="MLNSFYGRGTALIALATLAACASTPEPEASAPVDAVVPERSARVD
FT                   QAPEGPIPGSAADLEQNVGNRVFFEYNEYALGQESIATLRRQAAWMKEYPEARIRLEGH
FT                   ADERGTREYNLALGARRASAAKSYLVDLGIDPSRITTVSYGKERPIDPRSTPEAWARNR
FT                   NATTVLLTTVGS"
FT   gene            complement(604443..605771)
FT                   /locus_tag="PB2503_03337"
FT   CDS_pept        complement(604443..605771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03337"
FT                   /product="translocation protein TolB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03337"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08743"
FT                   /db_xref="GOA:E0TDI8"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI8"
FT                   /protein_id="ADM08743.1"
FT                   /translation="MVLIVRVLSALFVAFTLALPLGAVAQDEPLIDIVGGRTDPMPVAL
FT                   PAFIATGEGAERVSADLSEVIRDDLASSSLFAPIDPAAFIQQLQSVNTPPRFADWRAID
FT                   ARVLLVGEVTALSGGRIQVAARLWDVGASKQLGTIAFKTPATNVRKAGHEIADFVYEQL
FT                   TGEPGYFDTKIVYVAESGPKTDRRKRLMIMDQDGANPSILTDGLNFDALTPRFSPTQQQ
FT                   IIFLAMFDDRPSQVYLYDIETTEMEALGSWRGMTFAPRFSTDGRGVLLSIEEAGNTDIA
FT                   RMDLITRRIERLTRNPAIDTSPSMSPDGRHITFASDRGGSQQIYVMNADGSDQRRITFG
FT                   NGTYGTPVWSPRGDLIAFTRLYRGRFYIGVVKPDGTGERLLTESYLDEGPTWSPNGRVI
FT                   MFFRENRPGGPVNLYSIDLTGRNLRRVETSTEASDPAWSPLLD"
FT   gene            complement(605881..606765)
FT                   /locus_tag="PB2503_03342"
FT   CDS_pept        complement(605881..606765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03342"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08744"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDI9"
FT                   /protein_id="ADM08744.1"
FT                   /translation="MRFPALSLSLLLHGAVIGGLVVTVPRLADDPIYIPPVPVDVLSRA
FT                   EFDDLVSIPAESATEEPAEREEPAPLPEPAPEPAPQPEPDPTPEPEPEPEPAPEPEPEP
FT                   QPAPEPAPEPEPQPEAEPEPQLPEPDPEPAPPTSAPEPDPVEDLDFDSLSDGLVDLTPD
FT                   RPRTAPRVVGDTGEGGERDQPQIGPGGQLSITEEAALQACVRANRVIDLSARDADQFVV
FT                   ELRIVLNIDQTLAAPIEITNQAAINRSGNPAYQAAARNAVAAVRACLPLDALDPARYQQ
FT                   WRVINFRFRPGTS"
FT   gene            complement(606779..607192)
FT                   /locus_tag="PB2503_03347"
FT   CDS_pept        complement(606779..607192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03347"
FT                   /product="TonB system transport protein, ExbD/TolR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03347"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08745"
FT                   /db_xref="GOA:E0TDJ0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ0"
FT                   /protein_id="ADM08745.1"
FT                   /translation="MAGGIRQPGGRGRFTPMAEINVTPMVDVMLVLLIIFMVAAPLLTV
FT                   GIEVDKPDTDAQAMTDSGEPITVSVTSEGRIFVQDTEIALDNLAPHLTAVRQAGYDQRI
FT                   YVQGDRAASYDAVAQVLGALNGAGFTRIGLVTE"
FT   gene            complement(607196..607891)
FT                   /locus_tag="PB2503_03352"
FT   CDS_pept        complement(607196..607891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03352"
FT                   /product="TolQ protein, inner membrane protein, tolerance
FT                   to group A colicins"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03352"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08746"
FT                   /db_xref="GOA:E0TDJ1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ1"
FT                   /protein_id="ADM08746.1"
FT                   /translation="MDEAVTVTSELGTDFSIWGLILQADIVVQFVMLVLAGMSVWSWTI
FT                   MFDKSMTLGAIKSKAKKFEDQFWSGRPLDELGRKVKDKPDHPMARIFMTLMDEFTQDRG
FT                   HGDPAAASRLESVARVHVNRELEKIQSQLSVLATIGSAAPFIGLFGTVWGIMNAFRGIG
FT                   ATGDANLAVVAPGIAEALFATALGLVAAIPAVIGYNRYAAGVNSYAVRLEGFATEFVAI
FT                   LSRRLGEGA"
FT   gene            608156..609151
FT                   /locus_tag="PB2503_03357"
FT   CDS_pept        608156..609151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03357"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03357"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08747"
FT                   /db_xref="GOA:E0TDJ2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ2"
FT                   /protein_id="ADM08747.1"
FT                   /translation="MVGHEVLSILAERLFPADEVIALASRNSLGREVSYGDKTLKCRDL
FT                   DQFDFAGTDLAIFAAGGDISEKYAPLAAKAGCIVIDNSSKFRLDPDVPLIIPEVNAAAV
FT                   DGYAKRNIIANPNCSTAQLLVVLKPLHDRAKIKRVVVATYQSVSGAGKEAADELFTQTK
FT                   GIFVNDEPSPEKFTKQIAFNVIPHIDVFLDDGSTKEEFKMVAETKKILDPTIKLTATAV
FT                   RVPVFVGHAEAVNIEFEEPLDDEEARAILREAPGCLVVDKREDGGYVTPVECVGDFATF
FT                   ISRIRTDSTVENGLNLWVVSDNLRKGAALNAVQIAELLVNRGHVKAGDSA"
FT   gene            609179..609745
FT                   /locus_tag="PB2503_03362"
FT   CDS_pept        609179..609745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03362"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03362"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08748"
FT                   /db_xref="GOA:E0TDJ3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ3"
FT                   /protein_id="ADM08748.1"
FT                   /translation="MMITVRGKTIEPLFSADQIAERNIALAEQIAEGPTTDLLVIAVLK
FT                   GSFIFAADLLRALHAVGLAPEVEFITLSSYGKGTVSQGVRIIKDIDSEVAGRDILLIDD
FT                   ILESGRTLRFARDLMFERGANHVSIAVLLDKTSKRTEGTVEADYVGFECPDHFVVGYGM
FT                   DVAYAFRELPFVGIVTGDSEGAAPR"
FT   gene            609816..609974
FT                   /locus_tag="PB2503_03367"
FT   CDS_pept        609816..609974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03367"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08749"
FT                   /db_xref="GOA:E0TDJ4"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ4"
FT                   /protein_id="ADM08749.1"
FT                   /translation="MDLIRIIFSILLPPLGVALQVGLGAQFWLNVLLTLLGYIPGVIHA
FT                   VYIIGKR"
FT   gene            609992..610435
FT                   /locus_tag="PB2503_03372"
FT   CDS_pept        609992..610435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03372"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08750"
FT                   /db_xref="GOA:E0TDJ5"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ5"
FT                   /protein_id="ADM08750.1"
FT                   /translation="MTTMAERNSPTIDPSPEPRGPESLGHATQVRRLRRLSKLARLLDA
FT                   RFGVPGFRFGLDGIIGLVPGVGDAIMAAISIGIVVEAARMGARTTTLIRMVFNIVIDSL
FT                   AGAVPLLGDIFDIFYKANLRNIDLLRREFPDAAAEVDSVAKDR"
FT   gene            610562..611503
FT                   /locus_tag="PB2503_03377"
FT   CDS_pept        610562..611503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03377"
FT                   /product="rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03377"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08751"
FT                   /db_xref="GOA:E0TDJ6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ6"
FT                   /protein_id="ADM08751.1"
FT                   /translation="MSGPSSLRTGLLAGTLAYTLWGFLPFYFIVLRGISPIEIFTDRIL
FT                   FAVPFGLLVILARSQWGEVVKGLRSPKVVLWLLASALAIAGNWILYIVAVQEGRVFEVS
FT                   LGYYINPLVYVLVGVVVMGERLRRLQILAVLLAGIGVTILTVYGGRFPLFGLILAVTFT
FT                   FYGYSRKRVAIGAMPGLFIETLLLSPLALGLLIWLVASTDTGLEAGLSGDFGLLTLLML
FT                   AGPITVTPLLFFAIAARRLTLSTIGFLQFIGPTLAFGIGLLDGEPFTPAYQICFAFIWL
FT                   GVALFIGDALQHRAQRPSPVPRAVAASLSTDP"
FT   gene            complement(611446..611829)
FT                   /locus_tag="PB2503_03382"
FT   CDS_pept        complement(611446..611829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03382"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08752"
FT                   /db_xref="GOA:E0TDJ7"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ7"
FT                   /protein_id="ADM08752.1"
FT                   /translation="MNDAAPSPDDNTALAEGGPSLAILKGVVWGLGLILLLGFGLVAAL
FT                   IVKGPTEGEGETTLPVVTLEEGERIGHATLEGDRLFLTVDQPDGTQRLLLIDLAGGDIA
FT                   ASDIRYGSVDSEAATARGTGDGR"
FT   gene            611876..612892
FT                   /locus_tag="PB2503_03387"
FT   CDS_pept        611876..612892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03387"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03387"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08753"
FT                   /db_xref="GOA:E0TDJ8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ8"
FT                   /protein_id="ADM08753.1"
FT                   /translation="MSDTEPLSFTVAEADVGARLDKWIADQTDAYSRARIKALIEGGAL
FT                   TKDAAPFTDPKWKLRQGEVFTLVPPPPEDPTPKPEDIPLTVLFEDGDLIVINKPAGLVV
FT                   HPAAGNWTGTLVNALLHHCGDTLSGIGGVIRPGIVHRLDKDTSGVMVIAKNDHAHQGLS
FT                   ALFAAHDIDRAYLALCEGSPRPTSGTITWPLARSSGDRKKMTVVGVDRPEGKEAITHFA
FT                   RLDAYGIGRAKLPGDALASLVECRLETGRTHQIRVHMSHIGHPLLGDPVYGRSGLAGLK
FT                   PGDPAADHALGLLRRFRRQALHAVELGFDHPVTGEALHFRQPPPHDFSTLVEAFKVL"
FT   gene            613124..614038
FT                   /locus_tag="PB2503_03392"
FT   CDS_pept        613124..614038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03392"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03392"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08754"
FT                   /db_xref="GOA:E0TDJ9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDJ9"
FT                   /protein_id="ADM08754.1"
FT                   /translation="MANALTTTSGAALSPEGGLNRYLAEIRKFPLLERDEEYMLAKRFK
FT                   EHEDPDAAQRLITSHLRLVAKIAMGYRGYGLPTGEVISEGNVGLMQAVKKFDPDKGFRL
FT                   STYAMWWIRASIQEYILRSWSLVKIGTTAAQKKLFFNLRKLKGQIDAVDEGDMRPEEVE
FT                   LIATRLGVTEDEVISMNRRMAGSDNSLNSPMRSDGDGGAEWQDWLVDENAVNAESQLVK
FT                   DDEFETRMELLQEAMVDLNDRERHILTERRLTENPKTLEELSGEYGVSRERIRQIEVRA
FT                   FEKLQKAMKRLDKEMRAETLRLG"
FT   gene            complement(614117..614572)
FT                   /locus_tag="PB2503_03397"
FT   CDS_pept        complement(614117..614572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03397"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08755"
FT                   /db_xref="GOA:E0TDK0"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK0"
FT                   /protein_id="ADM08755.1"
FT                   /translation="MDDRSLTPDFSVSPQLEPADLGVAARQGYRTIIINRPDGEGDQPG
FT                   AAEMSEAGRRHGLNVRYVPVNCGEITDSELAAFQEVALNLPGPILAYCRTGTRSAMLWA
FT                   LSQAGHLSTDAILSTAKQAGYDLEGLRPRLDAMSPAVAGTGQGALHG"
FT   gene            complement(614848..616617)
FT                   /locus_tag="PB2503_03402"
FT   CDS_pept        complement(614848..616617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03402"
FT                   /product="sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03402"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08756"
FT                   /db_xref="GOA:E0TDK1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK1"
FT                   /protein_id="ADM08756.1"
FT                   /translation="MVSRARRRQYLPILSWIGGYRGDTFAKDALAAVIVTIMLIPQSLA
FT                   YALLAGLPPQVGLYASILPLVAYAVFGTSRSLAVGPVAVVSLLTATAVGQVAEQGTAGY
FT                   LAAAILLALLSGAFLTAMGLFRLGFVANFLSHPVISGFITASGLIIAASQVKHILGVEA
FT                   HGETLFRLVSALFHQLADTNIPTLMIGVMAIAFLFWVRRGLAPCLKKVGMKATTASMLA
FT                   KAGPVLAIVVTIALTAIFRLDQQGVAIVGDIEGSLPPVAVPSVDLNLLRSLVGPAILIS
FT                   IIGFVESISVAQTLAAKRRQRIDPDQELIALGAANIASGLSSGYPVTGGFARSAVNFDA
FT                   GAETPAAGAYTALGISLAALYLTPLLTFLPKATLAATIIVAVLSLVDIRAVGETMRYSK
FT                   ADGASMLATIIFTLGFGIETGVVAGVLLSLSLYLLKTSRPHMAIVGLVPGTEHFRNVDR
FT                   HDVVTDDKVITLRVDESLYFANARGLEDIVYDLVADNPTLEHFVLMCPAVNSIDASALE
FT                   SLEAMNARLKDSGVTFHLSEVKGPVMDRLKRSHLLADLTGEVFLSQFAALSTLTPALVD
FT                   GARDGAHPQAAAR"
FT   gene            complement(616643..617560)
FT                   /locus_tag="PB2503_03407"
FT   CDS_pept        complement(616643..617560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03407"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08757"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK2"
FT                   /protein_id="ADM08757.1"
FT                   /translation="MSASQIPPLPVAVSDHRFDAPAVEAFFDEATNTVSYVLYDPETKE
FT                   AAVIDSLLDFDNKAGRITTESADRVLDFVREKGLKIDLILETHVHADHLSAAPYVKKNV
FT                   GGRIAIGSEIKTVQYVFGKVFNAGTAFQRDGSQFDVLFEDEDIFKIGRFQGVAMHTPGH
FT                   TPACMSYLIGDALFVGDTIFMPDYGTARCDFPGGDAVTLYRSIRRLFQLPDETRMFLCH
FT                   DYKSETRDHYAWETTVGEERRENIHVKDSVSEEAFVKMRNERDATLSMPTLILPSIQVN
FT                   MNAGNLPVPEDNGQQYLKIPLNAL"
FT   gene            complement(617605..617961)
FT                   /locus_tag="PB2503_03412"
FT   CDS_pept        complement(617605..617961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03412"
FT                   /product="transcriptional regulator, ArsR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03412"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08758"
FT                   /db_xref="GOA:E0TDK3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK3"
FT                   /protein_id="ADM08758.1"
FT                   /translation="MEAQADRSATLLRAMANPQRLRLVCELMAGERGVGELEELTGIRQ
FT                   PALSKELGKLREAGVIEGRRESKAVFYRLIDERVPGIIASLCGREVAPTAAHPRPSPVS
FT                   ERGSVFARIVQKPF"
FT   gene            complement(617991..618644)
FT                   /locus_tag="PB2503_03417"
FT   CDS_pept        complement(617991..618644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03417"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Malallergen"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03417"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08759"
FT                   /db_xref="GOA:E0TDK4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK4"
FT                   /protein_id="ADM08759.1"
FT                   /translation="MGGMPRVIDDLNIAEGTGARIDEAAPLFEAQSTAGLVRLADYRGQ
FT                   WVMLFAHPADFTPVCTSEFVALARAQASFDRLGCALIGLSIDSVYAHLAWVERIEADFG
FT                   VRPTFPLIEDPSLAIARAYGMIHPGASSTTVVRSVFVIDPAGIVRASSTYPMSVGRSVS
FT                   ELLRLVEALQVTDGGGGVAPEGWESGEPLLDPAPRTSDDLSGLNNSLWYAGGTK"
FT   gene            complement(618989..621085)
FT                   /locus_tag="PB2503_03422"
FT   CDS_pept        complement(618989..621085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03422"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03422"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08760"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK5"
FT                   /protein_id="ADM08760.1"
FT                   /translation="MRSKLHARLLSGAAVLALGAPAFAQDAEPALQDVIIVTGTRIDPA
FT                   TETGITPDAAPLQGGDITYLTARTPGGARLGNGELSGQMQYRGLFGERLNLRVDGQRFA
FT                   SGGPNLMDPVFHYAPAPLVAAIVIDRGVSPVSAGPGLAGGADAVFKRVDYAQGDEARFG
FT                   YDLTVGARSVNDSLSTGGVVGLASDAWRVNLLGAWEKGDDTEFGDGEIGGTAFERGVYG
FT                   LSAGARTALGEFTLDLRRQNTGPSGTPPFPMDIQYFDTDFARLGYAKAFGDLHFTASVH
FT                   ATDIVHLMDNFSLRPAPMPGRQRATFADASTQGGEGSISFPAFGGDLALGLDGEQVEHD
FT                   VTITNPTNTDFFVTPFPRVEMQRFGGFAEWSGALGAINAQLGLRADRNGYDAGEASLGS
FT                   ALPMGPRMLATAFNDADRSGEDTTVDAVARLWTTERGGLSWRVTLAHKQQVPGYIQRFG
FT                   WLPINASGGLADGNIYVGDLALEPETAWIAEAGYDYASARAYLRPTVFIRQIDDYIQGV
FT                   PFDGTVGVADSPVEMIATMNGDPTPLRWANVEARLYGLDMDGGYDFDGPLRLDGVFSYV
FT                   RGERRDIDDNLYRVAPLNLTLGLTWEADVWSATVETRAVADQEEVSLTNSEEATDGYVV
FT                   LSAYGEWDLYDGVTLSAGVENLLDEVYQDHLAGYNRNGFGDVPVGDRLPGAGRGMFVRL
FT                   NMSY"
FT   gene            complement(621173..621571)
FT                   /locus_tag="PB2503_03427"
FT   CDS_pept        complement(621173..621571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03427"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08761"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK6"
FT                   /protein_id="ADM08761.1"
FT                   /translation="MKRATGLTVARLLAMLAIVLQAFLPGSMAVAEAKGVDVSRFMCSP
FT                   SGQLSPDSRAAAEQIARLLGEDVPADQPFDAHCPLCTLAHSVLAPAPLVVAAPRAFPLE
FT                   QIFVRFEPGLVREAQGPPVGSRGPPSHI"
FT   gene            complement(622034..622240)
FT                   /locus_tag="PB2503_03432"
FT   CDS_pept        complement(622034..622240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03432"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08762"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK7"
FT                   /protein_id="ADM08762.1"
FT                   /translation="MYLLISIKMVMVMRSGAWRLRPNAGTACTFRRQDFPRYPADRRQK
FT                   FINFKLGSRLFLLALWKQKKRFS"
FT   gene            complement(622903..623301)
FT                   /locus_tag="PB2503_03437"
FT   CDS_pept        complement(622903..623301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03437"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03437"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08763"
FT                   /db_xref="GOA:E0TDK8"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK8"
FT                   /protein_id="ADM08763.1"
FT                   /translation="MNIVPVTGLYAALFALILIPLTIRVGLYRDKIKVYAGDGGDETLT
FT                   RRIRGHANFLEYVPFGLLLIALLELTGASGLILHGLGVLFLVSRVMHYFTLIVSPLAVT
FT                   RQISMLGTIAVFLMSGGLLIYFNLSGTF"
FT   gene            complement(623317..623667)
FT                   /locus_tag="PB2503_03442"
FT   CDS_pept        complement(623317..623667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03442"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08764"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDK9"
FT                   /protein_id="ADM08764.1"
FT                   /translation="MDALSVVKDYVKAACAGDGQSLRASLADDFQFKGPMMEAHSADQF
FT                   LQAMAAMPTNFTIRNSDFVADSDRVAHLHEVVIDGNETAPIPMCEVLSVHEGKITSSKL
FT                   FFDTKLFPNPAA"
FT   gene            623771..624214
FT                   /locus_tag="PB2503_03447"
FT   CDS_pept        623771..624214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03447"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08765"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL0"
FT                   /protein_id="ADM08765.1"
FT                   /translation="MKDSAQKPHRSGCPISIALEIFGDRWSLLILRDMIFGGKSTYRQF
FT                   LDSEEAIATNILSDRLRSLEANGLIKKQGSPTDRRVKLFSVTEKGFALAPMLIEMILWS
FT                   AAHEDTAAPQEVLDLMVNDRDGFIESLRKKVALDDAETADRQA"
FT   gene            624345..624692
FT                   /locus_tag="PB2503_03452"
FT   CDS_pept        624345..624692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03452"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08766"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL1"
FT                   /protein_id="ADM08766.1"
FT                   /translation="MTEKLYLCIQRSQPRPEGERAAPSPAQMEAMYARFNEWKEKFKDN
FT                   IVDMGGQLLGGKVVTSDNVTDGPFVEAKDVVGGYMIVSAASLDEAVEVAQQSPGVGADG
FT                   ASVEVREISKP"
FT   gene            624689..625939
FT                   /locus_tag="PB2503_03457"
FT   CDS_pept        624689..625939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03457"
FT                   /product="putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03457"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08767"
FT                   /db_xref="GOA:E0TDL2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL2"
FT                   /protein_id="ADM08767.1"
FT                   /translation="MSGRDDVELAFRRHYAEQVSALSRRIGLRHLELAEDAVQSALLKA
FT                   LDVWSRNGPPENPAAWINKVARNHALERLRTGDRRGVLLAQNAEFVDTGPNLQPEATYS
FT                   GEIADDLLRMIFVCCDESLPQSSQLVLGLKILCGLSVREIAFLLFTEAETVQKRLQRAR
FT                   AKLGSKPDDFMENVIAPDPARLSSVRRTLYLLFTEGYHSNSPEACIREDLCNEAIRLTT
FT                   ILAGHAVSDDPETRALLALMHLHHARLPGRTAGNGDLLLLEEQDRSAWDRSHIAEGLRW
FT                   LEGSATGDKFSRYHAEAGIAAEHCLAPSFAETNWERIADLYALLESQSPSMIHRLNRAV
FT                   ATVEYAGPDAGLALLEGLEPPTWLEGSYLWCAVLADIHRRCGNSTEAQEYRLRAAHLAP
FT                   NVHTRMMIERRLRGRPH"
FT   gene            complement(626238..628109)
FT                   /locus_tag="PB2503_03462"
FT   CDS_pept        complement(626238..628109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03462"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08768"
FT                   /db_xref="GOA:E0TDL3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL3"
FT                   /protein_id="ADM08768.1"
FT                   /translation="MTLPTDTSGLPAPLSRALTAKGYDSLTEVQSAMLDEGVSGRDLLV
FT                   SAQTGSGKTVAFGLAMGPDLMRGQARLPRGGVPLALVVAPTRELAMQVAREITWLYAET
FT                   GATVATCVGGMDLRRERQALDRGAHIVVGTPGRLVDHISRDALDLSALRVAILDEADEM
FT                   LKLGFRQELEAILDACAEDRRTLMFSATVGGGIGKLAAQYQRDALRISASGPARSHDDI
FT                   AYKAMVTSQHDAEKAIINTLRFHEAENAIVFCGTRAAVARLTSRLANRGFSVVSLSGEL
FT                   SQQERTNALQAMRDGRARVCVATDVAARGIDLPGLELVIHADLPKDREGLLHRSGRTGR
FT                   AGRKGTSVLVVPPRARRRVEQLFRDAKVDADWIAPPSAEAVLARDDARLLSDPILNEGG
FT                   EADSLAQTLAEAYSAEHLAGAFIRLHRQNRSAPEEISELAVVPPGVKKGRTETTDGAWV
FT                   MLSVGRAHRAEPRWLLPMLCKSAPVPKGSIGAIRVRETETYVQLDKEGAADFLNSLGTV
FT                   GYLEDGIEVRRTDGPPDKEGPREAAVPVTRPRKGRTQRDGQSRSTESFDPLAPTPGQET
FT                   GDSPRFKRKSRAKGKPSEGSGKPGGPKPRQTGPGGGKPLKRPKKRSS"
FT   gene            629476..629736
FT                   /locus_tag="PB2503_03472"
FT   CDS_pept        629476..629736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03472"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08769"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL4"
FT                   /protein_id="ADM08769.1"
FT                   /translation="MPQFIDPQGADKEPLSLIATDDLARLVELARRGLGRKGKPADRVL
FT                   ARLSEVGGPSNAPLPKRRRSRTKSRRLTDFPAMQGTTDSDL"
FT   gene            629733..630224
FT                   /locus_tag="PB2503_03477"
FT   CDS_pept        629733..630224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03477"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08770"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL5"
FT                   /protein_id="ADM08770.1"
FT                   /translation="MTYLLGVDEFIELVDGNPDHPTLQFIASNNNPDIIASAIAYGAAI
FT                   EMVRCDEEMEDETRRLWASKLDVVGEAFRDEDINSLFAINSPDLAGLDLLPFTEREAAV
FT                   WAELKSQPLEGEVDDLDLMIAATAITRGYTLLARPRPWHDSVQPIAGLGRVVLKIVNPS
FT                   "
FT   gene            631000..631233
FT                   /locus_tag="PB2503_03482"
FT   CDS_pept        631000..631233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03482"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08771"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL6"
FT                   /protein_id="ADM08771.1"
FT                   /translation="MKLTRYVTERLGLCEYHLIEGDSTASEDKILKVDSASPEAIKTIA
FT                   SIAERYRIKIGGDEVTKRNLSRILSKNALKRI"
FT   gene            631308..632021
FT                   /locus_tag="PB2503_03487"
FT   CDS_pept        631308..632021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03487"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08772"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL7"
FT                   /protein_id="ADM08772.1"
FT                   /translation="MKIQVPHQAGFFLDPEIKDMMPIAWQEEFAQYRFFYAPAYRDTAR
FT                   QLLGDLTVNSYVGEASSYRRQLAEFVPTQLKSEVPKVQYHDWETLGSDQIRSAMKETNL
FT                   GFSKLVLAMILLQLMTEKRNDLRNTPDTTNVFDKVKIHPALFIFQDFDADKFREIVIHD
FT                   SHMFRELQQATQQRNTFFEDIAEGRPATYHTLEAIRNWLIGKHTDIAVGDIVPITERGQ
FT                   LKPAQKERVRSNQSV"
FT   gene            632334..633044
FT                   /locus_tag="PB2503_03492"
FT   CDS_pept        632334..633044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03492"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08773"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL8"
FT                   /protein_id="ADM08773.1"
FT                   /translation="MTERQKEKRILHVDIDADFNSSQTISYTIDVVFDPSPFSTGIFEK
FT                   VDFYVGSTGVNITIDFFDGEVHGFTEEISISVEYTNDRLIERYADLTISPKIELSSGKA
FT                   SMKTEVGSIHRKKGERYTQSSAFQCREAVLTPIDLGSGVRWLLQQPRSDKAIRDFLAGN
FT                   LHLAASHTPGSATSRGTVTARLSDIRIFDGERRPVSARKSLLMLFKLFEAGMWLTDSKS
FT                   VSFEFELQRADSEE"
FT   gene            complement(633825..634079)
FT                   /locus_tag="PB2503_03497"
FT   CDS_pept        complement(633825..634079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08774"
FT                   /db_xref="GOA:E0TDL9"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDL9"
FT                   /protein_id="ADM08774.1"
FT                   /translation="MSWLDDLQLRDLDEASLIEATCLKCGHTWLENPTQLLLKVIHRDV
FT                   TLREVKDNLACKRPHCTHVGMRIALIRNEDSGGFVGGLP"
FT   gene            complement(634076..635332)
FT                   /locus_tag="PB2503_03502"
FT   CDS_pept        complement(634076..635332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03502"
FT                   /product="UMUC-like DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08775"
FT                   /db_xref="GOA:E0TDM0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM0"
FT                   /protein_id="ADM08775.1"
FT                   /translation="MRKPETIETLYLDFDGFFASVMQQAMPHLRGKPVGVIPFDTASAQ
FT                   YTTVIACSKEAKARGVQNVMRVPEARAICPDIVLVMQRPDLFRWAHGALLNEISCEIPI
FT                   ETVKSIDELCCTLTKSDIGDPQGLARRLKSFIAENIGPHITCSIGYAANRLLAKMACKM
FT                   DKPNGVTIWRPEDMPRPLQDLPLTEVPGIGGRMEKRLAAAGVNQMEGLLDLQPKQARAL
FT                   WGNVTGERLWYALHGYALKAEPTGRGMYGHGRVLPPEWRNLDKAYDCARLLLIKAARRM
FT                   RRDRFYTNRLWVWLDLRKGAWVQCRDIPSAHDDKAILSALDILWEKARDDLARHKIEIV
FT                   RVGVTLSDLTPANARKRDLFHADDEDRQKWERLTADMDGLNRKFGKRVLSLGPLTPPPG
FT                   GYAGGKIAYTRIPSAEDFW"
FT   gene            635491..635895
FT                   /locus_tag="PB2503_03507"
FT   CDS_pept        635491..635895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08776"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM1"
FT                   /protein_id="ADM08776.1"
FT                   /translation="MCNRYANRASIAEMRRLMAALKRILETTSETGNFGGEDVYPDRNG
FT                   VVLRPLGEDRIELAALRWGFPETKAGSRPITNIRNLKSAWWRNVNGEYLLKPEHRCLVP
FT                   FTAFAEPPRSPIWFGLPDQEVAFFAGIWRP"
FT   gene            635998..636147
FT                   /locus_tag="PB2503_03512"
FT   CDS_pept        635998..636147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08777"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM2"
FT                   /protein_id="ADM08777.1"
FT                   /translation="MRPVHEKAMPVILTEPEEWKAWLAGGEDSLKLQHPLDNDRLAIVG
FT                   DPFY"
FT   gene            complement(636144..637199)
FT                   /locus_tag="PB2503_03517"
FT   CDS_pept        complement(636144..637199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08778"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM3"
FT                   /protein_id="ADM08778.1"
FT                   /translation="MLAYSRNSGPVRSGRQPSLYAEIRKVRDELKQHAFGGHPPFSNVS
FT                   LSRWFKGENVSLKNISALVTILNAIFKNKNTLSEGDLTDDLDDLIKKVGVRKADFMKWR
FT                   DALPVPEATHGRSKHAVLDADETATLARFGGVYYCYRDHVKQERVRRTIVIIRRSDESD
FT                   GLQLVMLGPSGNPWKGRLWLSMQSMTARVTRDEGGGLQVNTMTLFRASEGGDNYLYGLR
FT                   GRVSDGDNKYLASYRTFMVRQDDLHVYTDHLNDDEVRKLSERCGDLDPAQEPIKTIRTF
FT                   LNADNPHDPEGVKFEPRPSIVMFYLSMERVARELAGKPDNLIPLGKESSAIPSEEDADQ
FT                   VDHAESDSGSD"
FT   gene            637586..637960
FT                   /locus_tag="PB2503_03522"
FT   CDS_pept        637586..637960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08779"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM4"
FT                   /protein_id="ADM08779.1"
FT                   /translation="MMKSLTIAALIVAAGIGIFWAKPNWKEEAAATLAVQLDKAATYFA
FT                   SNSGDALNSHEAPTALPRLAATSHTYEVRLLVVSLSCEQGRSCTEFLTQSTKVVSGAAF
FT                   TSETRIPVSKAGIETDLEEW"
FT   gene            complement(638322..639752)
FT                   /locus_tag="PB2503_03527"
FT   CDS_pept        complement(638322..639752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03527"
FT                   /product="Piwi domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08780"
FT                   /db_xref="GOA:E0TDM5"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM5"
FT                   /protein_id="ADM08780.1"
FT                   /translation="MSDKRPFGLTAHERLREPLLRFGSTADNDVDVHPLRGLLRYGPYS
FT                   RNWIAGVPDQIRIAMIGQQGMIGKMRGLVSELEATLRPRDAAAYRPDYQGMSKTFGVRP
FT                   VGAGSASEIILPDTLTDDVRRARKPYVVLAEALQRAITQLKATRNDFDVVFIGIDAAWE
FT                   PAFVERDEEDFDLHDYLKAVGASMGVSVQLIRSDKALDYHCRASVMWRLSIALYTKAGG
FT                   VPWVLEDIHPQTAFIGIDYAMRRVQDDGPRFAICCAQVFDAEGSGLEFIAYKADGVSVY
FT                   GDNPYLNHAQMLKIIARSLTIYQRKHYGDLPKRVVIHKNTPFRDEEVDGCLNALSSVDA
FT                   VELIQVQQDTGWRGYRVDAAQKVAGYPVERGSLMPIGAHEALLWSRGDLPDVALRGAHY
FT                   FKEGKGTPEPLLITRHAGRGDFGDVCSDTLGLTKMDWNNDGPYDGMPVTLNYAGRLAQI
FT                   VKRMPDLQPHPYPVRLFM"
FT   gene            complement(639749..641533)
FT                   /locus_tag="PB2503_03532"
FT   CDS_pept        complement(639749..641533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08781"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM6"
FT                   /protein_id="ADM08781.1"
FT                   /translation="MSNSEMNDQSPTSADADLTLDLPSFLRLFQRRGRSIMWLLGAGAS
FT                   RAAGIKTGWDMIWDFKRSIYRSQKGVRDSALPDNTDIRARRLIQRYFDETGDYPLSDDP
FT                   TEYAAYFEAAYHAENDRRRYIEEAVSSARPTHGHRVLVALMDKNLCDIVWTTNFDRLVE
FT                   DAAAAKFETTGRLTDGDLNNPSTVVEAISESRWPVYGKLHGDFQSRSLKNTASELQSQD
FT                   ETLRRALVDACRTRGLAIVGYSGRDGSVMEALTHAIDEGGLSQGLYWFHRGDGEVFPAV
FT                   SDLIRKARAKGIDAHLVEAQGFDEAMSEIATFLPELDGVAANFRTERAGRRAAIQTGKR
FT                   GKKFPVIRTNGFPVTAYPQIARLIGCEIGNAKEVREVLETSGHKGVATRIRDGVIAFGD
FT                   DDDLRAAYSDNDIKEWNTHPILDSRLVRESGERRLLRDALFTAISTASRLELKYRRGET
FT                   LVLAEPSVTPAGRFRGLGNPNVVKGVVAGTRIDWIEVCGLRLDYRDDRLWLLLNPRTHL
FT                   VWNDEASPEDKNKAKDFVRERMARRYNSQSNDLLESWRTILLGADKGEVALTAGPFTKG
FT                   IGASFTINTVSGFSGRSQ"
FT   gene            complement(641520..642242)
FT                   /locus_tag="PB2503_03537"
FT   CDS_pept        complement(641520..642242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08782"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM7"
FT                   /protein_id="ADM08782.1"
FT                   /translation="MSKDEGEVKIDQWDGPTLDAIETALSTDRFAKYVDACGGNRKAAF
FT                   RLYGWNTAISAAFYGPLQTLEVTLRNALNASLSARYGATWYDAAGPGLDAHALKKIDES
FT                   KRGLAKEGHPIDAPHMVANLSFGFWVSLLGAGGRRQSPAPKANYEMTLWRPALRRAFPG
FT                   APKLNRKAAHSPFEHMRLLRNRIAHHEPVHARRLDKDYESILKVLEWMSPEARAWVEAS
FT                   SRIPDLLAQFKDSEHVKF"
FT   gene            complement(642321..642857)
FT                   /locus_tag="PB2503_03542"
FT   CDS_pept        complement(642321..642857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM8"
FT                   /protein_id="ADM08783.1"
FT                   /translation="MSMKTSSAADAENDNEGDGKVVQLRPAKASKASERKWGKPVMDLG
FT                   FCIVPSLLLRAQNRLGLNPTQLAVLMQLCDFWWDDARKPYPSKETLSERLGLSKRQLQR
FT                   YIADLEQAGLVTRIERHHAGHGGKLSNIYDLSGLVAKLKKLEPEFREADEKARETRKAV
FT                   RRRAHRRAAGIKKTA"
FT   gene            complement(643125..644195)
FT                   /locus_tag="PB2503_03547"
FT   CDS_pept        complement(643125..644195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08784"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDM9"
FT                   /protein_id="ADM08784.1"
FT                   /translation="MTVKMQTRGDAIIQDAEAVLKGVKALAQETFTRSDLSGLIEPFTS
FT                   RIEYFLKAVVFPGASRRTTLNTLIDDLAPLGAQSTTLEALHHLRELYNTSKHDPDTELK
FT                   WRRCMETLSGAVAALQDIAGLGLATVDAIFEQDLSSVVYVGFWDHYTGGETEFGLFLPS
FT                   DHWLGTSPISTFHLPMSAWDQVKPLLVGHPRYESGETALGDDLWKSFSEEGDFLNAGVW
FT                   EGDVRELLMLLSPFNDEAQEKAVIPFLARRNDLLSVGVAIVSAAVDVARADPGLAGQTL
FT                   RRRVAERAKKEYAAEVATSLGRAVLDSVSDLLERVPAGQRAALAGPAFRKAETKTAPPR
FT                   DIPLRLDGTTFIWMIA"
FT   gene            complement(644369..644581)
FT                   /locus_tag="PB2503_03552"
FT   CDS_pept        complement(644369..644581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08785"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN0"
FT                   /protein_id="ADM08785.1"
FT                   /translation="MPSRRTISEEEIEDGLNVVARLIDRYGDVYWPVFERLERELEQRR
FT                   SRSARVKSRLNREQYQIQNVDILSQ"
FT   gene            complement(644601..644918)
FT                   /locus_tag="PB2503_03557"
FT   CDS_pept        complement(644601..644918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08786"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN1"
FT                   /protein_id="ADM08786.1"
FT                   /translation="MATIGQFRLTHEGYEGTISTLSMARKVRIVPNGNKKNENSPDFFV
FT                   KTGQCDLGFAHRKMSEGQSPRPYLKVFLDDPSFVEPIWAALFEQDGKADLVWSRPRPTA
FT                   S"
FT   gene            complement(644936..645181)
FT                   /locus_tag="PB2503_03562"
FT   CDS_pept        complement(644936..645181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08787"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN2"
FT                   /protein_id="ADM08787.1"
FT                   /translation="MSATTLKIGPLPDTTPVKLTIAVDPDVNADLELYAQIYEETYKEK
FT                   ASVAALIPSMLEAFLASDSGFKKARKARGPHPNSSK"
FT   gene            complement(645186..646400)
FT                   /locus_tag="PB2503_03567"
FT   CDS_pept        complement(645186..646400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03567"
FT                   /product="conjugal transfer protein trbI"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08788"
FT                   /db_xref="GOA:E0TDN3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN3"
FT                   /protein_id="ADM08788.1"
FT                   /translation="MSAVEQDDSLAIRAKPRPVKRFNKRVLIGVSSVAALLILGAAAMA
FT                   LRTPNRAQEAHTELYNTRHKPMPDAFASLPESYGDMPSRLGPPLPGDLGAAMIGAPRIE
FT                   DAPENPFRYQPARVASTGPASGSPSAADDARTSDLFFINNSAQGERVLAASDGGAPTRL
FT                   DQLASVISPGVEDRTASTGFADAPDPNFQQRKEGFLGAEADDGIYNPHRLQAPISPYQV
FT                   MAGTIIPASLVTGLNSDLPGQVIAQVTENVYDTPTGAHLLIPQGSRLIGRYDSVIAYGQ
FT                   SRALVVWSRIIMPDGSSIVIDNLPGVDMAGYAGLEDRVDYHTWRLFQAAILSSVLSVSA
FT                   ELGRDSNDDEILEALRDGGQRTINQAGLQIITKQLNVQPTITVRPGYRLRVIVNKDIVL
FT                   KPYGD"
FT   gene            complement(646397..647395)
FT                   /locus_tag="PB2503_03572"
FT   CDS_pept        complement(646397..647395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03572"
FT                   /product="conjugal transfer protein trbG"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08789"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN4"
FT                   /protein_id="ADM08789.1"
FT                   /translation="MIRTLVIIGALVSLGACASTNPHDNFVLDDAEFMEAVYLADDPNG
FT                   EPLIIERIEPLAMAGQLKPLTESPIAAVPELKPYEAIDEANRSAAVEPDATSFINAIQI
FT                   YPYTIGALYQVYTAPEQVTDIALQPGEELMSVSAGDTVRWVLGDTVSGSGDASQTHILV
FT                   KPIASGLKTNLIITTSKRTYHIEMTSYRETYMAAVSWRYPHEELVTARGDAARRQAQGR
FT                   TVIDRGLSLDRINFRYEIKGDEPHWRPLRAFDDGRKVYIQFPSRLDQGEAPPLFVVGRN
FT                   GDSQLVNYRINGAYYIVDRLFAVAELRLGEDDQEVVRIERTAAPRNWMAGL"
FT   gene            complement(647392..648090)
FT                   /locus_tag="PB2503_03577"
FT   CDS_pept        complement(647392..648090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03577"
FT                   /product="putative conjugal transfer trbf transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08790"
FT                   /db_xref="GOA:E0TDN5"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN5"
FT                   /protein_id="ADM08790.1"
FT                   /translation="MFWKRQQQKYGTTPEAVTPYQRAAQVWDDRIGSARVQAENWRLTA
FT                   LVALALAFVMSAAFIWRSTQSIITPYVVELETDGRVRTVQSAVADYKPTDAQIAYQLAE
FT                   FVKQVRSVSIDPIVVRENWLKAYAFTTDQAALTLNDYARENDPFAEVGKRSVSVEIQSI
FT                   VRSSQDSFDLRWRETTFRSGVQVSSATYTGVLAIVFDPPRDEETLHRNPLGLYVHGINW
FT                   SKDLAQGGHQ"
FT   gene            complement(648094..649431)
FT                   /locus_tag="PB2503_03582"
FT   CDS_pept        complement(648094..649431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03582"
FT                   /product="conjugal transfer protein trbL"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08791"
FT                   /db_xref="GOA:E0TDN6"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN6"
FT                   /protein_id="ADM08791.1"
FT                   /translation="MEDLGIIDRFLATFSTYIDSGFGLLGPDVAYLTAFLIGIDVVLAG
FT                   VFWAMGPENNIIGTFVKKVLYVGFFALILNNFAFLANVIFESFAQLGLNASGSTITAAD
FT                   LLRPGFVADTGFTAGHPLLEEIGDLTGPVGFFVNFVTIAILFLAWLITLFAFFFLAIQL
FT                   FVTVIEFKLTTLAGFVLIPFALWNKTSFLAERVLGNVISSGIKLMVLAVIVGIGSTLFG
FT                   SVTAEITPGDVTLEDAATVILASLALVALGIFGPGIAAGLVSGAPQLGAGAVVGTAAGV
FT                   GAGAIAGGALAGGALRAGAAATGGAIKAGASLSGGAATSFSLGKAASGANGWRATAAGV
FT                   GAMAEAGARSFASGARSAASRAVAPVKRSFESGGRTAFSATGGTLGDVAAAPAATGGAP
FT                   NWARQVQRQQLQRDASLAAASALRDGANNGSGGGSGDGPRLKQDED"
FT   gene            complement(649444..650163)
FT                   /locus_tag="PB2503_03587"
FT   CDS_pept        complement(649444..650163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03587"
FT                   /product="conjugal transfer protein trbJ"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08792"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN7"
FT                   /protein_id="ADM08792.1"
FT                   /translation="MRRRIIAALLLAAAPMTIAPPAHAIFGIGDIVIDPSNLAQNILTA
FT                   ANTLEQINNQVKQLQNEADMLINQATNLVRTGYNPQVEINRLLNEISVLMDRARSISYV
FT                   VSETDRLFQENFPEDYSTWSRTQMATAAEMQWVSARSAFNDTLLVQSQIVQTLKADTSS
FT                   LDAMLAETAMAEGNLSVSQTGNQIAALGVKQTMQMQEMMAAQYRADALARARDLQIERE
FT                   GREKLARFVGGASAYTR"
FT   gene            complement(650148..652586)
FT                   /locus_tag="PB2503_03592"
FT   CDS_pept        complement(650148..652586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03592"
FT                   /product="conjugal transfer protein trbe"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03592"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08793"
FT                   /db_xref="GOA:E0TDN8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN8"
FT                   /protein_id="ADM08793.1"
FT                   /translation="MMNLKEYRQSNKRLADFLPWACLIAPGVVLNKDGSFQRSAMFRGP
FT                   DLESATAASLVSVCSRINNALKRFGSGWALYFEAAREAATDYPESQWRDPVGWLIDEER
FT                   RGRFTEAGALFESRYTLTFAFLPPADSVNRIEDAFVEKPAEEAGLAAFDHLARFIAETD
FT                   RSLDLIASVVPEARFLTDDETLTYLQSSLSSKRHPVCAPETPAYLDAILGGVDLVGGLE
FT                   PMLGGDHLRVLSLQGFPNATEPGLFDDLNRLGFPYRWMTRFLPMDKSEATKVLGRYRRQ
FT                   WFAKRKSLSAIIKEVMTNEASALVDPDADNKAADADAALQALGEDHVSYGYVTTSVAVM
FT                   DEDAASADEMIREVERIINGRGFVAMNETVNAVDAWLGGLPGHAYANVRQPIIHTLNLV
FT                   HMMPLSAVWAGPVENAHLNGPPLLYATANSNTPFRLVPHQNDVGHMLVVGPTGAGKSVL
FT                   LALIAAQFRRYAGAQVFLFDKGGSARAITAGMGGEHYALGEDRGLCFQPLARIDADAER
FT                   SWALEWISGLLAHEGVAIDPDVKDAVWTALTSLSAAPKAERTMTGLSVLLQSNRLKQAL
FT                   APYTLAGAHGALLDADDETLGQNDWQCFEMEELMHRPSLVPPVLTYLFHRLEARFDGRP
FT                   TLLILDEAWVFLDNPLFSERIREWLKVLRKRNVSVIFATQSLSDISGSTIAPAIIESCP
FT                   SRIFLPNDRALEPQQQDTYRAFGLNDRQIEIIAGASPRQDYYFQSRSGNRLFDLDLGPV
FT                   SLAFCAASSKADHKLIDDVEGAHPKEFAVHWLHARDLAWAADLITATPATQGDVPCAAE
FT                   "
FT   gene            complement(652583..652834)
FT                   /locus_tag="PB2503_03597"
FT   CDS_pept        complement(652583..652834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03597"
FT                   /product="putative conjugal transfer trbd transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03597"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08794"
FT                   /db_xref="GOA:E0TDN9"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDN9"
FT                   /protein_id="ADM08794.1"
FT                   /translation="MTEGFAIPVHRSLTEPILMGGAPRNAAILNGTIAAALGLGLQVWG
FT                   TGILYWIIAHGACVFMAKRDPKFMDVVLRHIRHEGYLA"
FT   gene            complement(652834..653151)
FT                   /locus_tag="PB2503_03602"
FT   CDS_pept        complement(652834..653151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03602"
FT                   /product="putative conjugal transfer protein"
FT                   /note="TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03602"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08795"
FT                   /db_xref="GOA:E0TDP0"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP0"
FT                   /protein_id="ADM08795.1"
FT                   /translation="MTLTKHTCRALAITFGLIVLVGPAHAAGSGMPWEAPLDSILQSIE
FT                   GPVAKIVGTLAIIITGLTLAFGDTGGGFRKLIQIVFGLSIAFTATSFFLSFFSFGGGAT
FT                   I"
FT   gene            complement(653148..654146)
FT                   /locus_tag="PB2503_03607"
FT   CDS_pept        complement(653148..654146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03607"
FT                   /product="conjugal transfer protein traB"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03607"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08796"
FT                   /db_xref="GOA:E0TDP1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP1"
FT                   /protein_id="ADM08796.1"
FT                   /translation="MPIPDARSQTYLRTETMLKTAMGPAVVEALDDPAIVEVMVNPDGK
FT                   IWIDAHGDGRMETGTVMPAAEAERVIRVVGSHIGQEVDRLHPIVSAELPGGGERFEGVI
FT                   PPVTTAPCFSIRKPAARVFTLDDYVETGVTSAEDADALRAAVRDAMNILIVGGTGSGKT
FT                   TLANALLAEVALSGDRVVILEDTRELQCEARDKVNLRTQAGAVAMADLVRSTLRLRPDR
FT                   IIVGEVRGGEALDMLKAWNTGHPGGIATIHANSAGGGLQRLEQLVSEVTAQTPHALIAE
FT                   AIDLIVFIAGRGPERRIRTISRVLGREAGDYRLEPFSSPVSQIVKLKGSSS"
FT   gene            complement(654133..654624)
FT                   /locus_tag="PB2503_03612"
FT   CDS_pept        complement(654133..654624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03612"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08797"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP2"
FT                   /protein_id="ADM08797.1"
FT                   /translation="MPSTKPRIWSYIDPINHARLKALAKRPGSNESQIVNDALTAFFMG
FT                   EHEVKRDAALIRRLDRMTRQAESLNRSQVITAEAFALFVRYFLTVIPPVPDADKRAAQA
FT                   QGAARFERFIESLQTVLADGETVIFAALQDVMSDESAFFTKDELMRLHDPAPEREHADT
FT                   "
FT   gene            complement(654628..656616)
FT                   /locus_tag="PB2503_03617"
FT   CDS_pept        complement(654628..656616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03617"
FT                   /product="conjugal transfer protein traG"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03617"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08798"
FT                   /db_xref="GOA:E0TDP3"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP3"
FT                   /protein_id="ADM08798.1"
FT                   /translation="MLATIVCGVWLSTQWVAAQFSYDAYLGPAWFYVGETPVYYPWRLF
FT                   EWWYAFDAYAPGVFARGGAIAAGSGFLGAFVAAIGSVWRGRQAKNLTTYGSSRWAARKD
FT                   LQTSGMLKPSGVFLGRFNDDYLRHDGPEHVMAFAPTRSGKGVGLVVPTLLSWTQSAVIH
FT                   DIKGENWQLTSGWRSKFSHCLLFDPTNAGSAKYNPLLEVRKGANEVRDVQNIADILVDP
FT                   EGALERRTHWEKTGHALLVGAILHVLYAEKEKTLAQVARFLSDPDRPFEKTLWVMMSTN
FT                   HLGDDGEARPHPVVAQAARELLNKSENERSGVLSTAMSFLGLYRDPTVAEVTSACDWRI
FT                   ADLIDAQKPVSLYLVVPPSDISRTKPLVRLILNQIGRRLTEKLDGQIDGDRRRQVLLML
FT                   DEFPALGRLDFFESALAFMAGYGLRAFLIAQSLNQIEKAYGPNNSILDNCHVRVAFATN
FT                   DERTAKRISDALGTKTEMRAMRNYAGHRLAPWLAHVMVSRQETARQLLTPGEVMQLPAD
FT                   DEVVLVSGLPPIRAKKLRYFEDANFTGRVGSPASTSDRGTPYADRPPSRTEDWGTRRRA
FT                   VDERLVRSSFGNGHDADDGGKDLKPEIDAPAQPDIDAAEQDRSDTPVSDSDEVAIKRAA
FT                   DLARATDTARRAYGVDKGTPKIDLMDF"
FT   gene            657155..658297
FT                   /locus_tag="PB2503_03622"
FT   CDS_pept        657155..658297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03622"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08799"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP4"
FT                   /protein_id="ADM08799.1"
FT                   /translation="MPKSEWHYPREAFAQQIYDLLIDSPASAISIFGPRRTGKTEFLED
FT                   DLAPLAHGKKHRVVYASMWQTLDAPLASLLYAFDTTLRGGKLTDRLAAAARDLAPKLKL
FT                   KPPGSGAEIEIDVGALRGKPQDNHLLLLDQYCERLANDKRPTFLLFDEFQELARTEISA
FT                   PIIAALRTSLDIRQKGLVSIFTGSSQDGLRKVFSAKDAPFYRYATQMTLPTLDEAFVDH
FT                   QLKVYKSKAKRAIERTEALRVFDKVERNPLFFQQWLIAMMAHASLTPKTALTHVLDGFG
FT                   EQFGFADTWNDLKPLQRATMRLLADHVDQIYADASTTKLARMTGEDAPTRSKVLSAVRR
FT                   LSRLGVAEKLEDRWSLNDPLLEVWVRARPDTDFIEAGSQT"
FT   gene            complement(658329..660245)
FT                   /locus_tag="PB2503_03627"
FT   CDS_pept        complement(658329..660245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03627"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08800"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP5"
FT                   /protein_id="ADM08800.1"
FT                   /translation="MTGDGDRFEVRLRRMRSPSGARKVEGFFRKVSKGARKLGRGGGRG
FT                   RSQRSAARTQFYRRVLVKVRVIRMDPKGRLAQKLHLNYVERDGTGPDGEPSRLYDRHGP
FT                   DADKQAFLERGAEDRHQFRIILSPEDAGELSSLTEFTRDLTSQMERDLGTRLDWVAVDH
FT                   YDTGQPHTHLIVSGKRDDGHDLVIPRDYISRGLRERAQALVELELGPVPETDGRARMAR
FT                   MVGQARFTEIDRALFRRARESVVDLSEPHRPGDGWRRQIERMRLGKLQGMALAEPLGKG
FT                   RWRLVDHAETDLRRMGERGDIIKAMHRAMRDKGVARTLDAGAIFDPASEGARPVTGVIL
FT                   DKGVADDVNDRAFIVVDGHRGRPVHVVVGGEDRLASLETGRIVTVAPPNRDPRRADHVI
FT                   AEIAAANEGRYSSALHMAHDKSARPEFVAAHIRRLEALRRAGHATRASDGSWRVPEDYL
FT                   DRAGDYEKAAALRRPVEIRVHSSLRLAQMQSAMGATWLDEHLRDFDDAGAVHGFAGEVE
FT                   AARIARRQFLMQQGLINREHGRLPQSVLDRLEAHDLKDAGDALAETLGKPYAPAPAAGR
FT                   VRGIYTQAIERPSGRYAVIERTRDFTLVPWRDVMDRNLGKSVSGLIRDGGISWTLTRGR
FT                   GIG"
FT   gene            complement(660427..660990)
FT                   /locus_tag="PB2503_03632"
FT   CDS_pept        complement(660427..660990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03632"
FT                   /product="plasmid transfer protein traf"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03632"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08801"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP6"
FT                   /protein_id="ADM08801.1"
FT                   /translation="MAARLIAGTAAAIVCAAAVVQIAAPPNPLVLYNPSESAPVGWYRI
FT                   DADGTVKRGAMVAAYAPDEARLLAHERGYLPSHIPLIKTVWAVAGEEICSEGGVIRAPN
FT                   RPDIYALAQDGSGREMPVWTGCIILRSDEIFLVSADVQTSFDSRYFGPVPVKNVLGTVD
FT                   FVGPEPDRSGAPGAQTGRARDERQ"
FT   gene            complement(660975..661430)
FT                   /locus_tag="PB2503_03637"
FT   CDS_pept        complement(660975..661430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03637"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08802"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP7"
FT                   /protein_id="ADM08802.1"
FT                   /translation="MRDPEEGRLTVVILQYRKNRLNHRLVFGTARFVVRRGWRRRLAAF
FT                   APDATFGYERWQAGEHGTRDWRLFVCRTSSQGSLTKIPGVLPGAVLLLEARGKTKVKRA
FT                   FVALDALRREGESLEDLAPHRWRALYNALQTRPSTLSDGRNPSWPRV"
FT   gene            complement(661417..661671)
FT                   /locus_tag="PB2503_03642"
FT   CDS_pept        complement(661417..661671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03642"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08803"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP8"
FT                   /protein_id="ADM08803.1"
FT                   /translation="MEHAKKPPVESPYFTAAEAAAYLRLEESTLNAMRWRKEGPNWRKH
FT                   GGKVVYHRDALDRWSRLRDSDPAVRNASNGDMSGDDARS"
FT   gene            complement(661810..662661)
FT                   /locus_tag="PB2503_03647"
FT   CDS_pept        complement(661810..662661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03647"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08804"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDP9"
FT                   /protein_id="ADM08804.1"
FT                   /translation="MNEQADSGIQSNRAGDPPARHLRLPYAAWAWEYLRRNRDYARDYR
FT                   SSLAGRARPIPLNTGAVLIRKRRRWRDAERWGLLCFADPERSCDDANIFWRPDLLAGAL
FT                   PIQLIRLGNTDSHAASERHDEIELRRLQTRRVILDTVDGARHIALCGRRFWVQLVCDSP
FT                   ASIGERCAIEVKINSTLHYQRKLDTASQLLSLYHSAGGKISLIGRSRDSTRLAQGLIAI
FT                   DIVNAGGSHRDVAEAIYGADKVAERWGGPSHYYEDWARRLVARARFMVNEGYLGLLSKK
FT                   TL"
FT   gene            complement(662793..663131)
FT                   /locus_tag="PB2503_03652"
FT   CDS_pept        complement(662793..663131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03652"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08805"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDQ0"
FT                   /protein_id="ADM08805.1"
FT                   /translation="METKIMAQALGYVTQTENGEYEGTLAMGVNARIRIARNAAKEPGS
FT                   KQPDFRIFSPQFGELGGGWTRTGKTSGREYVSLTLAHPMISTRRVYANLGPASGGQDGE
FT                   FALLWNAA"
FT   gene            complement(663513..663752)
FT                   /locus_tag="PB2503_03657"
FT   CDS_pept        complement(663513..663752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03657"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03657"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08806"
FT                   /db_xref="GOA:E0TDQ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDQ1"
FT                   /protein_id="ADM08806.1"
FT                   /translation="MNARDIVARNVRKRRAELGLSQDEVGARADSSGNYIGMIERSETS
FT                   VSIDMLADIAEVLGVSLRDLVDPDWTGVEHGSAN"
FT   gene            663851..664135
FT                   /locus_tag="PB2503_03662"
FT   CDS_pept        663851..664135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03662"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08807"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDQ2"
FT                   /protein_id="ADM08807.1"
FT                   /translation="MKHPVDIERLRIFMTQSGFVALDCENLSAEENARLFGDDGVCEPV
FT                   ALHALVRELLAVQAAASGEADAAAMSRLADSLQCCLDDVGAALASQRGA"
FT   gene            complement(664139..665866)
FT                   /locus_tag="PB2503_03667"
FT   CDS_pept        complement(664139..665866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03667"
FT                   /product="partitioning protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03667"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08808"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDY7"
FT                   /protein_id="ADM08808.1"
FT                   /translation="MKLQHIPVEQLKVSKLNMRHERRKPDISDILPSIRERGVRQALLV
FT                   RKEGQHYGVVAGRRRLFALKQVAKETGKSLTAPCGVLGPGDDAEAIEDSLLENIARLPP
FT                   GEFQQYDAFARLVQAGKSAEDIAATFGITELKVRRVLALANLLPDIKRLYEDDEVDAGT
FT                   LRALTLATPDQQESWLKLVADPNEHAPRGERLKAWLTGGARIFTKAALFDLAAYDGHIL
FT                   TDLFGDSAIFADPDLFWSCQNAAIAERIDAYKAAGWRAVEILERGAFWSSWEYVKRPKT
FT                   KGGCIYVETRHDGTVAFHEGYVSQKEAQRLEGATKGEKDAAAPEKPEMSGPLGEYVTLH
FT                   RHAAIRARLPGHPGVALRIAVAHLLIGSALWRIDADPQRTRKQATADSLADSEGERLVR
FT                   EEAAHVCAMLGFENPERGIVRQSGDGWTTAKVFARLLEMSDSDVLRILALAMAESLEAG
FT                   SPMVEALAQTIEPDLAALWTPDEAFFDLLRDKRVINAMVADIAGEAAAKACLTETGKAQ
FT                   KQILRNRIDGKRCKASPDWRPRWMTDVPTAYLAANGCPPVAAAEKARSAISEGKKAVA"
FT   gene            complement(665905..666384)
FT                   /locus_tag="PB2503_03672"
FT   CDS_pept        complement(665905..666384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03672"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08809"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDY8"
FT                   /protein_id="ADM08809.1"
FT                   /translation="MTFTETFGGFVCEGDAIHCEKDGYHVTARIVRDDCPDAPDERQDG
FT                   FWPSLYKDAPGFIGPGKNFRQRFDDAQARAEHIMEAWRKDDWFYCGVVLSVSFAKIHLL
FT                   DHAASLWGVEANYPDTDNSYLTETANELLAEALDAARAEQARLCATLCNQDTATC"
FT   gene            complement(666381..666575)
FT                   /locus_tag="PB2503_03677"
FT   CDS_pept        complement(666381..666575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03677"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08810"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDY9"
FT                   /protein_id="ADM08810.1"
FT                   /translation="MARFQAKPREDGKGPYRWAHVVRSRKGFRLGSIYRQIGDDLNPDE
FT                   TRALTQICAREGFDLRRVP"
FT   gene            complement(666591..667169)
FT                   /locus_tag="PB2503_03682"
FT   CDS_pept        complement(666591..667169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03682"
FT                   /product="putative antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03682"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08811"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="InterPro:IPR041893"
FT                   /db_xref="InterPro:IPR041895"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ0"
FT                   /protein_id="ADM08811.1"
FT                   /translation="MTTPANTAPLGTPAGRSCETPQRDDCRIYVACLAAYNNGILHGRW
FT                   IDAASGEAHIWDETRAMLAASPIPNAEEWAIHDYEGFEGASLEEYSSFETVVALAEFIG
FT                   EHGRLGAELYSHFGNALEAARAAFEDYAGEHKSLAHFAEDLNLECGPVIPKRYEYYIDW
FT                   EAMGRDMELSGDVFTIETGFEEIHVFWSR"
FT   gene            667576..668427
FT                   /locus_tag="PB2503_03687"
FT   CDS_pept        667576..668427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03687"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08812"
FT                   /db_xref="InterPro:IPR040556"
FT                   /db_xref="InterPro:IPR041584"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ1"
FT                   /protein_id="ADM08812.1"
FT                   /translation="MMILIMDEERRRHLEQELPDGFSRDLLDGALRVLADQDNPMRAHL
FT                   FAVGLRELFTYLLHNAAPDDEVRACDWFRQAPDTPGVTRRQRAVYASQGGLSDEYVANL
FT                   GVDVADLHRQAITAIDALNRATHVRPGRVLADAEEIVAFVEAAVSALEGLLEAFKTCRE
FT                   TVKEVLESEVYNQMMAAFVERTFGDIDLVASHGYEVDPFIAIDSIDIAGITASEILIVV
FT                   VGEAPVTLHYGRGDDATEIAHDFPFTMQLTAPTDAPGDVAFSDCEIDDSGWYGDGDDDD
FT                   DE"
FT   gene            668414..668515
FT                   /locus_tag="PB2503_03692"
FT   CDS_pept        668414..668515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03692"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08813"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ2"
FT                   /protein_id="ADM08813.1"
FT                   /translation="MTTNKAARQTSLLAMKQDIIRELFVKTARENAR"
FT   gene            668515..668622
FT                   /locus_tag="PB2503_03697"
FT   CDS_pept        668515..668622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03697"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08814"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ3"
FT                   /protein_id="ADM08814.1"
FT                   /translation="MAIRYYDEFARVEGTWYFANRTLIIDWSEIEVSAA"
FT   gene            complement(668662..669228)
FT                   /locus_tag="PB2503_03702"
FT   CDS_pept        complement(668662..669228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08815"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ4"
FT                   /protein_id="ADM08815.1"
FT                   /translation="MTISLYDLSVPTFLQTSRAIGNVLDRAVQYCGEAGANPDDFVEVR
FT                   LFDDMAPFHFQIEALKNHSVWGLKTVKTGAFTPPPLVGPMPFSDLQAIVRQAIADLEAL
FT                   TPDEVNSWSGKDLEIDVFRPLDPANASTSKWGPQRLAFTPETYLLTYSLPNFYFHVVTA
FT                   YNILRAQGMPIGKGDYEGTLRSKPA"
FT   gene            complement(669780..669905)
FT                   /locus_tag="PB2503_03707"
FT   CDS_pept        complement(669780..669905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03707"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08816"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ5"
FT                   /protein_id="ADM08816.1"
FT                   /translation="MMWRKMLGILLKRTKRDSHVSKRSIPSFFRIAASAKLDRFV"
FT   gene            670162..670686
FT                   /locus_tag="PB2503_03712"
FT   CDS_pept        670162..670686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03712"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08817"
FT                   /db_xref="GOA:E0TDZ6"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ6"
FT                   /protein_id="ADM08817.1"
FT                   /translation="MSSTDSKDEALTVEHYKRKQPMISQKAKYALRAMVLLARAHAEDE
FT                   ALIIADISERQNIPKKFLEQILLDLKRHGLLDSRRGKNGGYMLLRPADQITFGEVLRII
FT                   EGPIAPLPCLSKMAYRKCEDCDGEKSCEIRRVFAEVADATRAVLDKTTIADAIADERLA
FT                   PANLRGKARRR"
FT   gene            670762..672495
FT                   /locus_tag="PB2503_03717"
FT   CDS_pept        670762..672495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03717"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08818"
FT                   /db_xref="GOA:E0TDZ7"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ7"
FT                   /protein_id="ADM08818.1"
FT                   /translation="MTVDQLWIILILAGAMAAFALNRWRTEVVAVAALSAAVLAGLVNF
FT                   SSVFAGFSNSAVITVVEILMLTQLLARSGLVDRVARPILSRLASERQLILFLACGGAGL
FT                   SVFMNNIGALAIMLPLAYAGCRRLGVAPQTVLMPLSFATLLGGMCSLIGTPANLVVSGA
FT                   REENLGAPMGFFVFAVVGLPAVLAGLLWLGLFHGERGARGSGGGEHPREEDEAVERIVF
FT                   EWPVSKDAAWVGKSLEEIEREESIEILNVVRREEFVFARRDDIRLQAGDIIVLAAPHRL
FT                   FDRLWKGDENSVGDHRAWPIREAVVTPSSVVLGSTVGSIAPFDTHSVEVIGVRGANLRV
FT                   DGRFADIKISIGDVLLLQGDDDAFAGALEQAGCLALAGRSDTPPGRITPFAAIALGCGI
FT                   LLSATQITPPEIAFGLSLAGMAIAGAASLPELLRRIDWRVVIMLAALIPLAHAFETTGA
FT                   AAAMAGPILQLALSDKVMLALALWAVATLITPFLNNVATAAILAPIALAAAEASNASPD
FT                   MLLLAVAAGASTDFLTPFGHHNNTVVMGAAGYELRDFLRRGAPLTVITGVVTVLSLAIF
FT                   Y"
FT   gene            672637..672828
FT                   /locus_tag="PB2503_03722"
FT   CDS_pept        672637..672828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03722"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08819"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ8"
FT                   /protein_id="ADM08819.1"
FT                   /translation="MTDRRKTLTDERCSTETPNPAPNQNVIERISAALDCLEYGAVTVT
FT                   VHASKVVQIDVTERLRFT"
FT   gene            672903..675254
FT                   /locus_tag="PB2503_03727"
FT   CDS_pept        672903..675254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03727"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03727"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08820"
FT                   /db_xref="GOA:E0TDZ9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E0TDZ9"
FT                   /protein_id="ADM08820.1"
FT                   /translation="MIARFLLSVSILPIVAGAAAAQTIENDEFKSETGPAVQDVVLVTA
FT                   RRVEEDIQSVPIPVTALAGEFVTNSGASNIGGIDLLVPSVQFYTTNPRNSAVNIRGIGA
FT                   PFGLTNDGIEQGVGLYVDGVYFARPASATLDFLDVEQIEVLRGPQGTLYGKNTTAGAIN
FT                   VTTRKPQFEPNARVELSYGNYGYLQARGALTGPLTDTIAASIAFSGTQRDGVLYNTATQ
FT                   DDLNDINNIGVRGAILFAPSDSLSITLSGDVTRQRPEGYAQVFAGVIPTLRPEARQYAA
FT                   QAAYFDYAPPSLDPFDRVTDLDSPHRSYQDLGGASLTVDWETAIGDFTSITAWRYWDWG
FT                   PSNDRDFLGLPIVTVSQNPSKQFQWSQEFRLAGDITDSLDFVVGAFAFNQVVKTYGQQE
FT                   NGAAAFRFLLNPSTPGYDTPGLLDGYGFTSDIRSEHSSAALFGQIEWHATDRLRIIPGL
FT                   RLNYDEKDGHYRTTLYGGLDTSDDPALRALQRGVLSAQDYASSGDDTNVSGQLTVAYAV
FT                   ADNINAYATYATAFKTFGLNNNGLPTSDGQPLVELATIEPEDVRHIEIGLKTQPFPGVT
FT                   ANLTAYETTINDYQVNVVNGQSGVLRGYLANAEEVRVRGVEFDANARLADWLSLYGSLA
FT                   WADGEFVSFENAPPPLEQAGGSIAVVDASGTRLPGLSEWTISVGGELSQRGDLLGRSGE
FT                   FYLAADAYYRSEFSSSPTESAYLNVDGYTLLNPRVGFRGDDGWEVFAWSRNALETEYFE
FT                   SLAAGQSSSGYYAGALGDPRTWGVTIRGEF"
FT   gene            675365..677236
FT                   /locus_tag="PB2503_03732"
FT   CDS_pept        675365..677236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03732"
FT                   /product="trkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03732"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08821"
FT                   /db_xref="GOA:E0TE00"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE00"
FT                   /protein_id="ADM08821.1"
FT                   /translation="MGSSDIRALPTIGRRGLMDSLATHSAMEIGFVLFLVVIVFFGFVR
FT                   ERFPADIVALLAMGALLLTGILSTKEVLAIFSNSAPITIAAMFVLSAALERTGVIDEGG
FT                   RLVARLAKNASPMIAIIAMMAGVIILSAFINNTPVVVILIPVAISLAKSIGVAPSKLLI
FT                   PLSFASIFGGTMTLIGTSTNILVDGVAQSGDLAPFGMFEITGAGACLALAGAAYVALVG
FT                   RFLLPERETLAAILPDIKNRRFLAEIFIPIDSPLVGKSIRETGFSAEKGFSVIDVFRSG
FT                   QSLRSRLDELALEGGDRIVLRSPVSEMLTLREAGSVAVGAEANTRPSFEPVRTSETVLM
FT                   EGVIGAQSRLVGRPLTGGGLARLYGVYVLAIHRRGENIGLQRDKIRFDVGDTVLLEGPP
FT                   KGMRQLFDEGDFNNLTETSERAIKRGQAPIAIAAVLLVMGLAAFEILPIAALAIIAATI
FT                   VVAVGCLDHQEAYKAIHWDILMLIFGMLALGLAMEKTGAAALIVNNLASLVGGLGPVAI
FT                   LAALYLFTSVMTEIISNNAAAILLTPIAIGLGHQLGIDPRPFVVAVMFAASASFATPIG
FT                   YQTNTLVYTAGGYRFTDFLKIGLPLNIVMLVVAVLVIPIFWPLTALN"
FT   gene            complement(677339..678736)
FT                   /locus_tag="PB2503_03737"
FT   CDS_pept        complement(677339..678736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03737"
FT                   /product="possible phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03737"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08822"
FT                   /db_xref="GOA:E0TE01"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE01"
FT                   /protein_id="ADM08822.1"
FT                   /translation="MDQDNRHLKRKRAYWHYQRRVPKRYESIDDRGVVECSLRTKSIEI
FT                   ARLRRDAMEESDNLFWASLAGMDGETETGEAQARKRQVAERRYNAAAVRALARGFVYTP
FT                   IDQLAETPDLGDILDRIKVIKSADKGAPSQSEEAEAEALLGTVSSPPATVSSAFELYCD
FT                   EIAADELIGKSEAQKAAWKKTKNRGVQYFIDVVGDKSMREITRQDAQQYYNWWKDRVVP
FT                   KPGKKALSTKTANRDLGNMRKLYGEYFKYIGEEDRPNPFRNLSFKDKKSADVPPFEDQW
FT                   VREKILVPGALKGLRGDADLILYALIETGCRPGEIANLLAEDINLDGDAPYISIRPKSD
FT                   REIKTASSIRQIPLVGVSLEAMRQAPNGFPHYRDKPDLLSANLMTAMKSRNMFPTPDHK
FT                   VYSFRHSFEKRMQEAELDYGFRCMIMGHRNSRPAYGDGGSMAYRRDQILKIAHPVSDRL
FT                   KESIRSK"
FT   gene            complement(678862..678936)
FT                   /locus_tag="PB2503_t07306"
FT   tRNA            complement(678862..678936)
FT                   /locus_tag="PB2503_t07306"
FT                   /product="tRNA-Gly"
FT   gene            679135..679641
FT                   /locus_tag="PB2503_03742"
FT   CDS_pept        679135..679641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03742"
FT                   /product="DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03742"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08823"
FT                   /db_xref="GOA:E0TE02"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE02"
FT                   /protein_id="ADM08823.1"
FT                   /translation="MPPSPQTDPAVQWLTSQAYAVEWVEHAATPRVANALAQGRAPGPG
FT                   HSKSLLLTDKSGALILVTVPAMVRANLRGLSEALGTGRLSFAAPDTMEQSLGVSPGSLT
FT                   PLALINDDERRIDRVVLATELISSPTIWCHPLRNTASVGLSPEALIAFVTAFSRQPPLS
FT                   LPVTT"
FT   gene            679693..680634
FT                   /locus_tag="PB2503_03747"
FT   CDS_pept        679693..680634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03747"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03747"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08824"
FT                   /db_xref="GOA:E0TE03"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE03"
FT                   /protein_id="ADM08824.1"
FT                   /translation="MTDPIAPAAQNNALIKDATIETFQADVLQASMSVPVVVDFWASWC
FT                   GPCRQLGPLLEAQITARGGKILMVKVDTDQNQLLAQQLRIQSLPTVMAFVGGQPVDGFQ
FT                   GALPDSQIGQFLDRVEQIAAQAGLGGGQGETDPEAMLDDAEALLDQGDVATAMQIFAGV
FT                   ADATEAGSDAQARALAGLARCALSAGNKDQASDMLKAIPEEKQSLPAVSRAQALLELGG
FT                   NAPDSAALTAARDRAQQSPEDPAALFALGEAEIDNGSVDAGMDALLKSIALDKDWDEGA
FT                   ARQKLLKLFDALPPTHPSVKTGRRRLSSLLFA"
FT   gene            680690..681349
FT                   /locus_tag="PB2503_03752"
FT   CDS_pept        680690..681349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03752"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08825"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE04"
FT                   /protein_id="ADM08825.1"
FT                   /translation="MPKRYEGRLPETIALFPLRSAVLLPRARLPLNIFEPRYLAMTDYA
FT                   LGHQRLVGMIRPRFDDDVSPPLYSVGCAGRIISFSETGDGRYLIELTGVSRFRLIEDAQ
FT                   DDRGFRKGVVDWQPFVADRHDPQEEDPALRERVLELLVRFLDGVGLSADWDTIEGASAE
FT                   TIVNSVSMTCPFEPDEKQALLEAEGLRQRAETLIALMEMAVADTPQKESGHGGQLQ"
FT   gene            681346..681537
FT                   /locus_tag="PB2503_03757"
FT   CDS_pept        681346..681537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03757"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08826"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE05"
FT                   /protein_id="ADM08826.1"
FT                   /translation="MTTVDAPDPKLLTLLVCPVSRGPLSYDKEMGELVSAKARLAYPIR
FT                   NGIPIMLEAEARRLDDPA"
FT   gene            681625..682164
FT                   /locus_tag="PB2503_03762"
FT   CDS_pept        681625..682164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03762"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08827"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE06"
FT                   /protein_id="ADM08827.1"
FT                   /translation="MKPISFLQFCLPVVVGCAAISFGLPQASEAASASTPAFTTSTTSA
FT                   SGLPIPRFVGLRKDRVRARFGPSFDYPVSYEFSMKGLPLKVIGEDRDNIWRRVEDRDGQ
FT                   RMWIHRSMLSANSHAVVQAPEAILRTGPGATNAARARLANGVFLKLETCEAGWCRVHAG
FT                   EYRGWLPATSLWGADS"
FT   gene            682339..682887
FT                   /locus_tag="PB2503_03767"
FT   CDS_pept        682339..682887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03767"
FT                   /product="3-hydroxydecanoyl-ACP dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03767"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08828"
FT                   /db_xref="GOA:E0TE07"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE07"
FT                   /protein_id="ADM08828.1"
FT                   /translation="MSETTPTSERRHSYDKEALIECGMHGLRGPGTAQLPVPPMLMFDR
FT                   ILSITEDGGKHGKGQVIAELDITPDLWFFECHFPGDPVMPGCLGLDALWQLVGFFLTWG
FT                   GSPGHGRALGAGQIKFSGQVQPSVSLVRYEIDIRRAMRGRLILGIADGVMFADDVPIYK
FT                   ASDLRVGLFSQDQLSATGL"
FT   gene            682969..684189
FT                   /locus_tag="PB2503_03772"
FT   CDS_pept        682969..684189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03772"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03772"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08829"
FT                   /db_xref="GOA:E0TE08"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE08"
FT                   /protein_id="ADM08829.1"
FT                   /translation="MRRVVVTGVGIVSSIGSTVSEVLDSLRNGKSGLSFAPEMAEHGFK
FT                   SQVHGRPQIDVNDLLGRKTRRFMGEGAAWNYIAMRDAIEDSGLRPEEVSHEMTGIVMGS
FT                   GGPSTKTIVSAANTTLETGSPRKIGPFAVPSAMSSTNSATLAVPFEIKGLNYSISSACA
FT                   TSVHCVGHAYEQVAMGKQDVVFAGGGEDLDWTLSNMFDAMGAMSSKFNDVPEMASRAYD
FT                   AARDGFVIAGGAATLVVEALDRALARGAKIWGEITGYAANSDGVDMVMPSGEGASRCIA
FT                   KAISTVKQRIGYINTHGTATKIGDSREVGAIKDVFGDDIPPFGSTKSLTGHSLGAVGAQ
FT                   ELIYGLIMMKNRFLAASAAIETLDPEFEGLPILRERQDNVDLRAFLSNSFGFGGTNACL
FT                   AIERFDG"
FT   gene            complement(684343..685458)
FT                   /locus_tag="PB2503_03777"
FT   CDS_pept        complement(684343..685458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03777"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03777"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08830"
FT                   /db_xref="GOA:E0TE09"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE09"
FT                   /protein_id="ADM08830.1"
FT                   /translation="MAACTTAPGAQQSALLGRGGATQPLIVAPHRRMRITVCTRPFRAA
FT                   GPRLEAQRFGETTVIHNYGHGGSGWSLAWGSAHEATKLVMEERPSRVAVVGAGAIGLTT
FT                   ATYLAKLGIPTTIYAKEFPAETRSARATGTWSPDSRIALKGETGPDFPAMWERLARKSF
FT                   ATHQYYVGMTGHPVEFSYRYYLSDSAEPTPQSHSGAGPHFADYDDRLDDMTPPAEDLPR
FT                   SAHSFPVVRARRRISMTFNVSEYSRRLLADYLAFGGRIERADFGSPDDVLALDETTIVN
FT                   CTGYGARQLWGDDSLIPVRGQIGWLAPQPNALYGAYYNGVGVLSRRDGVILQVHGDTEA
FT                   WGYQIDNEAPDREEFDRAIATIAPLFENWRG"
FT   gene            685680..686501
FT                   /locus_tag="PB2503_03782"
FT   CDS_pept        685680..686501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03782"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03782"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08831"
FT                   /db_xref="GOA:E0TE10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE10"
FT                   /protein_id="ADM08831.1"
FT                   /translation="MASMDQFPSGTLLEGKRGLIMGVANKNSIAWAIAQQLKAQGAELC
FT                   FSYIEAMESRVRPLADEIGVDFLVPCDVTQDDSMAACFGAIEEKWGKMDFLVHSIAFSD
FT                   KEELKGSFVENTTRENFKQSLDISAFSFVDAAKRASKLMPDGGSMITLTYLGSERVIPS
FT                   YNVMGVAKAALEAATRYIARDLGPQGIRVNAISAGAIKTLSLGGISGGRSLIAEGRTWA
FT                   PLREDTDPIGVAGAALYLLSDLGKSCTGEVHHVDAGFHIVGMPDPEALKGD"
FT   gene            686691..687398
FT                   /locus_tag="PB2503_03787"
FT   CDS_pept        686691..687398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03787"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08832"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE11"
FT                   /protein_id="ADM08832.1"
FT                   /translation="MMKKTMLTIGAAGLALGTSASFAQVQGNSSYATVPSTSSVSTTTN
FT                   YAQPSYSGGAAKEYGAYLGLGYTFLDLETNDDIGDSTSAVTARFGYALNRELSLEVEGS
FT                   FGVDSGSFDFEEDEEDFEIDDNDDGDLDDVLIADGDLGLDYLFAAFVRYGVPVSDALKV
FT                   SGRVGYAFAEIDSTVELASTEIEFGGSEDGLAFGAGLEYTFTPSSTLLLDYTRYEFTDS
FT                   NGDAVTAMYQYKF"
FT   gene            687534..688739
FT                   /locus_tag="PB2503_03792"
FT   CDS_pept        687534..688739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03792"
FT                   /product="putative periplasmic dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03792"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08833"
FT                   /db_xref="GOA:E0TE12"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE12"
FT                   /protein_id="ADM08833.1"
FT                   /translation="MLSRLLLASVAVIGLSPLTAAAQDSAPSEKAVRLAKETVILDGHV
FT                   DIPFRLFLRPEDISVETEGGDFDYVRAMEGGLNAPFMSIYVPARLQDTPGAAKAHADEL
FT                   IALVEALETDHPDKFEVATSVADVKRITKAGKIALPMGMENGAPIETDLSRLDEYYEKG
FT                   IRYITLAHSKPNAISDSSYDINRPNGGLSPFGKEVVTRMNELGIIVDVSHISDAAFWDV
FT                   MELTDVPVMASHSSARAFTPGFERNMDDNMIKRVGEENGVIMINFGSAFLKGAFTDWQQ
FT                   KKGAAFARYLKAEGIDEPDMAVRFAFDAGYAAAEPKPYATVDDVLDHIDHVVELAGVES
FT                   VGLGSDFDGVGDSLPVGLKDASDMPNLVQGLMDRGYSDKEIKMMLSENAFRVWTAVEMA
FT                   AK"
FT   gene            complement(688748..689515)
FT                   /locus_tag="PB2503_03797"
FT   CDS_pept        complement(688748..689515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03797"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03797"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08834"
FT                   /db_xref="GOA:E0TE13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE13"
FT                   /protein_id="ADM08834.1"
FT                   /translation="MSDAQHLSGRTALITGVTSGIGRALATEMTGRGAHVIGTGRRGDR
FT                   LSALGTALGEAFHGLVLDMRDRAALASIEDRFPAGVVPDILVNNAGLALGLGGADQADL
FT                   NQWDEMVETNILGLIHLTRAMLPLLKQQPRADIMNVSSVAGTYPYPGGNTYGGTKAFVT
FT                   QFSLNLRADLLGSQVRVTSIEPGMTETEFSTVRFSGDTAKAADVYRDTTPLTAEDIAKI
FT                   MADILSYPPHINVNRIEIMPVDQAFGAFPVNRG"
FT   gene            complement(689595..690017)
FT                   /locus_tag="PB2503_03802"
FT   CDS_pept        complement(689595..690017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03802"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08835"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE14"
FT                   /protein_id="ADM08835.1"
FT                   /translation="MAYWLMKSEPSTWSWQDQLAKGEAGEPWDGVRNHQAKNYMQEMKK
FT                   GDLAFFYHSQKDREIVGIVEIIEEAMPDPTAAPDSPWECVTIAARETLDAPVTLAQIKD
FT                   TPDLAEMVLVKNSRLSVQPVTSDQWALICKMGQAGA"
FT   gene            complement(690084..691358)
FT                   /locus_tag="PB2503_03807"
FT   CDS_pept        complement(690084..691358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03807"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08836"
FT                   /db_xref="GOA:E0TE15"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE15"
FT                   /protein_id="ADM08836.1"
FT                   /translation="MTETINDLPQVMLEGAKAARAASRTMGTLSAEKRVEALEAIARHL
FT                   EAAKDDILSENKKDLDAAEDNGLDAPMVDRLRLDDERLGGIIQGVRDVAALDDPVGDVL
FT                   AEWERPNGLKMSRIRVPLGVIGVIYESRPNVTVDASVLCLKSGNAVMLRPGSDSFHTSR
FT                   RLVECVRAGLKEAGLPEGAVFMVPTTDRAAVGHLLSGLEGNLDVIVPRGGRSLVERVSQ
FT                   EARVPVIGHLEGICHVYVDKGADLEKAKAIVVNAKLRRTGVCGAAETILIDKARADELV
FT                   PEIAGALIDAGCEVRGDETAQARHDGIVPATEEDWSTEYLAPIVSMRVVDGVRGAIDHI
FT                   SHYATGHTESILTEDEDTAEAFLREVDSAIIIHNASTQFADGGEFGMGAEIGISTGRIH
FT                   ARGPVGCEQLTTFKYVVRGDGQTRP"
FT   gene            complement(691339..692427)
FT                   /locus_tag="PB2503_03812"
FT   CDS_pept        complement(691339..692427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03812"
FT                   /product="gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03812"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08837"
FT                   /db_xref="GOA:E0TE16"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE16"
FT                   /protein_id="ADM08837.1"
FT                   /translation="MTVTAPDLIESAKLAVVKVGSALITDTDHFTMGGLAGDIKERPWH
FT                   AVLVSSGAVAVGNERVPTLDPKQTEDRHALSAIGQATLITMWQSAFDAYNKVAAQVLLT
FT                   PDVTDDRSRYLNARAALRALFDNGVIPIVNENDAVTTRDFRYGDNDRLAAKTAGLIGAD
FT                   LLIILSDVDGLYTSNPSKDPDAKHVSYVPYGEASRYFEAAEDTKSGGVGTGGMRSKLAA
FT                   ARIAIDWGVTTIIASGRRPHPLRDLVTGEARCTIFEAGDKISARRRWLSGVHERSGSMD
FT                   IDAGALKALKAEASLLACGVVQVAEPFLKGDVIDIRHDNQVVGFGLAACDSASIGSAEG
FT                   STIVLRRDDLILTEHDHDRNDQ"
FT   gene            692642..693277
FT                   /locus_tag="PB2503_03817"
FT   CDS_pept        692642..693277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03817"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03817"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08838"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE17"
FT                   /protein_id="ADM08838.1"
FT                   /translation="MALAAFYTKQGWTVTGTARQPEQATALKELAGAVHQLDVRDREAI
FT                   SRLATQIEAPIDILISNAGVSGPARERQVFGALDYEGWMDTLLVNTIGSVAVCEAFTPH
FT                   VAASNLKKMAVITSRMGSIDDTSCDVIAYRTSKTALNMAMVAASKPLKERGIAVGVLHP
FT                   GWVDTRMGGGNAPLSTEKSAQGLAEQIDGLAPTEKAPFLAYDGRVLPW"
FT   gene            693274..693588
FT                   /locus_tag="PB2503_03822"
FT   CDS_pept        693274..693588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03822"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03822"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08839"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE18"
FT                   /protein_id="ADM08839.1"
FT                   /translation="MSGTDVTGHCLCGDVQFRIEGPVAPASPISAEDALRWGGRHMTHV
FT                   RQDKLILQNGELSLSWYGREGVEYGFCVICGTSLFTRPEEESAMVVAVNHGTLVDQDEG
FT                   "
FT   gene            complement(693597..694700)
FT                   /locus_tag="PB2503_03827"
FT   CDS_pept        complement(693597..694700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03827"
FT                   /product="sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03827"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08840"
FT                   /db_xref="GOA:E0TE19"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE19"
FT                   /protein_id="ADM08840.1"
FT                   /translation="MNKPNGVGGITDVLGKVPGRASRYAVAQAPMSLVLTDPHRADNPI
FT                   IYVNRAFEVMTGYSLSYVLGRNCRFLQRDGAEEEATKRLRAAIDKREPVQVDITNYRFD
FT                   GSAFTNRLSVSPIYDSNNDLYAFVGIQTEITAENKQVEELKTVISETQHRVRNHLQLIS
FT                   SMIRLRSQESPDGAFEILAKRVEALGLLYDEFFVKGGLKDDSLRFDIVSGGAYVSRVAT
FT                   LIASLDMRRTIRMNVDVDPIYIETERAAQLGLIVSELITNALQHAFPDRSEGVVEVRLK
FT                   ELGGDQVRLTVADDGVGMGAADWPNGTSLGSRICKALIGQIDGNLNVATSEAGSIVTVD
FT                   FYNATDTTLDQTGQRREIQDSNTQRLT"
FT   gene            694914..695522
FT                   /locus_tag="PB2503_03832"
FT   CDS_pept        694914..695522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03832"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03832"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08841"
FT                   /db_xref="GOA:E0TE20"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE20"
FT                   /protein_id="ADM08841.1"
FT                   /translation="MSTLPVGPEIEQLLTIISRLPGFGPRSARRIALHLLRRREGVMVP
FT                   LAEALATAAATVAPCEICGNWDSQSPCRLCEDEERDGSVLCVVEDVGDVWALERSGAFK
FT                   GRYHILGGLISPLDGIGPDDLNFGPLSQRASAGTVREVILALSATVDGQTTAGYVADRL
FT                   EGLGLTVTRLSHGVPIGGELGHLDEGTLAAALQSRRDFS"
FT   gene            695594..696700
FT                   /locus_tag="PB2503_03837"
FT   CDS_pept        695594..696700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03837"
FT                   /product="glutathione dependent formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03837"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08842"
FT                   /db_xref="GOA:E0TE21"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE21"
FT                   /protein_id="ADM08842.1"
FT                   /translation="MKTRAAVAFEPKKPLEIVDLDLEGPKAGEVLIELKATGICHTDAY
FT                   TLDGLDSEGLFPSILGHEGCGIVREVGPGVTTLKPDDHVIPLYTPECRECKSCLNPKTN
FT                   LCTAIRSTQGQGLMPDGTSRFSYKGERIYHYMGCSTFSNYTVMPEIAVAKIRKDAPFET
FT                   TCYVGCGVTTGVGAVTNTAKVEPGSTVVVFGLGGIGLNVIQGAKMVGASQIVGVDLNPE
FT                   KAEWGRKFGMTDFVNPKDVDNLVAHLVALTDGGADYSFDCTGNTEVMRQALECCHRGWG
FT                   ESIVIGVAEAGKEISTRPFQLVTGRVWKGTAFGGARGRTDVPTIVDWYMSGQIQIDPMI
FT                   THRFALDEINKAFDLMHQGQSIRSVVVY"
FT   gene            696724..697113
FT                   /locus_tag="PB2503_03842"
FT   CDS_pept        696724..697113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03842"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03842"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08843"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE22"
FT                   /protein_id="ADM08843.1"
FT                   /translation="MLFTHAIVGSSDLDRSKTFYDAALGALGLDPVLAGDRVVYVRDNV
FT                   AFGFGPPRNGEAPNPGNGLTISFAAPSKEAVDAFHEAGQSAGGTDEGAPGLRPNAPGRA
FT                   YGAYLRDPDGNKICAFAQLGDDEEG"
FT   gene            697117..697947
FT                   /locus_tag="PB2503_03847"
FT   CDS_pept        697117..697947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03847"
FT                   /product="esterase D"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03847"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08844"
FT                   /db_xref="GOA:E0TE23"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE23"
FT                   /protein_id="ADM08844.1"
FT                   /translation="METVSEVRSHGGLQGVYRHASTATATEMTFSVFVPDHPKGASLPV
FT                   VWYLSGLTCTHANVTEKGEFRRACKERGLVFVAPDTSPRGPGVADDDSYDLGQGAGFYL
FT                   NATEAPWAPHFHMRRYIEEELPSLIAASFPVDLSRQSLMGHSMGGHGALTIGLRNEDRF
FT                   KSVSAFAPIVASSKVPWGERAFTAYLGPDRTAWAPYDACALIAAGRRLPALLVDQGTAD
FT                   TFLERELQPQRLEAACAAAGQPLTLRRQDGYDHSYYFISTFMADHLHWHADHLG"
FT   gene            697996..698223
FT                   /locus_tag="PB2503_03852"
FT   CDS_pept        697996..698223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03852"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08845"
FT                   /db_xref="GOA:E0TE24"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE24"
FT                   /protein_id="ADM08845.1"
FT                   /translation="MAQVLVRKLEEGVVSSLKRLAAEKGVSLEQYLRDVLTETAEAPSA
FT                   AFDRLAADLRAATAQTAFDPAIIVREARER"
FT   gene            698220..698711
FT                   /locus_tag="PB2503_03857"
FT   CDS_pept        698220..698711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03857"
FT                   /product="PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03857"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08846"
FT                   /db_xref="GOA:E0TE25"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE25"
FT                   /protein_id="ADM08846.1"
FT                   /translation="MSRAVFDAPVVAAWMVASPVTQNALALKSAHAPLAPSYIMVELAN
FT                   VLWRYDRVSGLPGDSAAAILPLLRTELALTPDEALIDRAFALARRIGEPVFDCLYVALA
FT                   MREGVPLVTLNRRLIAAVEEAALAPIIKLRLDGRGEVSPTQCDGPKPGSPGGPDLGSRP
FT                   "
FT   gene            698872..699456
FT                   /locus_tag="PB2503_03862"
FT   CDS_pept        698872..699456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03862"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03862"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08847"
FT                   /db_xref="InterPro:IPR021381"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE26"
FT                   /protein_id="ADM08847.1"
FT                   /translation="MLSPSLIIGAVALSLGAAGDPPTTDLDAFLEGGRHGVKPSAGYST
FT                   GRPAEGGDRRHQTVRRVTCAAAGAYRECPAPGHISQIRLDGGPCRLGLDWGVGRRMVWV
FT                   DRHCRARFTVTGGQSWAPSPPPPPQDLSSVSCSSEDWRYRECAIPTAFSDIRVQTRWSD
FT                   APCRRNREWGLTKGGIWVDNGCRARFSYRQL"
FT   gene            699506..701329
FT                   /locus_tag="PB2503_03867"
FT   CDS_pept        699506..701329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03867"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03867"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08848"
FT                   /db_xref="GOA:E0TE27"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE27"
FT                   /protein_id="ADM08848.1"
FT                   /translation="MTDDLSPPPTSPGYRVLARKYRPQSFDDLLGHEAMVRTLRNAFAA
FT                   DRIAHAFILTGVRGVGKTTTARIIARALNYETETIDRPTVDMPVEGRHCRAIAESRHPD
FT                   VYEMDAASRTGVGDIRELIEGVRYAPIEGRYKVYIIDEVHMLSTNAFNALLKTLEEPPA
FT                   HVKFIFATTEIRKVPVTVLSRCQRFDLRRFDITSLSAHLAGIAEKEEAAISKEALDMIA
FT                   QAAEGSVRDALSLLDQALVQKAGEAIGAADIRDMLGLVDRTQTWDLLGAAMAGDAKTAL
FT                   RLFREQYDGGADAGQVMRDLLSLTHLLTRTLVAGDEAAAHGQAGEADTERAQAMAHGVP
FT                   LPALTRSWSLLMKALEEVQNAPDAAAAAEIGLIRVAYAAGQPTPEEALKALGQAAPQAA
FT                   AQAAPQAAPQAAPQAAPQAAPSAERAPTGAATGPQGSWSPTGGQVAVAVNAAPDAGPHT
FT                   APDPAQPSPERPARPMLTAPSPAPSPTIETLDDIAALAGVKRDARLREEIETCLIPVHL
FT                   ETGRLDVAVTEAAPKDLTGRLGQALKAWTGRPWIVSIVADPGEVPTIRGRRNQAIKANP
FT                   VVNAALSAFPKARIAAVRPLSSPTAPGEDSA"
FT   gene            701326..701841
FT                   /locus_tag="PB2503_03872"
FT   CDS_pept        701326..701841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03872"
FT                   /product="DinB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03872"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08849"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE28"
FT                   /protein_id="ADM08849.1"
FT                   /translation="MITPSYARMMAAYTRWQNQSLMIAADTLSDGDRAADQGAFFGSID
FT                   ATFAHLLWGDSIWLSRFGAAPAPQATSIADGTAPLPWGAFCARRRDVDALIIRWAESLD
FT                   PQDLEGDLSWFSGATGRQMSRPRRQLIVHFFNHGTHHRGQIHAMLTRLGTTPWDTDLPF
FT                   MPETAPHL"
FT   gene            701855..702181
FT                   /locus_tag="PB2503_03877"
FT   CDS_pept        701855..702181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03877"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03877"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08850"
FT                   /db_xref="GOA:E0TE29"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE29"
FT                   /protein_id="ADM08850.1"
FT                   /translation="MMKNFSDMMKQAAGLQKKMEEIQTQMAGLEASGSAGAGLVSVTLN
FT                   GKGYASKVSIDPKLFAEDEKEVLEDLVTAAINDAKAKLEEKSAEQMKSLTEGFPLPPGM
FT                   KLPF"
FT   gene            complement(702212..704428)
FT                   /locus_tag="PB2503_03882"
FT   CDS_pept        complement(702212..704428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03882"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03882"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08851"
FT                   /db_xref="GOA:E0TE30"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE30"
FT                   /protein_id="ADM08851.1"
FT                   /translation="MADASLFPTSSPKRRVRVLLPLPVGDGYDYTVPAGMRLVPGAFVR
FT                   VPLGPRQVAGVVWALDPAGEVADDKLKPITAQYDTPPLAEATRRFVDWVAGYTLSPRGT
FT                   VLRLVMRAGQQLTPPKARLAYRLPDPVPPGLRMTEARARVIEILRRQGGGPLVAADLAK
FT                   DADVTPGVLKGLAAAEGLIPEEVARDAPFGRPDPHLPGRALSEHQAAAAESLSAAVHAG
FT                   GYRAFLLDGVTGSGKTEVYLEAAAAALKKDPDAQICILLPEIGLTLPFLERIHRRFGTA
FT                   PAHWHSDLSQGTRRRVWRGVADGSAKVVVGARSALFLPFRRLALIVVDEEHEPAYKQHD
FT                   GVLYQARDMAVARAAQDGFPVLLVSATPSLETLANVEEGRYDRVALAVRYGPARLPETA
FT                   IVDMRADPPERGQWLSPIAIDAVTTCLAAGEQVLLYLNRRGYAPVTLCRTCGERMTAPG
FT                   SDTWLVEHRYSGRLVCHHTGYSIPKPDHCPHCGAPDSLTPCGPGVERIAEEAAARWPDA
FT                   RLAILSSDTMTAPGAMRQTLERMTAGEIDILVATQAAAKGHNFPGLTLVVAVDADLGLA
FT                   GGDLRAAERTYQTLAQVSGRAGRAERPGRVLLQSYQPESPVICALAAGDREGFTEAELE
FT                   GRAQLGFPPFGRLAAVILSGDNEARLTRFAHDLALAVPHAEGVEIWGPAPAPLYRLKGI
FT                   YRQRFLVKTGRRVSIQAVLKSWLGPIKLPSGIRRTVDIDPYSFT"
FT   gene            704522..705004
FT                   /locus_tag="PB2503_03887"
FT   CDS_pept        704522..705004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03887"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03887"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08852"
FT                   /db_xref="GOA:E0TE31"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE31"
FT                   /protein_id="ADM08852.1"
FT                   /translation="MERRALLFVCLGNICRSPVAEAAARQWARTHGLNLGLNLGLNLGL
FT                   NLAVGSRGTGPWHQGRPADAAMGQAAAAIGLDLSAHRARQLDLADFYEVDHILTMDGRN
FT                   YEDVLDLAPPNRRAQIARFAPFDIPDPYGGTADRFHEVATMIAARMNDLLPEILGE"
FT   gene            704997..705872
FT                   /locus_tag="PB2503_03892"
FT   CDS_pept        704997..705872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03892"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08853"
FT                   /db_xref="GOA:E0TE32"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE32"
FT                   /protein_id="ADM08853.1"
FT                   /translation="MSKVLLLGAGYSARVFADQALAEGWLVSGTTRDTHKAKALSQAGI
FT                   EPYLWEAGTPLPRAAISTADLIVVSISPQGDGCPAAAALAEACPSPSTRVIYLSSSGVY
FT                   GDHGGAWIDETTPPSPSGERGRRRLAAEAAWQDLAAAFGLDLVLCRLAGIYGPGRNALN
FT                   SLMTDSQGAKSGLSQRVIKEGQVFNRIHVEDIARLLLALAEAETWPAIVNGADDLPSPP
FT                   QDVILYAAALLGKEPPPAVAFEAAALSPMARSFYVDNKRLKNQRLHTLLPTGLRYPSYR
FT                   EGLRALLSKP"
FT   gene            706064..707791
FT                   /locus_tag="PB2503_03897"
FT   CDS_pept        706064..707791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03897"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03897"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08854"
FT                   /db_xref="GOA:E0TE33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE33"
FT                   /protein_id="ADM08854.1"
FT                   /translation="MRELPTRLFVITVGVSAVSATGRLDHLLCVAIYLLILGSQLTDAI
FT                   VWYRLSRCTESALPWHCRFGVLSAFQASMCYGLFPVYVWISDIPAGQAIAYTMLSGNLL
FT                   HTALHQNTRILVMISAAIPPLVYMAGLPIYQMAVDPSFYLRDCAALLTIEMLVILALLS
FT                   GAKAIRTVTQQREEERAAAEQASRAKSVFLATMSHEIRTPLNGILGMAEALAASALPED
FT                   SRSKAETIRDSGALLLQMLNNSLDLSKIEAGKLEIDKAPFRLDRAIERVHALFAQQARN
FT                   AGLTFTTDIDRSLPMLREGDEQRLTQILTNLIGNALKFTQSGGVTIGLHRGKGATDIVL
FT                   SVKDTGIGMSDEQQAKIFMPFTQAEGATTTRRFGGTGLGLSIVKALTAQMGGEVILKSV
FT                   AGVGSEFSVCLPLPEAATKSLPERHMNGRRDLETISGLRLLVIDDNRVNLTVIDALLRP
FT                   LGAQLTTCLSGEEGVALATSADVFDVILVDISMEGMDGPETLRVLRERLGGACPPVLAV
FT                   SAHAFSDDITRFIALGFEGYVTKPVNRERLVKAIADARLSHAATSAMETHYLTPSHAI"
FT   gene            707860..709260
FT                   /locus_tag="PB2503_03902"
FT   CDS_pept        707860..709260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03902"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03902"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08855"
FT                   /db_xref="GOA:E0TE34"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE34"
FT                   /protein_id="ADM08855.1"
FT                   /translation="MANDYEIADIGLADFGNKEIKIAEHEMPGLMQTRAEFGGSQPLKG
FT                   ARIAGSLHMTIQTAVLIQTLEALGATVRWASCNIYSTQDHAAAAIAANGTPVFAKKGET
FT                   LEEYWAYADRLWEWPDGEIANMILDDGGDATMLILLGSEAETDPSVLDNPGNEEERIVF
FT                   ETIKRRLARDPGFYSRVKASIKGVTEETTTGVLRLYQREKKGTLPFPAINVNDSVTKSK
FT                   FDNKYGCKESLVDAIRRGTDVMMAGKKALVAGYGDVGKGSAQSLRGAGCRVMVTEVDPI
FT                   CALQAAMDGFEVVTMADGAAQADIVVTATGNKDIVTIDDMRRMKDMAIVCNIGHFDNEI
FT                   QVEATRNWEWDNIKPQVDMITKPDGKRMILLSEGRLVNLGNATGHPSFVMSASFTNQTL
FT                   AQIELFANNEDGKYENRVYVLPKHLDEKVAALHLAHVGAHLSELTEEQAAYIGVGQKGP
FT                   FKPEGYRY"
FT   gene            709385..710461
FT                   /locus_tag="PB2503_03907"
FT   CDS_pept        709385..710461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03907"
FT                   /product="Putative hexosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03907"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08856"
FT                   /db_xref="GOA:E0TE35"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE35"
FT                   /protein_id="ADM08856.1"
FT                   /translation="MRIAIVLAPNTTYSPDGASAVVLCAHDAGLYSRHRDDITVIAPQT
FT                   NTPFSDLSYRPVPTDGGLHAYTKRVKRLLKDQPPDFVEVHQQVKCASHIARQIAPLPVM
FT                   LVKHSQIKAPKGPVSRIRLSRRIAPLTQIAFVSQFACDHFTAAYPRFVDRAAVAWNGLD
FT                   TDLYPYAPQAKRKTILFAGRIIANKGALDFAKAMRRTLPHYPDWNAVMIGQPDRGEEAY
FT                   GEAVRAEIAALGPQGEWLGYRPYPDVMAHFQAAEIVVVPSKWDETFGRVALEAMVTGAA
FT                   LIASRRGGLPEVGGEAATYLDAVTPDHISSAVRALIENTPLRRTQQEAGRRRAVEKFDI
FT                   RRTVACIDDLREAIVDRT"
FT   gene            710589..712595
FT                   /locus_tag="PB2503_03912"
FT   CDS_pept        710589..712595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03912"
FT                   /product="cell volume regulation protein CvrA"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03912"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08857"
FT                   /db_xref="GOA:E0TE36"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE36"
FT                   /protein_id="ADM08857.1"
FT                   /translation="MDIGIVILGISALSVGAILAGAAGQKIDAPILLIFLLVGMLAGRE
FT                   GPGGVSLDASQTVLVWGSAALASILFEGGLRTEARTFSIGVWPGLTLALLGTILTAVVL
FT                   APIAHIAFGLGWTEALLLGAIVSSTDAAAVFALAATGLRMPIKVRAVLEVESGLNDPIA
FT                   IFLVIGLASSLALDPMSATDWAGSFIAKLSLGTIVGIGMGHLVPRLLTDMTLPQGLLTI
FT                   LVAGFGFMAFGLAETVGGSGFLAIYLTGLTMARTAPDFTQRAAGVMDGLAWLAQTGLFL
FT                   VLGLLVTPSLLADVALPAFLLSLALILLARPIGVVASLLPFRFRSRDMAFVSWAGLRGA
FT                   TPVFLGLIPAAIGVENGSFFVSAATVVVLLSLVIQGWTAPLVGRALKVTMAEDGTSLDR
FT                   GAMWARLGAVGASIVVGAWFASVLAPPPGDDPDLMAPETMAELRDGLEDAALIPTRFPT
FT                   GFSSLPLDERRPLFIATLAQVVEATNQRIETDRVRLKELAAERRRRGRLSLEEEAEAAQ
FT                   IARRYGLRLTTPRALLDRIDVIPPRLAIAQAALATGWGSAGAAVEANAVYGRRRDEGFS
FT                   SLITATQDLASLYAAHEDFGRLRAARVAARRAERVPTAEELAPLIGAYAREADIYLAQI
FT                   AELLRTDSLAQPLPQPGPPADEGETPTEDSNGE"
FT   gene            712868..713443
FT                   /locus_tag="PB2503_03917"
FT   CDS_pept        712868..713443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03917"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03917"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08858"
FT                   /db_xref="GOA:E0TE37"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE37"
FT                   /protein_id="ADM08858.1"
FT                   /translation="MNRKFYALAALSMAVAACKMPPDNRPATYPPDTVSMVDISKYVGL
FT                   WYEIARYPNFFEDTNRYTCVGVTAFYEVQTSEEISVENTCYKDTLDGEVQVAKGVGRIV
FT                   DPSNAKLKVRFAPAWVSFADGDYWILALTDDYGAVLVGEPEGRFLWVLSRTPQLDDEIY
FT                   QSLIDVAESQGFDTRPLQRTPQPGDPAP"
FT   gene            713556..714464
FT                   /locus_tag="PB2503_03922"
FT   CDS_pept        713556..714464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03922"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03922"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08859"
FT                   /db_xref="GOA:E0TE38"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE38"
FT                   /protein_id="ADM08859.1"
FT                   /translation="MQPTNPNAFSLDPLDRAGNERRDPEWVKAQQEREDARLLLLSRGN
FT                   PLTKRVGPETSLVWLPLSVLDSAEGDPGLILLGLEKGAPRFAADIRDHTAPFTVDGATF
FT                   SSLRDSGWTLSPTELAIAGQATWLTGWHAKHRYCARDGGETVMAEGGFKRINPVSGAQH
FT                   FPRTDPVAIMLPLHQGDVCLGRSPRFPEGMYSAFAGYLEPCETLESCVIRELKEEAGLT
FT                   VTSTHYRFSQPWPFSSSLMVGYFANVAAKTLTLDPEEIADARWFNREEILALLDNNGEP
FT                   GVFVPPPFTIAHQLLRDWAER"
FT   gene            complement(714434..715291)
FT                   /locus_tag="PB2503_03927"
FT   CDS_pept        complement(714434..715291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03927"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03927"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08860"
FT                   /db_xref="GOA:E0TE39"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE39"
FT                   /protein_id="ADM08860.1"
FT                   /translation="MKEKIAFQGEPGAFSEEAARKFLSQYDPLPCSSFAEVFRAVEEGA
FT                   ALEALVPVENAIAGRVDDVYRLLPDMPFVIYAEHFLPVHMQLMTIPGRDENDLRIVRSH
FT                   PMALGQCAQMIARRGLKAEVAMDTAGAAKALAATREEGVAVIAPEAAAALYDLEIIERN
FT                   VQDADKNVTRFLRIGAETDAVWPDLLSGPVLTSIVFRVRNIPAALYKALGGFATNGVNL
FT                   FKLESYQEDASFTATRFQAEFEGHPDEPPVRRALEELGWFSSDLRLLGVFPADPYRSAQ
FT                   SRRS"
FT   gene            715413..716096
FT                   /locus_tag="PB2503_03932"
FT   CDS_pept        715413..716096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03932"
FT                   /product="cytochrome C"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03932"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08861"
FT                   /db_xref="GOA:E0TE40"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE40"
FT                   /protein_id="ADM08861.1"
FT                   /translation="MKDPLYGNKVAAAILTTLLLAFGLPITISTLTKVFSHHGHHEADE
FT                   ENPFGLAYIPAEIELGPTAAGEEEEEIDLGTLMANASVERGQRAAGLCGSCHTFQEGEP
FT                   NGIGPNLWGIVGRDIASHGGFSYSSALQGLEGDWTYERLDPYLENSQAYVPGTQMAQMV
FT                   RKEEKRADLLAYLGSLSNDPVPYPAPAPAPEETAEAEGDADSGEESGAGESRSESDMPE
FT                   QAGFH"
FT   gene            716118..716354
FT                   /locus_tag="PB2503_03937"
FT   CDS_pept        716118..716354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03937"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03937"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08862"
FT                   /db_xref="InterPro:IPR025227"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE41"
FT                   /protein_id="ADM08862.1"
FT                   /translation="MSGDLINLRLARKRKARAEKERQAAANRATHGRSKADRQFGAADR
FT                   EKQSQRHEGHRLTDPEVRPSPVGIDGKEPRSDD"
FT   gene            complement(716343..717119)
FT                   /locus_tag="PB2503_03942"
FT   CDS_pept        complement(716343..717119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03942"
FT                   /product="peptidase/amylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03942"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08863"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE42"
FT                   /protein_id="ADM08863.1"
FT                   /translation="MTENIVIVPHIIAREAPNPTAEAVTDLLYGERQSVLEETADWVRV
FT                   RNRDDAYEGWIPQAALAPLPPEPMEPVRRVRTRLATAYKAPAGRVALQDIGFASPIPVA
FT                   EARGGWIRDGHGRWFRDQDLTAEPLPEGFADLALLFLGVPYVWGGRHGGGIDCSGLVQV
FT                   TALAKGHHCLRDTGDQVESFGHLLEGTARDHLQRDDILYMPGHVAILTGPLTAVHADGL
FT                   AGYVHEQDIETILAERGFRFDEATIRRPVRAPQSVV"
FT   gene            complement(717116..718048)
FT                   /locus_tag="PB2503_03947"
FT   CDS_pept        complement(717116..718048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03947"
FT                   /product="Peptidase U61, LD-carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03947"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08864"
FT                   /db_xref="GOA:E0TE43"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE43"
FT                   /protein_id="ADM08864.1"
FT                   /translation="MAEARARPLTVRAVAPARWLEPEVLDDFIALAAAQGGRVLTPAAL
FT                   SLRDHQLCGTDEERAAALIAAFDDPEADILWCVRGGYGSARLLPYVHKALATGKIVIGY
FT                   SDMTALFVGTGADGPRAPFLAVHGPMPVDLLKPEGAARLVAAIDMARTARDTGRWPGCD
FT                   WRGGGVRAGQGRGRLIVGNLTVLLSLLGTPYEPQPREPVLLAIEDCGEYHYALDRALVQ
FT                   LAQSRFGKALAGIVLGDFTDLEDNPVPWGEGVAAMAHRHFPDLPIAHGFPVGHGLENSP
FT                   FALGAAAQLVVEGEAAHLTIADTPLPLAP"
FT   gene            complement(718041..718394)
FT                   /locus_tag="PB2503_03952"
FT   CDS_pept        complement(718041..718394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03952"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03952"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08865"
FT                   /db_xref="GOA:E0TE44"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE44"
FT                   /protein_id="ADM08865.1"
FT                   /translation="MSQHSHLHPWRDVMVDTVRLDRPDLSMRQWALLLTVYLTPGPHTV
FT                   RRLSEELKVPKPAISRALDALSIHGYIKRARDPDDRRIVLVQKTEEGAMFIDQFAGVVE
FT                   ERERQSDLGAYYG"
FT   gene            complement(718461..719297)
FT                   /locus_tag="PB2503_03957"
FT   CDS_pept        complement(718461..719297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03957"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03957"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08866"
FT                   /db_xref="GOA:E0TE45"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE45"
FT                   /protein_id="ADM08866.1"
FT                   /translation="MDMTAMATLIETAWENRDGLSDPANRTADLEEAVASALEGLDSGT
FT                   LRVAEPDGKGGWTVNEWLKKAVLLSFRLSANVSIAGGPGGSDWYDKVPPKFIGWTEADF
FT                   AQAGFRAVPPCAVRYGAHVAKGAVLMPSYVNIGAYVGSGTMVDTWVTIGSCAQIGENCH
FT                   ISGGVGIGGVLEPIQAAPVIIEDNCFIGARSEVAEGVIVREGAVLSMGVFLGASTKIVD
FT                   RETGEVTRGEVPPYAVVVPGTMGGGADRPALSCAVIVKRVDERTRAKTGINELLRY"
FT   gene            complement(719297..720019)
FT                   /locus_tag="PB2503_03962"
FT   CDS_pept        complement(719297..720019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03962"
FT                   /product="putative haloacid dehalogenase superfamily
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03962"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08867"
FT                   /db_xref="GOA:E0TE46"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE46"
FT                   /protein_id="ADM08867.1"
FT                   /translation="MALAAFDHVETWIFDLDNTLYPADCHLFAQIDERMTGFIEGFLRC
FT                   DRAKARHLQKDYYRRYGTTLAGLMAEHNLPPDDFLDYVHDIDLSAVPPNERLGMAIAAL
FT                   PGRKYIFTNGSEGHAERVSDHLGVSHAFDGVFGIETGDFIPKPQEAAYHAFSARFGRCP
FT                   RSAAFFEDMAPNLTVPAALGMVTILVQSDATWFEDEPQGKRPAIPGDHPPHVDHTTSDL
FT                   TDFVGRLSTFGSNGKEGG"
FT   gene            complement(720031..721107)
FT                   /locus_tag="PB2503_03967"
FT   CDS_pept        complement(720031..721107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03967"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03967"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08868"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE47"
FT                   /protein_id="ADM08868.1"
FT                   /translation="MVARSLSFRGCRPPLIAGLVGFLLCAPFLVSSAHAQYSFCNKTSY
FT                   ALSAAIGYVDDEDLVTRGWWRLRSGQCKRVLSDRVQPGRYFVYAEAIPGHRGELRTWSG
FT                   ETPLCVQNDSLFTLRDQNSCTSDPRRQRRFLPVDVDESTDGTKTTEFVEESNFTAFSAE
FT                   VAGVQRLLKDIGLYEGLIDGSFGGETKGALTRFVRQKGLGNAGAINETVIDALMAEANS
FT                   TDSNRGFVFCNATMLPVWAAFAQPDSQSEEYTSSGWWRLESQDCAKVRRGSVENENFYV
FT                   YGVMEADGRSVPLAGGDTSFCISTVQFEAPGDAPCEELGYETANFRRVEATNSKAWTFQ
FT                   FTPELFNPALAPRSGSTN"
FT   gene            721206..721925
FT                   /locus_tag="PB2503_03972"
FT   CDS_pept        721206..721925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03972"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03972"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08869"
FT                   /db_xref="GOA:E0TE48"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE48"
FT                   /protein_id="ADM08869.1"
FT                   /translation="MRLVILTGAGISADSGVDTFRDEGGVWSQVRLEDVATPEAFLHTP
FT                   DRVHAFYNRRRAQLPNVAPNAAHLALAALERRLREDRHEFVLITQNVDNLHQRAGSDSV
FT                   FPMHGQLDRALCVHCGGVVALTEDLSTKTACPQCQRQGGMRPNIVWFGEIPHFLDDIAA
FT                   AIEGADHFVAIGTSGTVYPAAGLVEGARQAGAVTTLINRDPAENDTMFDHIIAGRAAEA
FT                   VPAWADRLVDSLTERKA"
FT   gene            721929..722216
FT                   /locus_tag="PB2503_03977"
FT   CDS_pept        721929..722216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03977"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03977"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08870"
FT                   /db_xref="GOA:E0TE49"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE49"
FT                   /protein_id="ADM08870.1"
FT                   /translation="MDKLSAEDRKRFLADHPNWTLVDGRDAMSASFRFENFIDAFGFMT
FT                   QIALRAEKMDHHPEWSNVYNKVEITLTTHDVDGLSPRDTELAAFIDKLAP"
FT   gene            722379..723077
FT                   /locus_tag="PB2503_03982"
FT   CDS_pept        722379..723077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03982"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03982"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08871"
FT                   /db_xref="GOA:E0TE50"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE50"
FT                   /protein_id="ADM08871.1"
FT                   /translation="MAQIVLVDDDQNILTSVSIALESDGHDVTTYEDGAEALEGIAAKE
FT                   PELVISDIKMPRLNGIDLLKKLREKSDVPLIFLTSKDEEIDEVLGLTLGADDYVKKPFS
FT                   QRLFLERVKAVLRRQKERHRAPTPEETAQIIHRGDLTLDPLRHACSWKGAPVTLTVTEF
FT                   LILQALAQRPGFVKSRDALMDAAYDDQVYVDDRTIDSHIKRVRKKFRVVDREFDQIETL
FT                   YGVGYKYKED"
FT   gene            723097..724854
FT                   /locus_tag="PB2503_03987"
FT   CDS_pept        723097..724854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03987"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03987"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08872"
FT                   /db_xref="GOA:E0TE51"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE51"
FT                   /protein_id="ADM08872.1"
FT                   /translation="MSPPTRPAVAPAPRRRSFGFRDDTGRLPISRLTVTILLTQLFGLT
FT                   ILMMGSFRVTQYRDGLIDAKLEAVRAQAQVIASIMATVAAEDADCDIVTADQDVAPCEV
FT                   SLDRESVNAIFTRVWPSFEGRVRIFETPEDYDGGPISDPRAILLEDQVLRAGAIEAVEL
FT                   PDLTQGPADRLRTRLRQARGLFLDIFVDPGLRSTAQQRRLEDELTRAFRSTGINAQRGA
FT                   ASLRYNEDNELVASVSVPIRKVQAIYGVVTAEIGGIDEVLSSARAALLSFSLVALIVAV
FT                   ILSILLTMNIATPIRRLARAADSVRVGLRGSSRRRIPEFPNRRDDIGELARSLKSMTAA
FT                   LYDRIEAIEHFAADVSHELKNPLTSIRSAIETLDIAKTEQARARLLAVIKQDVARMDRL
FT                   ITDISNASRLDAELAREKRDIVDLRQLLRDVVATYTSRDDQGDRPKIHIEKEPADPAYL
FT                   IGSPGTLGQVLRNLMDNALSFSPEGGAVRISLVVEAREGGQLAILSVEDEGPGIPEENL
FT                   ESIFERFYTKRPEGAQFGNNSGLGLAISRQIVESHDGNIWAENRRGDGAGPPRGARFTV
FT                   LLPLLSTDR"
FT   gene            724893..725339
FT                   /locus_tag="PB2503_03992"
FT   CDS_pept        724893..725339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PB2503_03992"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PB2503_03992"
FT                   /db_xref="EnsemblGenomes-Tr:ADM08873"
FT                   /db_xref="GOA:E0TE52"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:E0TE52"
FT                   /protein_id="ADM08873.1"
FT                   /translation="MAISAGAPLVGVILLGPSGIG