(data stored in SCRATCH zone)

EMBL: CP002157

ID   CP002157; SV 1; circular; genomic DNA; STD; PRO; 3868304 BP.
AC   CP002157; AAOC01000000-AAOC01000015; CH672391-CH672394;
PR   Project:PRJNA13595;
DT   07-SEP-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Maribacter sp. HTCC2170, complete genome.
KW   .
OS   Maribacter sp. HTCC2170
OC   Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
OC   Flavobacteriaceae; Maribacter.
RN   [1]
RP   1-3868304
RX   DOI; 10.1128/JB.01207-10.
RX   PUBMED; 21037013.
RA   Oh H.M., Kang I., Yang S.J., Jang Y., Vergin K.L., Giovannoni S.J.,
RA   Cho J.C.;
RT   "Complete genome sequence of strain HTCC2170, a novel member of the genus
RT   Maribacter in the family Flavobacteriaceae";
RL   J. Bacteriol. 193(1):303-304(2011).
RN   [2]
RP   1-3868304
RA   Oh H.-M., Jang Y., Cho J.-C.;
RT   ;
RL   Submitted (04-AUG-2010) to the INSDC.
RL   Division of Biology and Ocean Sciences, Inha University, College of Natural
RL   Sciences Inha University, Incheon 402-751, Republic of Korea
DR   MD5; b3e3e6eac01d062a39e08738ff5aa371.
DR   BioSample; SAMN02603923.
DR   EnsemblGenomes-Gn; EBG00001464821.
DR   EnsemblGenomes-Gn; EBG00001464822.
DR   EnsemblGenomes-Gn; EBG00001464823.
DR   EnsemblGenomes-Gn; EBG00001464824.
DR   EnsemblGenomes-Gn; EBG00001464825.
DR   EnsemblGenomes-Gn; EBG00001464826.
DR   EnsemblGenomes-Gn; EBG00001464827.
DR   EnsemblGenomes-Gn; EBG00001464828.
DR   EnsemblGenomes-Gn; EBG00001464829.
DR   EnsemblGenomes-Gn; EBG00001464830.
DR   EnsemblGenomes-Gn; EBG00001464831.
DR   EnsemblGenomes-Gn; EBG00001464832.
DR   EnsemblGenomes-Gn; EBG00001464833.
DR   EnsemblGenomes-Gn; EBG00001464834.
DR   EnsemblGenomes-Gn; EBG00001464835.
DR   EnsemblGenomes-Gn; EBG00001464836.
DR   EnsemblGenomes-Gn; EBG00001464837.
DR   EnsemblGenomes-Gn; EBG00001464838.
DR   EnsemblGenomes-Gn; EBG00001464839.
DR   EnsemblGenomes-Gn; EBG00001464840.
DR   EnsemblGenomes-Gn; EBG00001464841.
DR   EnsemblGenomes-Gn; EBG00001464842.
DR   EnsemblGenomes-Gn; EBG00001464843.
DR   EnsemblGenomes-Gn; EBG00001464844.
DR   EnsemblGenomes-Gn; EBG00001464845.
DR   EnsemblGenomes-Gn; EBG00001464846.
DR   EnsemblGenomes-Gn; EBG00001464847.
DR   EnsemblGenomes-Gn; EBG00001464848.
DR   EnsemblGenomes-Gn; EBG00001464849.
DR   EnsemblGenomes-Gn; EBG00001464850.
DR   EnsemblGenomes-Gn; EBG00001464851.
DR   EnsemblGenomes-Gn; EBG00001464852.
DR   EnsemblGenomes-Gn; EBG00001464853.
DR   EnsemblGenomes-Gn; EBG00001464854.
DR   EnsemblGenomes-Gn; EBG00001464855.
DR   EnsemblGenomes-Gn; EBG00001464856.
DR   EnsemblGenomes-Gn; EBG00001464857.
DR   EnsemblGenomes-Gn; EBG00001464858.
DR   EnsemblGenomes-Gn; EBG00001464859.
DR   EnsemblGenomes-Gn; EBG00001464860.
DR   EnsemblGenomes-Gn; EBG00001464861.
DR   EnsemblGenomes-Gn; EBG00001464862.
DR   EnsemblGenomes-Gn; EBG00001464863.
DR   EnsemblGenomes-Gn; EBG00001464864.
DR   EnsemblGenomes-Gn; EBG00001464865.
DR   EnsemblGenomes-Gn; EBG00001464866.
DR   EnsemblGenomes-Gn; EBG00001464867.
DR   EnsemblGenomes-Gn; EBG00001464868.
DR   EnsemblGenomes-Gn; EBG00001464869.
DR   EnsemblGenomes-Gn; EBG00001464870.
DR   EnsemblGenomes-Gn; EBG00001464871.
DR   EnsemblGenomes-Gn; EBG00001464872.
DR   EnsemblGenomes-Gn; FB2170_r00235.
DR   EnsemblGenomes-Gn; FB2170_r09006.
DR   EnsemblGenomes-Gn; FB2170_r10252.
DR   EnsemblGenomes-Gn; FB2170_r10270.
DR   EnsemblGenomes-Gn; FB2170_r17495.
DR   EnsemblGenomes-Gn; FB2170_r17500.
DR   EnsemblGenomes-Gn; FB2170_t00227.
DR   EnsemblGenomes-Gn; FB2170_t01162.
DR   EnsemblGenomes-Gn; FB2170_t01699.
DR   EnsemblGenomes-Gn; FB2170_t01968.
DR   EnsemblGenomes-Gn; FB2170_t01970.
DR   EnsemblGenomes-Gn; FB2170_t07257.
DR   EnsemblGenomes-Gn; FB2170_t07259.
DR   EnsemblGenomes-Gn; FB2170_t07261.
DR   EnsemblGenomes-Gn; FB2170_t07263.
DR   EnsemblGenomes-Gn; FB2170_t07265.
DR   EnsemblGenomes-Gn; FB2170_t07267.
DR   EnsemblGenomes-Gn; FB2170_t07269.
DR   EnsemblGenomes-Gn; FB2170_t07271.
DR   EnsemblGenomes-Gn; FB2170_t07273.
DR   EnsemblGenomes-Gn; FB2170_t07275.
DR   EnsemblGenomes-Gn; FB2170_t07277.
DR   EnsemblGenomes-Gn; FB2170_t07279.
DR   EnsemblGenomes-Gn; FB2170_t08998.
DR   EnsemblGenomes-Gn; FB2170_t09000.
DR   EnsemblGenomes-Gn; FB2170_t09002.
DR   EnsemblGenomes-Gn; FB2170_t10248.
DR   EnsemblGenomes-Gn; FB2170_t10250.
DR   EnsemblGenomes-Gn; FB2170_t10511.
DR   EnsemblGenomes-Gn; FB2170_t13443.
DR   EnsemblGenomes-Gn; FB2170_t15827.
DR   EnsemblGenomes-Gn; FB2170_t15829.
DR   EnsemblGenomes-Gn; FB2170_t15831.
DR   EnsemblGenomes-Gn; FB2170_t17475.
DR   EnsemblGenomes-Gn; FB2170_t17477.
DR   EnsemblGenomes-Gn; FB2170_t17479.
DR   EnsemblGenomes-Gn; FB2170_t17481.
DR   EnsemblGenomes-Gn; FB2170_t17482.
DR   EnsemblGenomes-Gn; FB2170_t17483.
DR   EnsemblGenomes-Gn; FB2170_t17485.
DR   EnsemblGenomes-Gn; FB2170_t17487.
DR   EnsemblGenomes-Gn; FB2170_t17489.
DR   EnsemblGenomes-Gn; FB2170_t17491.
DR   EnsemblGenomes-Gn; FB2170_t17493.
DR   EnsemblGenomes-Tr; EBT00001618546.
DR   EnsemblGenomes-Tr; EBT00001618547.
DR   EnsemblGenomes-Tr; EBT00001618548.
DR   EnsemblGenomes-Tr; EBT00001618549.
DR   EnsemblGenomes-Tr; EBT00001618550.
DR   EnsemblGenomes-Tr; EBT00001618551.
DR   EnsemblGenomes-Tr; EBT00001618552.
DR   EnsemblGenomes-Tr; EBT00001618553.
DR   EnsemblGenomes-Tr; EBT00001618554.
DR   EnsemblGenomes-Tr; EBT00001618555.
DR   EnsemblGenomes-Tr; EBT00001618556.
DR   EnsemblGenomes-Tr; EBT00001618557.
DR   EnsemblGenomes-Tr; EBT00001618558.
DR   EnsemblGenomes-Tr; EBT00001618559.
DR   EnsemblGenomes-Tr; EBT00001618560.
DR   EnsemblGenomes-Tr; EBT00001618561.
DR   EnsemblGenomes-Tr; EBT00001618562.
DR   EnsemblGenomes-Tr; EBT00001618563.
DR   EnsemblGenomes-Tr; EBT00001618564.
DR   EnsemblGenomes-Tr; EBT00001618568.
DR   EnsemblGenomes-Tr; EBT00001618569.
DR   EnsemblGenomes-Tr; EBT00001618572.
DR   EnsemblGenomes-Tr; EBT00001618574.
DR   EnsemblGenomes-Tr; EBT00001618575.
DR   EnsemblGenomes-Tr; EBT00001618576.
DR   EnsemblGenomes-Tr; EBT00001618579.
DR   EnsemblGenomes-Tr; EBT00001618580.
DR   EnsemblGenomes-Tr; EBT00001618581.
DR   EnsemblGenomes-Tr; EBT00001618583.
DR   EnsemblGenomes-Tr; EBT00001618585.
DR   EnsemblGenomes-Tr; EBT00001618587.
DR   EnsemblGenomes-Tr; EBT00001618589.
DR   EnsemblGenomes-Tr; EBT00001618590.
DR   EnsemblGenomes-Tr; EBT00001618591.
DR   EnsemblGenomes-Tr; EBT00001618594.
DR   EnsemblGenomes-Tr; EBT00001618598.
DR   EnsemblGenomes-Tr; EBT00001618599.
DR   EnsemblGenomes-Tr; EBT00001618600.
DR   EnsemblGenomes-Tr; EBT00001618603.
DR   EnsemblGenomes-Tr; EBT00001618606.
DR   EnsemblGenomes-Tr; EBT00001618607.
DR   EnsemblGenomes-Tr; EBT00001618611.
DR   EnsemblGenomes-Tr; EBT00001618612.
DR   EnsemblGenomes-Tr; EBT00001618614.
DR   EnsemblGenomes-Tr; EBT00001618615.
DR   EnsemblGenomes-Tr; EBT00001618616.
DR   EnsemblGenomes-Tr; EBT00001618617.
DR   EnsemblGenomes-Tr; EBT00001618618.
DR   EnsemblGenomes-Tr; EBT00001618620.
DR   EnsemblGenomes-Tr; EBT00001618621.
DR   EnsemblGenomes-Tr; EBT00001618623.
DR   EnsemblGenomes-Tr; EBT00001618626.
DR   EnsemblGenomes-Tr; FB2170_r00235-1.
DR   EnsemblGenomes-Tr; FB2170_r09006-1.
DR   EnsemblGenomes-Tr; FB2170_r10252-1.
DR   EnsemblGenomes-Tr; FB2170_r10270-1.
DR   EnsemblGenomes-Tr; FB2170_r17495-1.
DR   EnsemblGenomes-Tr; FB2170_r17500-1.
DR   EnsemblGenomes-Tr; FB2170_t00227-1.
DR   EnsemblGenomes-Tr; FB2170_t01162-1.
DR   EnsemblGenomes-Tr; FB2170_t01699-1.
DR   EnsemblGenomes-Tr; FB2170_t01968-1.
DR   EnsemblGenomes-Tr; FB2170_t01970-1.
DR   EnsemblGenomes-Tr; FB2170_t07257-1.
DR   EnsemblGenomes-Tr; FB2170_t07259-1.
DR   EnsemblGenomes-Tr; FB2170_t07261-1.
DR   EnsemblGenomes-Tr; FB2170_t07263-1.
DR   EnsemblGenomes-Tr; FB2170_t07265-1.
DR   EnsemblGenomes-Tr; FB2170_t07267-1.
DR   EnsemblGenomes-Tr; FB2170_t07269-1.
DR   EnsemblGenomes-Tr; FB2170_t07271-1.
DR   EnsemblGenomes-Tr; FB2170_t07273-1.
DR   EnsemblGenomes-Tr; FB2170_t07275-1.
DR   EnsemblGenomes-Tr; FB2170_t07277-1.
DR   EnsemblGenomes-Tr; FB2170_t07279-1.
DR   EnsemblGenomes-Tr; FB2170_t08998-1.
DR   EnsemblGenomes-Tr; FB2170_t09000-1.
DR   EnsemblGenomes-Tr; FB2170_t09002-1.
DR   EnsemblGenomes-Tr; FB2170_t10248-1.
DR   EnsemblGenomes-Tr; FB2170_t10250-1.
DR   EnsemblGenomes-Tr; FB2170_t10511-1.
DR   EnsemblGenomes-Tr; FB2170_t13443-1.
DR   EnsemblGenomes-Tr; FB2170_t15827-1.
DR   EnsemblGenomes-Tr; FB2170_t15829-1.
DR   EnsemblGenomes-Tr; FB2170_t15831-1.
DR   EnsemblGenomes-Tr; FB2170_t17475-1.
DR   EnsemblGenomes-Tr; FB2170_t17477-1.
DR   EnsemblGenomes-Tr; FB2170_t17479-1.
DR   EnsemblGenomes-Tr; FB2170_t17481-1.
DR   EnsemblGenomes-Tr; FB2170_t17482-1.
DR   EnsemblGenomes-Tr; FB2170_t17483-1.
DR   EnsemblGenomes-Tr; FB2170_t17485-1.
DR   EnsemblGenomes-Tr; FB2170_t17487-1.
DR   EnsemblGenomes-Tr; FB2170_t17489-1.
DR   EnsemblGenomes-Tr; FB2170_t17491-1.
DR   EnsemblGenomes-Tr; FB2170_t17493-1.
DR   EuropePMC; PMC3019928; 21037013.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3463246; 23066504.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01685; 6S-Flavo.
DR   RFAM; RF01692; Bacteroid-trp.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002157.
DR   SILVA-SSU; CP002157.
CC   On or before Aug 24, 2010 this sequence version replaced
CC   gi:88709778, gi:88709301, gi:88708910, gi:88708661, gi:88708393,
CC   gi:88708190, gi:88707993, gi:88707807, gi:88707699, gi:88707625,
CC   gi:88707563, gi:88707494, gi:88707442, gi:88707388, gi:88707343.
CC   available from Korean Culture Center of Microorganisms.
FH   Key             Location/Qualifiers
FT   source          1..3868304
FT                   /organism="Maribacter sp. HTCC2170"
FT                   /strain="HTCC2170"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:313603"
FT                   /culture_collection="KCCM:42371"
FT   gene            complement(4302..4430)
FT                   /locus_tag="FB2170_16136"
FT   CDS_pept        complement(4302..4430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16136"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00630"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT60"
FT                   /protein_id="EAR00630.2"
FT   gene            complement(4721..8113)
FT                   /locus_tag="FB2170_16141"
FT   CDS_pept        complement(4721..8113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16141"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00631"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT61"
FT                   /protein_id="EAR00631.1"
FT   gene            complement(8315..11920)
FT                   /locus_tag="FB2170_16146"
FT   CDS_pept        complement(8315..11920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16146"
FT                   /product="probable aggregation factor core protein MAFp3,
FT                   isoform C"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16146"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00632"
FT                   /db_xref="GOA:A4AT62"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT62"
FT                   /protein_id="EAR00632.1"
FT   gene            complement(12149..14089)
FT                   /locus_tag="FB2170_16151"
FT   CDS_pept        complement(12149..14089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16151"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16151"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00633"
FT                   /db_xref="GOA:A4AT63"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT63"
FT                   /protein_id="EAR00633.1"
FT                   KNRRSEFIILE"
FT   gene            complement(14101..15054)
FT                   /locus_tag="FB2170_16156"
FT   CDS_pept        complement(14101..15054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16156"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00634"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT64"
FT                   /protein_id="EAR00634.1"
FT   gene            complement(15070..18543)
FT                   /locus_tag="FB2170_16161"
FT   CDS_pept        complement(15070..18543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16161"
FT                   /product="transcriptional regulator, AraC family with
FT                   parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16161"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00635"
FT                   /db_xref="GOA:A4AT65"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT65"
FT                   /protein_id="EAR00635.1"
FT   gene            18943..20532
FT                   /locus_tag="FB2170_16166"
FT   CDS_pept        18943..20532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16166"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16166"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00636"
FT                   /db_xref="GOA:A4AT66"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT66"
FT                   /protein_id="EAR00636.1"
FT                   PSVILHFTSEFK"
FT   gene            complement(20590..20901)
FT                   /locus_tag="FB2170_16171"
FT   CDS_pept        complement(20590..20901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16171"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00637"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT67"
FT                   /protein_id="EAR00637.1"
FT   gene            complement(20911..25209)
FT                   /locus_tag="FB2170_16176"
FT   CDS_pept        complement(20911..25209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16176"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16176"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00638"
FT                   /db_xref="GOA:A4AT68"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT68"
FT                   /protein_id="EAR00638.1"
FT   gene            complement(25269..29078)
FT                   /locus_tag="FB2170_16181"
FT   CDS_pept        complement(25269..29078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16181"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16181"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00639"
FT                   /db_xref="GOA:A4AT69"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT69"
FT                   /protein_id="EAR00639.1"
FT   gene            complement(29209..29589)
FT                   /locus_tag="FB2170_16186"
FT   CDS_pept        complement(29209..29589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16186"
FT                   /product="putative 50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16186"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00640"
FT                   /db_xref="GOA:A4AT70"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT70"
FT                   /protein_id="EAR00640.1"
FT   gene            complement(29640..30155)
FT                   /locus_tag="FB2170_16191"
FT   CDS_pept        complement(29640..30155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16191"
FT                   /product="putative 50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16191"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00641"
FT                   /db_xref="GOA:A4AT71"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT71"
FT                   /protein_id="EAR00641.1"
FT                   ILKTLSEK"
FT   gene            complement(30178..30870)
FT                   /locus_tag="FB2170_16196"
FT   CDS_pept        complement(30178..30870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16196"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16196"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00642"
FT                   /db_xref="GOA:A4AT72"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT72"
FT                   /protein_id="EAR00642.1"
FT                   QLDPKTVD"
FT   gene            complement(30889..31326)
FT                   /locus_tag="FB2170_16201"
FT   CDS_pept        complement(30889..31326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16201"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16201"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00643"
FT                   /db_xref="GOA:A4AT73"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT73"
FT                   /protein_id="EAR00643.1"
FT   gene            complement(31394..31945)
FT                   /locus_tag="FB2170_16206"
FT   CDS_pept        complement(31394..31945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16206"
FT                   /product="putative transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16206"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00644"
FT                   /db_xref="GOA:A4AT74"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT74"
FT                   /protein_id="EAR00644.1"
FT   gene            complement(31956..32144)
FT                   /locus_tag="FB2170_16211"
FT   CDS_pept        complement(31956..32144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16211"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16211"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00645"
FT                   /db_xref="GOA:A4AT75"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT75"
FT                   /protein_id="EAR00645.1"
FT                   DSVFSKLIKLYFSNVLN"
FT   gene            complement(32215..32290)
FT                   /locus_tag="FB2170_t17493"
FT   tRNA            complement(32215..32290)
FT                   /locus_tag="FB2170_t17493"
FT                   /product="tRNA-Trp"
FT   gene            complement(32358..33545)
FT                   /locus_tag="FB2170_16216"
FT   CDS_pept        complement(32358..33545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16216"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16216"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00646"
FT                   /db_xref="GOA:A4AT76"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT76"
FT                   /protein_id="EAR00646.1"
FT   gene            complement(33598..33672)
FT                   /locus_tag="FB2170_t17491"
FT   tRNA            complement(33598..33672)
FT                   /locus_tag="FB2170_t17491"
FT                   /product="tRNA-Thr"
FT   gene            complement(33870..33942)
FT                   /locus_tag="FB2170_t17489"
FT   tRNA            complement(33870..33942)
FT                   /locus_tag="FB2170_t17489"
FT                   /product="tRNA-Gly"
FT   gene            complement(34068..34152)
FT                   /locus_tag="FB2170_t17487"
FT   tRNA            complement(34068..34152)
FT                   /locus_tag="FB2170_t17487"
FT                   /product="tRNA-Tyr"
FT   gene            complement(34175..34251)
FT                   /locus_tag="FB2170_t17485"
FT   tRNA            complement(34175..34251)
FT                   /locus_tag="FB2170_t17485"
FT                   /product="tRNA-Thr"
FT   gene            complement(34353..34655)
FT                   /locus_tag="FB2170_16221"
FT   CDS_pept        complement(34353..34655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16221"
FT                   /product="sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16221"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00647"
FT                   /db_xref="GOA:A4AT77"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT77"
FT                   /protein_id="EAR00647.1"
FT   gene            complement(34694..35587)
FT                   /locus_tag="FB2170_16226"
FT   CDS_pept        complement(34694..35587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16226"
FT                   /product="putative site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16226"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00648"
FT                   /db_xref="GOA:A4AT78"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT78"
FT                   /protein_id="EAR00648.1"
FT                   ELKKVHSSAHPRGKKL"
FT   gene            complement(35690..35884)
FT                   /locus_tag="FB2170_16231"
FT   CDS_pept        complement(35690..35884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16231"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16231"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00649"
FT                   /db_xref="GOA:A4AT79"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT79"
FT                   /protein_id="EAR00649.1"
FT   gene            complement(35954..37108)
FT                   /locus_tag="FB2170_16236"
FT   CDS_pept        complement(35954..37108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16236"
FT                   /product="AcdA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16236"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00650"
FT                   /db_xref="GOA:A4AT80"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT80"
FT                   /protein_id="EAR00650.1"
FT   gene            complement(37120..38010)
FT                   /locus_tag="FB2170_16241"
FT   CDS_pept        complement(37120..38010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16241"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00651"
FT                   /db_xref="GOA:A4AT81"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT81"
FT                   /protein_id="EAR00651.1"
FT                   FPTDKINRIQLYLSL"
FT   gene            complement(38022..39632)
FT                   /locus_tag="FB2170_16246"
FT   CDS_pept        complement(38022..39632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16246"
FT                   /product="putative Na(+)-linked D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16246"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00652"
FT                   /db_xref="GOA:A4AT82"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT82"
FT                   /protein_id="EAR00652.1"
FT   gene            complement(39726..40685)
FT                   /locus_tag="FB2170_16251"
FT   CDS_pept        complement(39726..40685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16251"
FT                   /product="potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16251"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00653"
FT                   /db_xref="GOA:A4AT83"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT83"
FT                   /protein_id="EAR00653.1"
FT   gene            complement(40735..40962)
FT                   /locus_tag="FB2170_16256"
FT   CDS_pept        complement(40735..40962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16256"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00654"
FT                   /db_xref="GOA:A4AT84"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT84"
FT                   /protein_id="EAR00654.1"
FT   gene            complement(40972..42255)
FT                   /locus_tag="FB2170_16261"
FT   CDS_pept        complement(40972..42255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16261"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00655"
FT                   /db_xref="InterPro:IPR021272"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT85"
FT                   /protein_id="EAR00655.1"
FT   gene            complement(42315..42626)
FT                   /locus_tag="FB2170_16266"
FT   CDS_pept        complement(42315..42626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16266"
FT                   /product="rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16266"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00656"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT86"
FT                   /protein_id="EAR00656.1"
FT   gene            42792..43238
FT                   /locus_tag="FB2170_16271"
FT   CDS_pept        42792..43238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16271"
FT                   /product="hypothetical 161 kDa transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16271"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00657"
FT                   /db_xref="GOA:A4AT87"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT87"
FT                   /protein_id="EAR00657.1"
FT   gene            43273..43851
FT                   /locus_tag="FB2170_16276"
FT   CDS_pept        43273..43851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16276"
FT                   /product="YCE I like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16276"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00658"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT88"
FT                   /protein_id="EAR00658.1"
FT   gene            44091..45491
FT                   /locus_tag="FB2170_16281"
FT   CDS_pept        44091..45491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16281"
FT                   /product="anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16281"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00659"
FT                   /db_xref="GOA:A4AT89"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT89"
FT                   /protein_id="EAR00659.1"
FT                   ALEIAETI"
FT   gene            45513..46082
FT                   /locus_tag="FB2170_16286"
FT   CDS_pept        45513..46082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16286"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16286"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00660"
FT                   /db_xref="GOA:A4AT90"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT90"
FT                   /protein_id="EAR00660.1"
FT   gene            46111..47103
FT                   /locus_tag="FB2170_16291"
FT   CDS_pept        46111..47103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16291"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16291"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00661"
FT                   /db_xref="GOA:A4AT91"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT91"
FT                   /protein_id="EAR00661.1"
FT   gene            47122..47907
FT                   /locus_tag="FB2170_16296"
FT   CDS_pept        47122..47907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16296"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16296"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00662"
FT                   /db_xref="GOA:A4AT92"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT92"
FT                   /protein_id="EAR00662.1"
FT   gene            47909..48571
FT                   /locus_tag="FB2170_16301"
FT   CDS_pept        47909..48571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16301"
FT                   /product="putative N-(5'-phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16301"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00663"
FT                   /db_xref="GOA:A4AT93"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT93"
FT                   /protein_id="EAR00663.1"
FT   gene            48568..49749
FT                   /locus_tag="FB2170_16306"
FT   CDS_pept        48568..49749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16306"
FT                   /product="tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16306"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00664"
FT                   /db_xref="GOA:A4AT94"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT94"
FT                   /protein_id="EAR00664.1"
FT   gene            49746..50528
FT                   /locus_tag="FB2170_16311"
FT   CDS_pept        49746..50528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16311"
FT                   /product="tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16311"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00665"
FT                   /db_xref="GOA:A4AT95"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT95"
FT                   /protein_id="EAR00665.1"
FT   gene            50512..50736
FT                   /locus_tag="FB2170_16316"
FT   CDS_pept        50512..50736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16316"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00666"
FT                   /db_xref="GOA:A4AT96"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT96"
FT                   /protein_id="EAR00666.1"
FT   gene            50775..52271
FT                   /locus_tag="FB2170_16321"
FT   CDS_pept        50775..52271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16321"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16321"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00667"
FT                   /db_xref="GOA:A4AT97"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT97"
FT                   /protein_id="EAR00667.1"
FT   gene            complement(52268..52876)
FT                   /locus_tag="FB2170_16326"
FT   CDS_pept        complement(52268..52876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16326"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00668"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT98"
FT                   /protein_id="EAR00668.1"
FT   gene            complement(53167..55710)
FT                   /locus_tag="FB2170_16331"
FT   CDS_pept        complement(53167..55710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16331"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16331"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00669"
FT                   /db_xref="GOA:A4AT99"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT99"
FT                   /protein_id="EAR00669.1"
FT   gene            complement(55888..56547)
FT                   /locus_tag="FB2170_16336"
FT   CDS_pept        complement(55888..56547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16336"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00670"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA0"
FT                   /protein_id="EAR00670.1"
FT   gene            56666..56794
FT                   /locus_tag="FB2170_16341"
FT   CDS_pept        56666..56794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16341"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00671"
FT                   /db_xref="GOA:A4ATA1"
FT                   /db_xref="InterPro:IPR030826"
FT                   /db_xref="InterPro:IPR031414"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA1"
FT                   /protein_id="EAR00671.1"
FT   gene            complement(56798..57559)
FT                   /locus_tag="FB2170_16346"
FT   CDS_pept        complement(56798..57559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16346"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00672"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA2"
FT                   /protein_id="EAR00672.1"
FT   gene            complement(57651..58676)
FT                   /locus_tag="FB2170_16351"
FT   CDS_pept        complement(57651..58676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16351"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16351"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00673"
FT                   /db_xref="GOA:A4ATA3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA3"
FT                   /protein_id="EAR00673.1"
FT                   M"
FT   gene            complement(58680..59267)
FT                   /locus_tag="FB2170_16356"
FT   CDS_pept        complement(58680..59267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16356"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00674"
FT                   /db_xref="GOA:A4ATA4"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA4"
FT                   /protein_id="EAR00674.1"
FT   gene            59474..60457
FT                   /locus_tag="FB2170_16361"
FT   CDS_pept        59474..60457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16361"
FT                   /product="D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16361"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00675"
FT                   /db_xref="GOA:A4ATA5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA5"
FT                   /protein_id="EAR00675.1"
FT   gene            60467..60922
FT                   /locus_tag="FB2170_16366"
FT   CDS_pept        60467..60922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16366"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16366"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00676"
FT                   /db_xref="GOA:A4ATA6"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA6"
FT                   /protein_id="EAR00676.1"
FT   gene            61133..64132
FT                   /locus_tag="FB2170_16371"
FT   CDS_pept        61133..64132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16371"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16371"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00677"
FT                   /db_xref="GOA:A4ATA7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA7"
FT                   /protein_id="EAR00677.1"
FT                   TFNIYFNEEN"
FT   gene            64119..64523
FT                   /locus_tag="FB2170_16376"
FT   CDS_pept        64119..64523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16376"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16376"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00678"
FT                   /db_xref="GOA:A4ATA8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA8"
FT                   /protein_id="EAR00678.1"
FT   gene            complement(64552..65139)
FT                   /locus_tag="FB2170_16381"
FT   CDS_pept        complement(64552..65139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16381"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16381"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00679"
FT                   /db_xref="GOA:A4ATA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA9"
FT                   /protein_id="EAR00679.1"
FT   gene            65147..65788
FT                   /locus_tag="FB2170_16386"
FT   CDS_pept        65147..65788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16386"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16386"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00680"
FT                   /db_xref="GOA:A4ATB0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB0"
FT                   /protein_id="EAR00680.1"
FT   gene            65796..66188
FT                   /locus_tag="FB2170_16391"
FT   CDS_pept        65796..66188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16391"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00681"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB1"
FT                   /protein_id="EAR00681.1"
FT   gene            complement(66190..66921)
FT                   /locus_tag="FB2170_16396"
FT   CDS_pept        complement(66190..66921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16396"
FT                   /product="putative biotin--(acetyl-CoA carboxylase)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16396"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00682"
FT                   /db_xref="GOA:A4ATB2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB2"
FT                   /protein_id="EAR00682.1"
FT   gene            67015..67392
FT                   /locus_tag="FB2170_16401"
FT   CDS_pept        67015..67392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16401"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00683"
FT                   /db_xref="GOA:A4ATB3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB3"
FT                   /protein_id="EAR00683.1"
FT   gene            67402..69411
FT                   /locus_tag="FB2170_16406"
FT   CDS_pept        67402..69411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16406"
FT                   /product="putative transmembrane AAA-metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16406"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00684"
FT                   /db_xref="GOA:A4ATB4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB4"
FT                   /protein_id="EAR00684.1"
FT   gene            69470..70081
FT                   /locus_tag="FB2170_16411"
FT   CDS_pept        69470..70081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16411"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00685"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB5"
FT                   /protein_id="EAR00685.1"
FT   gene            70083..70886
FT                   /locus_tag="FB2170_16416"
FT   CDS_pept        70083..70886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16416"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16416"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00686"
FT                   /db_xref="GOA:A4ATB6"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB6"
FT                   /protein_id="EAR00686.1"
FT   gene            70876..71556
FT                   /locus_tag="FB2170_16421"
FT   CDS_pept        70876..71556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16421"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16421"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00687"
FT                   /db_xref="GOA:A4ATB7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB7"
FT                   /protein_id="EAR00687.1"
FT                   GDLT"
FT   gene            71534..71800
FT                   /locus_tag="FB2170_16426"
FT   CDS_pept        71534..71800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16426"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00688"
FT                   /db_xref="GOA:A4ATB8"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB8"
FT                   /protein_id="EAR00688.1"
FT   gene            complement(71807..72571)
FT                   /locus_tag="FB2170_16431"
FT   CDS_pept        complement(71807..72571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16431"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00689"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB9"
FT                   /protein_id="EAR00689.1"
FT   gene            complement(72581..73852)
FT                   /locus_tag="FB2170_16436"
FT   CDS_pept        complement(72581..73852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16436"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00690"
FT                   /db_xref="GOA:A4ATC0"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC0"
FT                   /protein_id="EAR00690.1"
FT   gene            complement(73923..74732)
FT                   /locus_tag="FB2170_16441"
FT   CDS_pept        complement(73923..74732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16441"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00691"
FT                   /db_xref="GOA:A4ATC1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC1"
FT                   /protein_id="EAR00691.1"
FT   gene            complement(74710..75558)
FT                   /locus_tag="FB2170_16446"
FT   CDS_pept        complement(74710..75558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16446"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00692"
FT                   /db_xref="GOA:A4ATC2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC2"
FT                   /protein_id="EAR00692.1"
FT                   I"
FT   gene            complement(75674..76264)
FT                   /locus_tag="FB2170_16451"
FT   CDS_pept        complement(75674..76264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16451"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00693"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC3"
FT                   /protein_id="EAR00693.1"
FT   gene            complement(76367..76576)
FT                   /locus_tag="FB2170_16456"
FT   CDS_pept        complement(76367..76576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16456"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00694"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC4"
FT                   /protein_id="EAR00694.1"
FT   gene            complement(76637..79267)
FT                   /locus_tag="FB2170_16461"
FT   CDS_pept        complement(76637..79267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16461"
FT                   /product="putative valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16461"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00695"
FT                   /db_xref="GOA:A4ATC5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC5"
FT                   /protein_id="EAR00695.1"
FT                   LASLS"
FT   gene            79465..79860
FT                   /locus_tag="FB2170_16466"
FT   CDS_pept        79465..79860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16466"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00696"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC6"
FT                   /protein_id="EAR00696.1"
FT   gene            complement(79895..81241)
FT                   /locus_tag="FB2170_16471"
FT   CDS_pept        complement(79895..81241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16471"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16471"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00697"
FT                   /db_xref="GOA:A4ATC7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC7"
FT                   /protein_id="EAR00697.1"
FT   gene            81393..82586
FT                   /locus_tag="FB2170_16476"
FT   CDS_pept        81393..82586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16476"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16476"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00698"
FT                   /db_xref="GOA:A4ATC8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC8"
FT                   /protein_id="EAR00698.1"
FT   gene            82583..83599
FT                   /locus_tag="FB2170_16481"
FT   CDS_pept        82583..83599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16481"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16481"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00699"
FT                   /db_xref="GOA:A4ATC9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC9"
FT                   /protein_id="EAR00699.1"
FT   gene            complement(83722..83811)
FT                   /locus_tag="FB2170_16486"
FT   CDS_pept        complement(83722..83811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16486"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16486"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00700"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD0"
FT                   /protein_id="EAR00700.1"
FT                   /translation="MQWFGFEKINALAASNQFILTVYPLNANL"
FT   gene            83810..84373
FT                   /locus_tag="FB2170_16491"
FT   CDS_pept        83810..84373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16491"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16491"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00701"
FT                   /db_xref="GOA:A4ATD1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD1"
FT                   /protein_id="EAR00701.1"
FT   gene            84373..85131
FT                   /locus_tag="FB2170_16496"
FT   CDS_pept        84373..85131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16496"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16496"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00702"
FT                   /db_xref="GOA:A4ATD2"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD2"
FT                   /protein_id="EAR00702.1"
FT   gene            85212..85421
FT                   /locus_tag="FB2170_16501"
FT   CDS_pept        85212..85421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16501"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00703"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD3"
FT                   /protein_id="EAR00703.1"
FT   gene            85457..86017
FT                   /locus_tag="FB2170_16506"
FT   CDS_pept        85457..86017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16506"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16506"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00704"
FT                   /db_xref="GOA:A4ATD4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD4"
FT                   /protein_id="EAR00704.1"
FT   gene            86126..86992
FT                   /locus_tag="FB2170_16511"
FT   CDS_pept        86126..86992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16511"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16511"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00705"
FT                   /db_xref="GOA:A4ATD5"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD5"
FT                   /protein_id="EAR00705.1"
FT                   KAHKHIN"
FT   gene            87037..88047
FT                   /locus_tag="FB2170_16516"
FT   CDS_pept        87037..88047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16516"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16516"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00706"
FT                   /db_xref="GOA:A4ATD6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD6"
FT                   /protein_id="EAR00706.1"
FT   gene            88080..90266
FT                   /locus_tag="FB2170_16521"
FT   CDS_pept        88080..90266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16521"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16521"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00707"
FT                   /db_xref="GOA:A4ATD7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD7"
FT                   /protein_id="EAR00707.1"
FT   gene            complement(90256..91290)
FT                   /locus_tag="FB2170_16526"
FT   CDS_pept        complement(90256..91290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16526"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16526"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00708"
FT                   /db_xref="GOA:A4ATD8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD8"
FT                   /protein_id="EAR00708.1"
FT                   QVMS"
FT   gene            91306..92400
FT                   /locus_tag="FB2170_16531"
FT   CDS_pept        91306..92400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16531"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00709"
FT                   /db_xref="GOA:A4ATD9"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD9"
FT                   /protein_id="EAR00709.1"
FT   gene            92403..93182
FT                   /locus_tag="FB2170_16536"
FT   CDS_pept        92403..93182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16536"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00710"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE0"
FT                   /protein_id="EAR00710.1"
FT   gene            complement(93252..94595)
FT                   /locus_tag="FB2170_16541"
FT   CDS_pept        complement(93252..94595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16541"
FT                   /product="monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16541"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00711"
FT                   /db_xref="GOA:A4ATE1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR027545"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE1"
FT                   /protein_id="EAR00711.1"
FT   gene            complement(94851..95399)
FT                   /locus_tag="FB2170_16546"
FT   CDS_pept        complement(94851..95399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16546"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16546"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00712"
FT                   /db_xref="GOA:A4ATE2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE2"
FT                   /protein_id="EAR00712.1"
FT   gene            95399..96187
FT                   /locus_tag="FB2170_16551"
FT   CDS_pept        95399..96187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16551"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00713"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE3"
FT                   /protein_id="EAR00713.1"
FT   gene            complement(96195..97349)
FT                   /locus_tag="FB2170_16556"
FT   CDS_pept        complement(96195..97349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16556"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16556"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00714"
FT                   /db_xref="GOA:A4ATE4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE4"
FT                   /protein_id="EAR00714.1"
FT   gene            97504..98373
FT                   /locus_tag="FB2170_16561"
FT   CDS_pept        97504..98373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16561"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16561"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00715"
FT                   /db_xref="GOA:A4ATE5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE5"
FT                   /protein_id="EAR00715.1"
FT                   KSNRIKSH"
FT   gene            complement(98370..99704)
FT                   /locus_tag="FB2170_16566"
FT   CDS_pept        complement(98370..99704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16566"
FT                   /product="kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16566"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00716"
FT                   /db_xref="GOA:A4ATE6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE6"
FT                   /protein_id="EAR00716.1"
FT   gene            complement(99705..100163)
FT                   /locus_tag="FB2170_16571"
FT   CDS_pept        complement(99705..100163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16571"
FT                   /product="predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16571"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00717"
FT                   /db_xref="GOA:A4ATE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE7"
FT                   /protein_id="EAR00717.1"
FT   gene            100232..100873
FT                   /locus_tag="FB2170_16576"
FT   CDS_pept        100232..100873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16576"
FT                   /product="O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16576"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00718"
FT                   /db_xref="GOA:A4ATE8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE8"
FT                   /protein_id="EAR00718.1"
FT   gene            complement(100839..101411)
FT                   /locus_tag="FB2170_16581"
FT   CDS_pept        complement(100839..101411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16581"
FT                   /product="PAP2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16581"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00719"
FT                   /db_xref="GOA:A4ATE9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE9"
FT                   /protein_id="EAR00719.1"
FT   gene            complement(101422..101760)
FT                   /locus_tag="FB2170_16586"
FT   CDS_pept        complement(101422..101760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16586"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00720"
FT                   /db_xref="GOA:A4ATF0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF0"
FT                   /protein_id="EAR00720.1"
FT                   VTGSIKRK"
FT   gene            complement(101844..104150)
FT                   /locus_tag="FB2170_16591"
FT   CDS_pept        complement(101844..104150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16591"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16591"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00721"
FT                   /db_xref="GOA:A4ATF1"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF1"
FT                   /protein_id="EAR00721.1"
FT                   EEQNDFDKFKEKIKG"
FT   gene            complement(104214..104729)
FT                   /locus_tag="FB2170_16596"
FT   CDS_pept        complement(104214..104729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16596"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00722"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF2"
FT                   /protein_id="EAR00722.1"
FT                   NNKGMLKL"
FT   gene            complement(104771..105613)
FT                   /locus_tag="FB2170_16601"
FT   CDS_pept        complement(104771..105613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16601"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16601"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00723"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF3"
FT                   /protein_id="EAR00723.1"
FT   gene            complement(105600..106343)
FT                   /locus_tag="FB2170_16606"
FT   CDS_pept        complement(105600..106343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16606"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00724"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF4"
FT                   /protein_id="EAR00724.1"
FT   gene            complement(106369..107115)
FT                   /locus_tag="FB2170_16611"
FT   CDS_pept        complement(106369..107115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16611"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00725"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF5"
FT                   /protein_id="EAR00725.1"
FT   gene            107389..110478
FT                   /locus_tag="FB2170_16616"
FT   CDS_pept        107389..110478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16616"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00726"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF6"
FT                   /protein_id="EAR00726.1"
FT   gene            110487..111635
FT                   /locus_tag="FB2170_16621"
FT   CDS_pept        110487..111635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16621"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00727"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF7"
FT                   /protein_id="EAR00727.1"
FT   gene            112006..116301
FT                   /locus_tag="FB2170_16626"
FT   CDS_pept        112006..116301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16626"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00728"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF8"
FT                   /protein_id="EAR00728.1"
FT   gene            116301..117494
FT                   /locus_tag="FB2170_16631"
FT   CDS_pept        116301..117494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16631"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00729"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF9"
FT                   /protein_id="EAR00729.1"
FT   gene            117908..121606
FT                   /locus_tag="FB2170_16636"
FT   CDS_pept        117908..121606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16636"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16636"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00730"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG0"
FT                   /protein_id="EAR00730.1"
FT                   MFTILDL"
FT   gene            121611..122732
FT                   /locus_tag="FB2170_16641"
FT   CDS_pept        121611..122732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16641"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00731"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG1"
FT                   /protein_id="EAR00731.1"
FT   gene            122842..123879
FT                   /locus_tag="FB2170_16646"
FT   CDS_pept        122842..123879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16646"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00732"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG2"
FT                   /protein_id="EAR00732.1"
FT                   FYLSL"
FT   gene            124253..124987
FT                   /locus_tag="FB2170_16651"
FT   CDS_pept        124253..124987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16651"
FT                   /product="D-alanyl-D-alanine carboxypeptidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16651"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00733"
FT                   /db_xref="GOA:A4ATG3"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG3"
FT                   /protein_id="EAR00733.1"
FT   gene            125028..125792
FT                   /locus_tag="FB2170_16656"
FT   CDS_pept        125028..125792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16656"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00734"
FT                   /db_xref="GOA:A4ATG4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG4"
FT                   /protein_id="EAR00734.1"
FT   gene            125922..126089
FT                   /locus_tag="FB2170_16661"
FT   CDS_pept        125922..126089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16661"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00735"
FT                   /db_xref="GOA:A4ATG5"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG5"
FT                   /protein_id="EAR00735.1"
FT                   MYRAFTGFEF"
FT   gene            complement(126198..126692)
FT                   /locus_tag="FB2170_16666"
FT   CDS_pept        complement(126198..126692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16666"
FT                   /product="Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16666"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00736"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG6"
FT                   /protein_id="EAR00736.1"
FT                   S"
FT   gene            126793..128337
FT                   /locus_tag="FB2170_16671"
FT   CDS_pept        126793..128337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16671"
FT                   /product="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16671"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00737"
FT                   /db_xref="GOA:A4ATG7"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG7"
FT                   /protein_id="EAR00737.1"
FT   gene            128371..129189
FT                   /locus_tag="FB2170_16676"
FT   CDS_pept        128371..129189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16676"
FT                   /product="methionine aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16676"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00738"
FT                   /db_xref="GOA:A4ATG8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG8"
FT                   /protein_id="EAR00738.1"
FT   gene            129311..129997
FT                   /locus_tag="FB2170_16681"
FT   CDS_pept        129311..129997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16681"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16681"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00739"
FT                   /db_xref="GOA:A4ATG9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG9"
FT                   /protein_id="EAR00739.1"
FT                   PLVKKV"
FT   gene            complement(129994..131022)
FT                   /locus_tag="FB2170_16686"
FT   CDS_pept        complement(129994..131022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16686"
FT                   /product="thiamine biosynthesis lipoprotein ApbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16686"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00740"
FT                   /db_xref="GOA:A4ATH0"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH0"
FT                   /protein_id="EAR00740.1"
FT                   LD"
FT   gene            complement(131000..131365)
FT                   /locus_tag="FB2170_16691"
FT   CDS_pept        complement(131000..131365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16691"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16691"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00741"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH1"
FT                   /protein_id="EAR00741.1"
FT                   VLLNEKYIVEYDGLIEL"
FT   gene            complement(131461..132768)
FT                   /locus_tag="FB2170_16696"
FT   CDS_pept        complement(131461..132768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16696"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16696"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00742"
FT                   /db_xref="GOA:A4ATH2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH2"
FT                   /protein_id="EAR00742.1"
FT   gene            complement(132771..133517)
FT                   /locus_tag="FB2170_16701"
FT   CDS_pept        complement(132771..133517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16701"
FT                   /product="NADH:ubiquinone oxidoreductase, Na translocating,
FT                   E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16701"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00743"
FT                   /db_xref="GOA:A4ATH3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH3"
FT                   /protein_id="EAR00743.1"
FT   gene            complement(133539..134186)
FT                   /locus_tag="FB2170_16706"
FT   CDS_pept        complement(133539..134186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16706"
FT                   /product="NADH-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16706"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00744"
FT                   /db_xref="GOA:A4ATH4"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH4"
FT                   /protein_id="EAR00744.1"
FT   gene            complement(134188..134937)
FT                   /locus_tag="FB2170_16711"
FT   CDS_pept        complement(134188..134937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16711"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16711"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00745"
FT                   /db_xref="GOA:A4ATH5"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH5"
FT                   /protein_id="EAR00745.1"
FT   gene            complement(134940..136214)
FT                   /locus_tag="FB2170_16716"
FT   CDS_pept        complement(134940..136214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16716"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16716"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00746"
FT                   /db_xref="GOA:A4ATH6"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH6"
FT                   /protein_id="EAR00746.1"
FT   gene            complement(136218..137567)
FT                   /locus_tag="FB2170_16721"
FT   CDS_pept        complement(136218..137567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16721"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16721"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00747"
FT                   /db_xref="GOA:A4ATH7"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH7"
FT                   /protein_id="EAR00747.1"
FT   gene            137744..138964
FT                   /locus_tag="FB2170_16726"
FT   CDS_pept        137744..138964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16726"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00748"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031345"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH8"
FT                   /protein_id="EAR00748.1"
FT                   NSQNISN"
FT   gene            138993..140126
FT                   /locus_tag="FB2170_16731"
FT   CDS_pept        138993..140126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16731"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00749"
FT                   /db_xref="GOA:A4ATH9"
FT                   /db_xref="InterPro:IPR022134"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH9"
FT                   /protein_id="EAR00749.1"
FT   gene            140128..140520
FT                   /locus_tag="FB2170_16736"
FT   CDS_pept        140128..140520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16736"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00750"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI0"
FT                   /protein_id="EAR00750.1"
FT   gene            140605..142233
FT                   /locus_tag="FB2170_16741"
FT   CDS_pept        140605..142233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16741"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16741"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00751"
FT                   /db_xref="GOA:A4ATI1"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI1"
FT                   /protein_id="EAR00751.1"
FT   gene            complement(142604..143269)
FT                   /locus_tag="FB2170_16746"
FT   CDS_pept        complement(142604..143269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16746"
FT                   /product="glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16746"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00752"
FT                   /db_xref="GOA:A4ATI2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI2"
FT                   /protein_id="EAR00752.1"
FT   gene            143359..144459
FT                   /locus_tag="FB2170_16751"
FT   CDS_pept        143359..144459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16751"
FT                   /product="linoleoyl-CoA desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16751"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00753"
FT                   /db_xref="GOA:A4ATI3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI3"
FT                   /protein_id="EAR00753.1"
FT   gene            144476..145663
FT                   /locus_tag="FB2170_16756"
FT   CDS_pept        144476..145663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16756"
FT                   /product="putative aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16756"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00754"
FT                   /db_xref="GOA:A4ATI4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI4"
FT                   /protein_id="EAR00754.1"
FT   gene            complement(145717..147207)
FT                   /locus_tag="FB2170_16761"
FT   CDS_pept        complement(145717..147207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16761"
FT                   /product="putative potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16761"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00755"
FT                   /db_xref="GOA:A4ATI5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI5"
FT                   /protein_id="EAR00755.1"
FT   gene            complement(147209..148558)
FT                   /locus_tag="FB2170_16766"
FT   CDS_pept        complement(147209..148558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16766"
FT                   /product="putative potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16766"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00756"
FT                   /db_xref="GOA:A4ATI6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI6"
FT                   /protein_id="EAR00756.1"
FT   gene            148812..149540
FT                   /locus_tag="FB2170_16771"
FT   CDS_pept        148812..149540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16771"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16771"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00757"
FT                   /db_xref="GOA:A4ATI7"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI7"
FT                   /protein_id="EAR00757.1"
FT   gene            149545..150240
FT                   /locus_tag="FB2170_16776"
FT   CDS_pept        149545..150240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16776"
FT                   /product="porT protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16776"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00758"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI8"
FT                   /protein_id="EAR00758.1"
FT                   GLFVNFTFE"
FT   gene            complement(150248..150970)
FT                   /locus_tag="FB2170_16781"
FT   CDS_pept        complement(150248..150970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16781"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16781"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00759"
FT                   /db_xref="GOA:A4ATI9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI9"
FT                   /protein_id="EAR00759.1"
FT                   SLNVASATSIFLSEIRRV"
FT   gene            150953..153616
FT                   /locus_tag="FB2170_16786"
FT   CDS_pept        150953..153616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16786"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00760"
FT                   /db_xref="GOA:A4ATJ0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ0"
FT                   /protein_id="EAR00760.1"
FT                   YNFANSVLQIGINYPF"
FT   gene            153676..154743
FT                   /locus_tag="FB2170_16791"
FT   CDS_pept        153676..154743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16791"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16791"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00761"
FT                   /db_xref="GOA:A4ATJ1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ1"
FT                   /protein_id="EAR00761.1"
FT                   RLKKAFDDLNNVNTL"
FT   gene            154762..155628
FT                   /locus_tag="FB2170_16796"
FT   CDS_pept        154762..155628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16796"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16796"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00762"
FT                   /db_xref="GOA:A4ATJ2"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ2"
FT                   /protein_id="EAR00762.1"
FT                   IQNNPVR"
FT   gene            complement(155679..156539)
FT                   /locus_tag="FB2170_16801"
FT   CDS_pept        complement(155679..156539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16801"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00763"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ3"
FT                   /protein_id="EAR00763.1"
FT                   RRFKH"
FT   gene            156703..156972
FT                   /locus_tag="FB2170_16806"
FT   CDS_pept        156703..156972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16806"
FT                   /product="putative 30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16806"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00764"
FT                   /db_xref="GOA:A4ATJ4"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ4"
FT                   /protein_id="EAR00764.1"
FT   gene            157166..159379
FT                   /locus_tag="FB2170_16811"
FT   CDS_pept        157166..159379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16811"
FT                   /product="putative polyribonucleotide
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16811"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00765"
FT                   /db_xref="GOA:A4ATJ5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ5"
FT                   /protein_id="EAR00765.1"
FT   gene            159538..160401
FT                   /locus_tag="FB2170_16816"
FT   CDS_pept        159538..160401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16816"
FT                   /product="putative sigma factor A"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16816"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00766"
FT                   /db_xref="GOA:A4ATJ6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ6"
FT                   /protein_id="EAR00766.1"
FT                   LKTYLG"
FT   gene            160615..160845
FT                   /locus_tag="FB2170_16821"
FT   CDS_pept        160615..160845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16821"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00767"
FT                   /db_xref="GOA:A4ATJ7"
FT                   /db_xref="InterPro:IPR018668"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ7"
FT                   /protein_id="EAR00767.1"
FT   gene            160835..161287
FT                   /locus_tag="FB2170_16826"
FT   CDS_pept        160835..161287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16826"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16826"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00768"
FT                   /db_xref="GOA:A4ATJ8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ8"
FT                   /protein_id="EAR00768.1"
FT   gene            complement(161304..162272)
FT                   /locus_tag="FB2170_16831"
FT   CDS_pept        complement(161304..162272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16831"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00769"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ9"
FT                   /protein_id="EAR00769.1"
FT   gene            162411..165041
FT                   /locus_tag="FB2170_16836"
FT   CDS_pept        162411..165041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16836"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00770"
FT                   /db_xref="GOA:A4ATK0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK0"
FT                   /protein_id="EAR00770.1"
FT                   VYKDD"
FT   gene            165034..165966
FT                   /locus_tag="FB2170_16841"
FT   CDS_pept        165034..165966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16841"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16841"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00771"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK1"
FT                   /protein_id="EAR00771.1"
FT   gene            165959..166909
FT                   /locus_tag="FB2170_16846"
FT   CDS_pept        165959..166909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16846"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16846"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00772"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK2"
FT                   /protein_id="EAR00772.1"
FT   gene            167005..167664
FT                   /locus_tag="FB2170_16851"
FT   CDS_pept        167005..167664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16851"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16851"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00773"
FT                   /db_xref="GOA:A4ATK3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK3"
FT                   /protein_id="EAR00773.1"
FT   gene            167664..168632
FT                   /locus_tag="FB2170_16856"
FT   CDS_pept        167664..168632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16856"
FT                   /product="Pyridine nucleotide-disulphide oxidoreductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16856"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00774"
FT                   /db_xref="InterPro:IPR023856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK4"
FT                   /protein_id="EAR00774.1"
FT   gene            168713..169579
FT                   /locus_tag="FB2170_16861"
FT   CDS_pept        168713..169579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16861"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16861"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00775"
FT                   /db_xref="GOA:A4ATK5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK5"
FT                   /protein_id="EAR00775.1"
FT                   KRYQKIT"
FT   gene            complement(169586..172924)
FT                   /locus_tag="FB2170_16866"
FT   CDS_pept        complement(169586..172924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16866"
FT                   /product="probable secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16866"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00776"
FT                   /db_xref="GOA:A4ATK6"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013428"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK6"
FT                   /protein_id="EAR00776.1"
FT                   DWIKK"
FT   gene            complement(173012..173422)
FT                   /locus_tag="FB2170_16871"
FT   CDS_pept        complement(173012..173422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16871"
FT                   /product="putative cupin"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16871"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00777"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK7"
FT                   /protein_id="EAR00777.1"
FT   gene            complement(173428..174291)
FT                   /locus_tag="FB2170_16876"
FT   CDS_pept        complement(173428..174291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16876"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16876"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00778"
FT                   /db_xref="GOA:A4ATK8"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK8"
FT                   /protein_id="EAR00778.1"
FT                   SLTLNK"
FT   gene            complement(174464..175684)
FT                   /locus_tag="FB2170_16881"
FT   CDS_pept        complement(174464..175684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16881"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00779"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK9"
FT                   /protein_id="EAR00779.1"
FT                   LLKLIQD"
FT   gene            176062..176820
FT                   /locus_tag="FB2170_16886"
FT   CDS_pept        176062..176820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16886"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16886"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00780"
FT                   /db_xref="GOA:A4ATL0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL0"
FT                   /protein_id="EAR00780.1"
FT   gene            complement(176862..177947)
FT                   /locus_tag="FB2170_16891"
FT   CDS_pept        complement(176862..177947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16891"
FT                   /product="Alpha-tubulin suppressor and related RCC1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16891"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00781"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL1"
FT                   /protein_id="EAR00781.1"
FT   gene            complement(178119..178195)
FT                   /locus_tag="FB2170_t09000"
FT   tRNA            complement(178119..178195)
FT                   /locus_tag="FB2170_t09000"
FT                   /product="tRNA-Arg"
FT   gene            complement(178215..178661)
FT                   /locus_tag="FB2170_16896"
FT   CDS_pept        complement(178215..178661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16896"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16896"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00782"
FT                   /db_xref="GOA:A4ATL2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL2"
FT                   /protein_id="EAR00782.1"
FT   gene            complement(178752..180671)
FT                   /locus_tag="FB2170_16901"
FT   CDS_pept        complement(178752..180671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16901"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16901"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00783"
FT                   /db_xref="GOA:A4ATL3"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL3"
FT                   /protein_id="EAR00783.1"
FT                   DNVD"
FT   gene            complement(180719..182041)
FT                   /locus_tag="FB2170_16906"
FT   CDS_pept        complement(180719..182041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16906"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16906"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00784"
FT                   /db_xref="GOA:A4ATL4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL4"
FT                   /protein_id="EAR00784.1"
FT   gene            complement(182050..182769)
FT                   /locus_tag="FB2170_16911"
FT   CDS_pept        complement(182050..182769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16911"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16911"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00785"
FT                   /db_xref="GOA:A4ATL5"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL5"
FT                   /protein_id="EAR00785.1"
FT                   YNVVSLEFNNQVVCTKI"
FT   gene            complement(182759..184111)
FT                   /locus_tag="FB2170_16916"
FT   CDS_pept        complement(182759..184111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16916"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16916"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00786"
FT                   /db_xref="GOA:A4ATL6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL6"
FT                   /protein_id="EAR00786.1"
FT   gene            complement(184112..185203)
FT                   /locus_tag="FB2170_16921"
FT   CDS_pept        complement(184112..185203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16921"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16921"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00787"
FT                   /db_xref="GOA:A4ATL7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL7"
FT                   /protein_id="EAR00787.1"
FT   gene            complement(185190..186389)
FT                   /locus_tag="FB2170_16926"
FT   CDS_pept        complement(185190..186389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16926"
FT                   /product="putative transmembrane rod-shape determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16926"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00788"
FT                   /db_xref="GOA:A4ATL8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL8"
FT                   /protein_id="EAR00788.1"
FT                   "
FT   gene            complement(186392..187726)
FT                   /locus_tag="FB2170_16931"
FT   CDS_pept        complement(186392..187726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16931"
FT                   /product="putative UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16931"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00789"
FT                   /db_xref="GOA:A4ATL9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL9"
FT                   /protein_id="EAR00789.1"
FT   gene            complement(187727..188947)
FT                   /locus_tag="FB2170_16936"
FT   CDS_pept        complement(187727..188947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16936"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16936"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00790"
FT                   /db_xref="GOA:A4ATM0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM0"
FT                   /protein_id="EAR00790.1"
FT                   IVTLKVR"
FT   gene            complement(188972..190435)
FT                   /locus_tag="FB2170_16941"
FT   CDS_pept        complement(188972..190435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16941"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16941"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00791"
FT                   /db_xref="GOA:A4ATM1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM1"
FT                   /protein_id="EAR00791.1"
FT   gene            complement(190432..192438)
FT                   /locus_tag="FB2170_16946"
FT   CDS_pept        complement(190432..192438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16946"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16946"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00792"
FT                   /db_xref="GOA:A4ATM2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM2"
FT                   /protein_id="EAR00792.1"
FT   gene            complement(192438..192758)
FT                   /locus_tag="FB2170_16951"
FT   CDS_pept        complement(192438..192758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16951"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16951"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00793"
FT                   /db_xref="GOA:A4ATM3"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM3"
FT                   /protein_id="EAR00793.1"
FT                   KD"
FT   gene            complement(192766..193659)
FT                   /locus_tag="FB2170_16956"
FT   CDS_pept        complement(192766..193659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16956"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16956"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00794"
FT                   /db_xref="GOA:A4ATM4"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM4"
FT                   /protein_id="EAR00794.1"
FT                   LNNRARSAKLRIAERI"
FT   gene            complement(193649..194119)
FT                   /locus_tag="FB2170_16961"
FT   CDS_pept        complement(193649..194119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16961"
FT                   /product="mraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16961"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00795"
FT                   /db_xref="GOA:A4ATM5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM5"
FT                   /protein_id="EAR00795.1"
FT   gene            194229..194369
FT                   /locus_tag="FB2170_16966"
FT   CDS_pept        194229..194369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16966"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00796"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM6"
FT                   /protein_id="EAR00796.1"
FT                   N"
FT   gene            194387..195151
FT                   /locus_tag="FB2170_16971"
FT   CDS_pept        194387..195151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16971"
FT                   /product="beta-D-galactosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16971"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00797"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM7"
FT                   /protein_id="EAR00797.1"
FT   gene            195163..195774
FT                   /locus_tag="FB2170_16976"
FT   CDS_pept        195163..195774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16976"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16976"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00798"
FT                   /db_xref="GOA:A4ATM8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM8"
FT                   /protein_id="EAR00798.1"
FT   gene            complement(195782..196144)
FT                   /locus_tag="FB2170_16981"
FT   CDS_pept        complement(195782..196144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16981"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16981"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00799"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM9"
FT                   /protein_id="EAR00799.1"
FT                   AMQRAEDLIKIIQQRV"
FT   gene            196226..197860
FT                   /locus_tag="FB2170_16986"
FT   CDS_pept        196226..197860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16986"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16986"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00800"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN0"
FT                   /protein_id="EAR00800.1"
FT   gene            complement(197865..199199)
FT                   /locus_tag="FB2170_16991"
FT   CDS_pept        complement(197865..199199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16991"
FT                   /product="diphosphate--fructose-6-phosphate
FT                   1-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16991"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00801"
FT                   /db_xref="GOA:A4ATN1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN1"
FT                   /protein_id="EAR00801.1"
FT   gene            complement(199350..199685)
FT                   /locus_tag="FB2170_16996"
FT   CDS_pept        complement(199350..199685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16996"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00802"
FT                   /db_xref="InterPro:IPR019854"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN2"
FT                   /protein_id="EAR00802.1"
FT                   EKLELKK"
FT   gene            complement(199686..200642)
FT                   /locus_tag="FB2170_17001"
FT   CDS_pept        complement(199686..200642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17001"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00803"
FT                   /db_xref="InterPro:IPR019853"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN3"
FT                   /protein_id="EAR00803.1"
FT   gene            200734..201522
FT                   /locus_tag="FB2170_17006"
FT   CDS_pept        200734..201522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17006"
FT                   /product="putative NH(3)-dependent NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17006"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00804"
FT                   /db_xref="GOA:A4ATN4"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN4"
FT                   /protein_id="EAR00804.1"
FT   gene            201679..202308
FT                   /locus_tag="FB2170_17011"
FT   CDS_pept        201679..202308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17011"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17011"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00805"
FT                   /db_xref="GOA:A4ATN5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN5"
FT                   /protein_id="EAR00805.1"
FT   gene            complement(202384..204363)
FT                   /locus_tag="FB2170_17016"
FT   CDS_pept        complement(202384..204363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17016"
FT                   /product="putative DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17016"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00806"
FT                   /db_xref="GOA:A4ATN6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN6"
FT                   /protein_id="EAR00806.1"
FT   gene            204433..204672
FT                   /locus_tag="FB2170_17021"
FT   CDS_pept        204433..204672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17021"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00807"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN7"
FT                   /protein_id="EAR00807.1"
FT   gene            complement(204694..205776)
FT                   /locus_tag="FB2170_17026"
FT   CDS_pept        complement(204694..205776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17026"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00808"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN8"
FT                   /protein_id="EAR00808.1"
FT   gene            complement(205857..206600)
FT                   /locus_tag="FB2170_17031"
FT   CDS_pept        complement(205857..206600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17031"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00809"
FT                   /db_xref="GOA:A4ATN9"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN9"
FT                   /protein_id="EAR00809.1"
FT   gene            complement(206587..207150)
FT                   /locus_tag="FB2170_17036"
FT   CDS_pept        complement(206587..207150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17036"
FT                   /product="putative RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17036"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00810"
FT                   /db_xref="GOA:A4ATP0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP0"
FT                   /protein_id="EAR00810.1"
FT   gene            complement(207263..208240)
FT                   /locus_tag="FB2170_17041"
FT   CDS_pept        complement(207263..208240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17041"
FT                   /product="polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17041"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00811"
FT                   /db_xref="GOA:A4ATP1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP1"
FT                   /protein_id="EAR00811.1"
FT   gene            complement(208334..209380)
FT                   /locus_tag="FB2170_17046"
FT   CDS_pept        complement(208334..209380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17046"
FT                   /product="radical SAM enzyme, Cfr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17046"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00812"
FT                   /db_xref="GOA:A4ATP2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP2"
FT                   /protein_id="EAR00812.1"
FT                   CGQLANKS"
FT   gene            complement(209481..210530)
FT                   /locus_tag="FB2170_17051"
FT   CDS_pept        complement(209481..210530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17051"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17051"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00813"
FT                   /db_xref="GOA:A4ATP3"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP3"
FT                   /protein_id="EAR00813.1"
FT                   SYGDAMLII"
FT   gene            complement(210630..211859)
FT                   /locus_tag="FB2170_17056"
FT   CDS_pept        complement(210630..211859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17056"
FT                   /product="putative 3-phosphoshikimate
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17056"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00814"
FT                   /db_xref="GOA:A4ATP4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP4"
FT                   /protein_id="EAR00814.1"
FT                   ETLGFKLRKL"
FT   gene            complement(211896..212222)
FT                   /locus_tag="FB2170_17061"
FT   CDS_pept        complement(211896..212222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17061"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00815"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR012359"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP5"
FT                   /protein_id="EAR00815.1"
FT                   EKLK"
FT   gene            complement(212222..212674)
FT                   /locus_tag="FB2170_17066"
FT   CDS_pept        complement(212222..212674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17066"
FT                   /product="D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17066"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00816"
FT                   /db_xref="GOA:A4ATP6"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP6"
FT                   /protein_id="EAR00816.1"
FT   gene            complement(212702..213655)
FT                   /locus_tag="FB2170_17071"
FT   CDS_pept        complement(212702..213655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17071"
FT                   /product="ribosome-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17071"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00817"
FT                   /db_xref="GOA:A4ATP7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP7"
FT                   /protein_id="EAR00817.1"
FT   gene            213765..214568
FT                   /locus_tag="FB2170_17076"
FT   CDS_pept        213765..214568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17076"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00818"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP8"
FT                   /protein_id="EAR00818.1"
FT   gene            214711..215151
FT                   /locus_tag="FB2170_17081"
FT   CDS_pept        214711..215151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17081"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00819"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP9"
FT                   /protein_id="EAR00819.1"
FT   gene            complement(215188..215862)
FT                   /locus_tag="FB2170_17086"
FT   CDS_pept        complement(215188..215862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17086"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00820"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ0"
FT                   /protein_id="EAR00820.1"
FT                   KD"
FT   gene            complement(215957..217039)
FT                   /locus_tag="FB2170_17091"
FT   CDS_pept        complement(215957..217039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17091"
FT                   /product="putative chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17091"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00821"
FT                   /db_xref="GOA:A4ATQ1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ1"
FT                   /protein_id="EAR00821.1"
FT   gene            complement(217053..217910)
FT                   /locus_tag="FB2170_17096"
FT   CDS_pept        complement(217053..217910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17096"
FT                   /product="Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17096"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00822"
FT                   /db_xref="GOA:A4ATQ2"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ2"
FT                   /protein_id="EAR00822.1"
FT                   PLNK"
FT   gene            complement(217912..219057)
FT                   /locus_tag="FB2170_17101"
FT   CDS_pept        complement(217912..219057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17101"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17101"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00823"
FT                   /db_xref="GOA:A4ATQ3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ3"
FT                   /protein_id="EAR00823.1"
FT   gene            complement(219054..219881)
FT                   /locus_tag="FB2170_17106"
FT   CDS_pept        complement(219054..219881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17106"
FT                   /product="putative prefrenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17106"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00824"
FT                   /db_xref="GOA:A4ATQ4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ4"
FT                   /protein_id="EAR00824.1"
FT   gene            complement(220170..221264)
FT                   /locus_tag="FB2170_17111"
FT   CDS_pept        complement(220170..221264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17111"
FT                   /product="FmtA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17111"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00825"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ5"
FT                   /protein_id="EAR00825.1"
FT   gene            complement(221346..222095)
FT                   /locus_tag="FB2170_17116"
FT   CDS_pept        complement(221346..222095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17116"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00826"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ6"
FT                   /protein_id="EAR00826.1"
FT   gene            complement(222092..223192)
FT                   /locus_tag="FB2170_17121"
FT   CDS_pept        complement(222092..223192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17121"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00827"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ7"
FT                   /protein_id="EAR00827.1"
FT   gene            complement(223277..224230)
FT                   /locus_tag="FB2170_17126"
FT   CDS_pept        complement(223277..224230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17126"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17126"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00828"
FT                   /db_xref="GOA:A4ATQ8"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ8"
FT                   /protein_id="EAR00828.1"
FT   gene            complement(224249..226939)
FT                   /locus_tag="FB2170_17131"
FT   CDS_pept        complement(224249..226939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17131"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17131"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00829"
FT                   /db_xref="GOA:A4ATQ9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ9"
FT                   /protein_id="EAR00829.1"
FT   gene            complement(226939..227421)
FT                   /locus_tag="FB2170_17136"
FT   CDS_pept        complement(226939..227421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17136"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00830"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR0"
FT                   /protein_id="EAR00830.1"
FT   gene            complement(227444..228436)
FT                   /locus_tag="FB2170_17141"
FT   CDS_pept        complement(227444..228436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17141"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17141"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00831"
FT                   /db_xref="GOA:A4ATR1"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR1"
FT                   /protein_id="EAR00831.1"
FT   gene            complement(228503..228682)
FT                   /locus_tag="FB2170_17146"
FT   CDS_pept        complement(228503..228682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17146"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00832"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR2"
FT                   /protein_id="EAR00832.1"
FT                   KDNREKEGLSFIQS"
FT   gene            complement(228734..229315)
FT                   /locus_tag="FB2170_17151"
FT   CDS_pept        complement(228734..229315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17151"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17151"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00833"
FT                   /db_xref="GOA:A4ATR3"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR3"
FT                   /protein_id="EAR00833.1"
FT   gene            complement(229318..230085)
FT                   /locus_tag="FB2170_17156"
FT   CDS_pept        complement(229318..230085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17156"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17156"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00834"
FT                   /db_xref="GOA:A4ATR4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR4"
FT                   /protein_id="EAR00834.1"
FT   gene            complement(230078..232168)
FT                   /locus_tag="FB2170_17161"
FT   CDS_pept        complement(230078..232168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17161"
FT                   /product="probable sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17161"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00835"
FT                   /db_xref="GOA:A4ATR5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR5"
FT                   /protein_id="EAR00835.1"
FT                   NV"
FT   gene            complement(232263..233510)
FT                   /locus_tag="FB2170_17166"
FT   CDS_pept        complement(232263..233510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17166"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17166"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00836"
FT                   /db_xref="GOA:A4ATR6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR6"
FT                   /protein_id="EAR00836.1"
FT                   LIDTQSNNTVGAGFIS"
FT   gene            complement(233612..234511)
FT                   /locus_tag="FB2170_17171"
FT   CDS_pept        complement(233612..234511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17171"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17171"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00837"
FT                   /db_xref="GOA:A4ATR7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR7"
FT                   /protein_id="EAR00837.1"
FT                   DDKRSEAAMEKRKQQGYF"
FT   gene            complement(234536..235159)
FT                   /locus_tag="FB2170_17176"
FT   CDS_pept        complement(234536..235159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17176"
FT                   /product="possible 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17176"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00838"
FT                   /db_xref="GOA:A4ATR8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR8"
FT                   /protein_id="EAR00838.1"
FT   gene            complement(235194..235454)
FT                   /locus_tag="FB2170_17181"
FT   CDS_pept        complement(235194..235454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17181"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00839"
FT                   /db_xref="GOA:A4ATR9"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR9"
FT                   /protein_id="EAR00839.1"
FT   gene            complement(235677..236087)
FT                   /locus_tag="FB2170_17186"
FT   CDS_pept        complement(235677..236087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17186"
FT                   /product="transcriptional regulator, BadM/Rrf2 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17186"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00840"
FT                   /db_xref="GOA:A4ATS0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS0"
FT                   /protein_id="EAR00840.1"
FT   gene            complement(236146..237315)
FT                   /locus_tag="FB2170_17191"
FT   CDS_pept        complement(236146..237315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17191"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17191"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00841"
FT                   /db_xref="GOA:A4ATS1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS1"
FT                   /protein_id="EAR00841.1"
FT   gene            complement(237318..240704)
FT                   /locus_tag="FB2170_17196"
FT   CDS_pept        complement(237318..240704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17196"
FT                   /product="bifunctional aspartokinase I/homoserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17196"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00842"
FT                   /db_xref="GOA:A4ATS2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS2"
FT                   /protein_id="EAR00842.1"
FT   gene            complement(240769..242061)
FT                   /locus_tag="FB2170_17201"
FT   CDS_pept        complement(240769..242061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17201"
FT                   /product="O-acetyl-L-homoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17201"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00843"
FT                   /db_xref="GOA:A4ATS3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS3"
FT                   /protein_id="EAR00843.1"
FT   gene            complement(242383..243639)
FT                   /locus_tag="FB2170_17206"
FT   CDS_pept        complement(242383..243639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17206"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17206"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00844"
FT                   /db_xref="GOA:A4ATS4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS4"
FT                   /protein_id="EAR00844.1"
FT   gene            complement(243845..246523)
FT                   /locus_tag="FB2170_17211"
FT   CDS_pept        complement(243845..246523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17211"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00845"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS5"
FT                   /protein_id="EAR00845.1"
FT   gene            complement(246575..247531)
FT                   /locus_tag="FB2170_17216"
FT   CDS_pept        complement(246575..247531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17216"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00846"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS6"
FT                   /protein_id="EAR00846.1"
FT   gene            247605..248219
FT                   /locus_tag="FB2170_17221"
FT   CDS_pept        247605..248219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17221"
FT                   /product="Deoxynucleoside kinase subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17221"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00847"
FT                   /db_xref="GOA:A4ATS7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS7"
FT                   /protein_id="EAR00847.1"
FT   gene            248232..248942
FT                   /locus_tag="FB2170_17226"
FT   CDS_pept        248232..248942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17226"
FT                   /product="peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17226"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00848"
FT                   /db_xref="GOA:A4ATS8"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS8"
FT                   /protein_id="EAR00848.1"
FT                   AYELPTESSLGFLR"
FT   gene            249201..249905
FT                   /locus_tag="FB2170_17231"
FT   CDS_pept        249201..249905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17231"
FT                   /product="TonB"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17231"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00849"
FT                   /db_xref="GOA:A4ATS9"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS9"
FT                   /protein_id="EAR00849.1"
FT                   VAFTIPINFRLQ"
FT   gene            complement(249976..252381)
FT                   /locus_tag="FB2170_17236"
FT   CDS_pept        complement(249976..252381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17236"
FT                   /product="Inorganic H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17236"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00850"
FT                   /db_xref="GOA:A4ATT0"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT0"
FT                   /protein_id="EAR00850.1"
FT   gene            complement(252500..253027)
FT                   /locus_tag="FB2170_17241"
FT   CDS_pept        complement(252500..253027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17241"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17241"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00851"
FT                   /db_xref="GOA:A4ATT1"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT1"
FT                   /protein_id="EAR00851.1"
FT                   NSEHKKKRTFTI"
FT   gene            complement(253098..255593)
FT                   /locus_tag="FB2170_17246"
FT   CDS_pept        complement(253098..255593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17246"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00852"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT2"
FT                   /protein_id="EAR00852.1"
FT   gene            complement(255703..256680)
FT                   /locus_tag="FB2170_17251"
FT   CDS_pept        complement(255703..256680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17251"
FT                   /product="pyruvate dehydrogenase E1 component, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17251"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00853"
FT                   /db_xref="GOA:A4ATT3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT3"
FT                   /protein_id="EAR00853.1"
FT   gene            256865..257611
FT                   /locus_tag="FB2170_17256"
FT   CDS_pept        256865..257611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17256"
FT                   /product="electron transfer flavoprotein (beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17256"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00854"
FT                   /db_xref="GOA:A4ATT4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT4"
FT                   /protein_id="EAR00854.1"
FT   gene            257656..258624
FT                   /locus_tag="FB2170_17261"
FT   CDS_pept        257656..258624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17261"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17261"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00855"
FT                   /db_xref="GOA:A4ATT5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT5"
FT                   /protein_id="EAR00855.1"
FT   gene            258714..259343
FT                   /locus_tag="FB2170_17266"
FT   CDS_pept        258714..259343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17266"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00856"
FT                   /db_xref="GOA:A4ATT6"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT6"
FT                   /protein_id="EAR00856.1"
FT   gene            259359..260819
FT                   /locus_tag="FB2170_17271"
FT   CDS_pept        259359..260819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17271"
FT                   /product="nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17271"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00857"
FT                   /db_xref="GOA:A4ATT7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT7"
FT                   /protein_id="EAR00857.1"
FT   gene            260911..261735
FT                   /locus_tag="FB2170_17276"
FT   CDS_pept        260911..261735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17276"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17276"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00858"
FT                   /db_xref="GOA:A4ATT8"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT8"
FT                   /protein_id="EAR00858.1"
FT   gene            complement(261808..262104)
FT                   /locus_tag="FB2170_17281"
FT   CDS_pept        complement(261808..262104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17281"
FT                   /product="putative isoamylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17281"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00859"
FT                   /db_xref="GOA:A4ATT9"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT9"
FT                   /protein_id="EAR00859.1"
FT   gene            262350..262736
FT                   /locus_tag="FB2170_17286"
FT   CDS_pept        262350..262736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17286"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00860"
FT                   /db_xref="GOA:A4ATU0"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU0"
FT                   /protein_id="EAR00860.1"
FT   gene            262751..263230
FT                   /locus_tag="FB2170_17291"
FT   CDS_pept        262751..263230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17291"
FT                   /product="DfrA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17291"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00861"
FT                   /db_xref="GOA:A4ATU1"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU1"
FT                   /protein_id="EAR00861.1"
FT   gene            complement(263241..264029)
FT                   /locus_tag="FB2170_17296"
FT   CDS_pept        complement(263241..264029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17296"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17296"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00862"
FT                   /db_xref="GOA:A4ATU2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU2"
FT                   /protein_id="EAR00862.1"
FT   gene            complement(264040..265722)
FT                   /locus_tag="FB2170_17301"
FT   CDS_pept        complement(264040..265722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17301"
FT                   /product="putative alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17301"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00863"
FT                   /db_xref="GOA:A4ATU3"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR026263"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU3"
FT                   /protein_id="EAR00863.1"
FT   gene            265775..266572
FT                   /locus_tag="FB2170_17306"
FT   CDS_pept        265775..266572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17306"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00864"
FT                   /db_xref="GOA:A4ATU4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU4"
FT                   /protein_id="EAR00864.1"
FT   gene            266572..267339
FT                   /locus_tag="FB2170_17311"
FT   CDS_pept        266572..267339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17311"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17311"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00865"
FT                   /db_xref="GOA:A4ATU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU5"
FT                   /protein_id="EAR00865.1"
FT   gene            complement(267336..268802)
FT                   /locus_tag="FB2170_17316"
FT   CDS_pept        complement(267336..268802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17316"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17316"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00866"
FT                   /db_xref="GOA:A4ATU6"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU6"
FT                   /protein_id="EAR00866.1"
FT   gene            complement(268805..269884)
FT                   /locus_tag="FB2170_17321"
FT   CDS_pept        complement(268805..269884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17321"
FT                   /product="putative mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17321"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00867"
FT                   /db_xref="GOA:A4ATU7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU7"
FT                   /protein_id="EAR00867.1"
FT   gene            complement(269895..270497)
FT                   /locus_tag="FB2170_17326"
FT   CDS_pept        complement(269895..270497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17326"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00868"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU8"
FT                   /protein_id="EAR00868.1"
FT   gene            270620..270970
FT                   /locus_tag="FB2170_17331"
FT   CDS_pept        270620..270970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17331"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00869"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU9"
FT                   /protein_id="EAR00869.1"
FT                   ELRRKGYAVWYN"
FT   gene            271029..271910
FT                   /locus_tag="FB2170_17336"
FT   CDS_pept        271029..271910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17336"
FT                   /product="endo-1,4-beta-xylanase B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17336"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00870"
FT                   /db_xref="GOA:A4ATV0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV0"
FT                   /protein_id="EAR00870.1"
FT                   SLFVNWIKNNQF"
FT   gene            272020..272271
FT                   /locus_tag="FB2170_17341"
FT   CDS_pept        272020..272271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17341"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00871"
FT                   /db_xref="GOA:A4ATV1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV1"
FT                   /protein_id="EAR00871.1"
FT   gene            272380..273006
FT                   /locus_tag="FB2170_17346"
FT   CDS_pept        272380..273006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17346"
FT                   /product="peptidyl-prolyl cis-trans isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17346"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00872"
FT                   /db_xref="GOA:A4ATV2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV2"
FT                   /protein_id="EAR00872.1"
FT   gene            complement(273009..273689)
FT                   /locus_tag="FB2170_17351"
FT   CDS_pept        complement(273009..273689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17351"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17351"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00873"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV3"
FT                   /protein_id="EAR00873.1"
FT                   SSTP"
FT   gene            complement(273689..274753)
FT                   /locus_tag="FB2170_17356"
FT   CDS_pept        complement(273689..274753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17356"
FT                   /product="putative peptidase, M28 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17356"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00874"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV4"
FT                   /protein_id="EAR00874.1"
FT                   ENITNSPVQEIKYN"
FT   gene            complement(274834..276477)
FT                   /locus_tag="FB2170_17361"
FT   CDS_pept        complement(274834..276477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17361"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvatedehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17361"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00875"
FT                   /db_xref="GOA:A4ATV5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV5"
FT                   /protein_id="EAR00875.1"
FT   gene            complement(276485..277480)
FT                   /locus_tag="FB2170_17366"
FT   CDS_pept        complement(276485..277480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17366"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17366"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00876"
FT                   /db_xref="GOA:A4ATV6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV6"
FT                   /protein_id="EAR00876.1"
FT   gene            complement(277678..278160)
FT                   /locus_tag="FB2170_17371"
FT   CDS_pept        complement(277678..278160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17371"
FT                   /product="cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17371"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00877"
FT                   /db_xref="GOA:A4ATV7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV7"
FT                   /protein_id="EAR00877.1"
FT   gene            complement(278181..278249)
FT                   /locus_tag="FB2170_17376"
FT   CDS_pept        complement(278181..278249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17376"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00878"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV8"
FT                   /protein_id="EAR00878.1"
FT                   /translation="MIKTNETFITKPAIEQVLLFLA"
FT   gene            complement(278242..279387)
FT                   /locus_tag="FB2170_17381"
FT   CDS_pept        complement(278242..279387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17381"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00879"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV9"
FT                   /protein_id="EAR00879.1"
FT   gene            279737..279841
FT                   /locus_tag="FB2170_17386"
FT   CDS_pept        279737..279841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17386"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00880"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW0"
FT                   /protein_id="EAR00880.1"
FT   gene            279857..281527
FT                   /locus_tag="FB2170_17391"
FT   CDS_pept        279857..281527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17391"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17391"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00881"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR019865"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW1"
FT                   /protein_id="EAR00881.1"
FT   gene            281591..282868
FT                   /locus_tag="FB2170_17396"
FT   CDS_pept        281591..282868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17396"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17396"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00882"
FT                   /db_xref="GOA:A4ATW2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW2"
FT                   /protein_id="EAR00882.1"
FT   gene            complement(282889..282963)
FT                   /locus_tag="FB2170_t17481"
FT   tRNA            complement(282889..282963)
FT                   /locus_tag="FB2170_t17481"
FT                   /product="tRNA-Val"
FT   gene            283152..284315
FT                   /locus_tag="FB2170_17401"
FT   CDS_pept        283152..284315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17401"
FT                   /product="L-lactate dehydrogenase and related alpha-hydroxy
FT                   acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17401"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00883"
FT                   /db_xref="GOA:A4ATW3"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW3"
FT                   /protein_id="EAR00883.1"
FT   gene            complement(284407..286653)
FT                   /locus_tag="FB2170_17406"
FT   CDS_pept        complement(284407..286653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17406"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00884"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW4"
FT                   /protein_id="EAR00884.1"
FT   gene            complement(287069..287146)
FT                   /locus_tag="FB2170_t17479"
FT   tRNA            complement(287069..287146)
FT                   /locus_tag="FB2170_t17479"
FT                   /product="tRNA-Val"
FT   gene            complement(287205..288416)
FT                   /locus_tag="FB2170_17411"
FT   CDS_pept        complement(287205..288416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17411"
FT                   /product="folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17411"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00885"
FT                   /db_xref="GOA:A4ATW5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW5"
FT                   /protein_id="EAR00885.1"
FT                   AEVL"
FT   gene            complement(288417..289319)
FT                   /locus_tag="FB2170_17416"
FT   CDS_pept        complement(288417..289319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17416"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00886"
FT                   /db_xref="GOA:A4ATW6"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW6"
FT                   /protein_id="EAR00886.1"
FT   gene            complement(289319..289705)
FT                   /locus_tag="FB2170_17421"
FT   CDS_pept        complement(289319..289705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17421"
FT                   /product="putative tansport related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17421"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00887"
FT                   /db_xref="GOA:A4ATW7"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW7"
FT                   /protein_id="EAR00887.1"
FT   gene            complement(289716..290408)
FT                   /locus_tag="FB2170_17426"
FT   CDS_pept        complement(289716..290408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17426"
FT                   /product="putative biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17426"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00888"
FT                   /db_xref="GOA:A4ATW8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW8"
FT                   /protein_id="EAR00888.1"
FT                   LDLLNEPL"
FT   gene            complement(290459..291796)
FT                   /locus_tag="FB2170_17431"
FT   CDS_pept        complement(290459..291796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17431"
FT                   /product="probable Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17431"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00889"
FT                   /db_xref="GOA:A4ATW9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW9"
FT                   /protein_id="EAR00889.1"
FT   gene            complement(291813..293045)
FT                   /locus_tag="FB2170_17436"
FT   CDS_pept        complement(291813..293045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17436"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17436"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00890"
FT                   /db_xref="GOA:A4ATX0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX0"
FT                   /protein_id="EAR00890.1"
FT                   TGFEIALKQLV"
FT   gene            293322..294464
FT                   /locus_tag="FB2170_17441"
FT   CDS_pept        293322..294464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17441"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17441"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00891"
FT                   /db_xref="GOA:A4ATX1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX1"
FT                   /protein_id="EAR00891.1"
FT   gene            294775..299283
FT                   /locus_tag="FB2170_17446"
FT   CDS_pept        294775..299283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17446"
FT                   /product="glutamate synthase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17446"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00892"
FT                   /db_xref="GOA:A4ATX2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX2"
FT                   /protein_id="EAR00892.1"
FT   gene            299292..300758
FT                   /locus_tag="FB2170_17451"
FT   CDS_pept        299292..300758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17451"
FT                   /product="NADPH-dependent glutamate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17451"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00893"
FT                   /db_xref="GOA:A4ATX3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX3"
FT                   /protein_id="EAR00893.1"
FT   gene            complement(300787..301647)
FT                   /locus_tag="FB2170_17456"
FT   CDS_pept        complement(300787..301647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17456"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17456"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00894"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX4"
FT                   /protein_id="EAR00894.1"
FT                   LESKN"
FT   gene            complement(301688..303460)
FT                   /locus_tag="FB2170_17461"
FT   CDS_pept        complement(301688..303460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17461"
FT                   /product="endochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17461"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00895"
FT                   /db_xref="GOA:A4ATX5"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX5"
FT                   /protein_id="EAR00895.1"
FT                   PHGAWLILAVSSAR"
FT   gene            complement(303637..303747)
FT                   /locus_tag="FB2170_r10270"
FT   rRNA            complement(303637..303747)
FT                   /locus_tag="FB2170_r10270"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(303860..306703)
FT                   /locus_tag="FB2170_r09006"
FT   rRNA            complement(303860..306703)
FT                   /locus_tag="FB2170_r09006"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(306835..306908)
FT                   /locus_tag="FB2170_t10250"
FT   tRNA            complement(306835..306908)
FT                   /locus_tag="FB2170_t10250"
FT                   /product="tRNA-Ala"
FT   gene            complement(307030..307103)
FT                   /locus_tag="FB2170_t10248"
FT   tRNA            complement(307030..307103)
FT                   /locus_tag="FB2170_t10248"
FT                   /product="tRNA-Ile"
FT   gene            complement(307217..308770)
FT                   /locus_tag="FB2170_r10252"
FT   rRNA            complement(307217..308770)
FT                   /locus_tag="FB2170_r10252"
FT                   /product="16S ribosomal RNA"
FT   gene            309323..311263
FT                   /locus_tag="FB2170_00005"
FT   CDS_pept        309323..311263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00005"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00005"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99590"
FT                   /db_xref="GOA:A4AWS3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS3"
FT                   /protein_id="EAQ99590.1"
FT                   TKEINSTLKSF"
FT   gene            311390..311848
FT                   /locus_tag="FB2170_00010"
FT   CDS_pept        311390..311848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00010"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00010"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99591"
FT                   /db_xref="GOA:A4AWS4"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS4"
FT                   /protein_id="EAQ99591.1"
FT   gene            311945..312142
FT                   /locus_tag="FB2170_00015"
FT   CDS_pept        311945..312142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00015"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00015"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99592"
FT                   /db_xref="GOA:A4AWS5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS5"
FT                   /protein_id="EAQ99592.1"
FT   gene            312240..312584
FT                   /locus_tag="FB2170_00020"
FT   CDS_pept        312240..312584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00020"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00020"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99593"
FT                   /db_xref="GOA:A4AWS6"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS6"
FT                   /protein_id="EAQ99593.1"
FT                   AFKAIVDKVK"
FT   gene            complement(312653..312925)
FT                   /locus_tag="FB2170_00025"
FT   CDS_pept        complement(312653..312925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00025"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99594"
FT                   /db_xref="GOA:A4AWS7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS7"
FT                   /protein_id="EAQ99594.1"
FT   gene            complement(312976..313398)
FT                   /locus_tag="FB2170_00030"
FT   CDS_pept        complement(312976..313398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00030"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99595"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS8"
FT                   /protein_id="EAQ99595.1"
FT   gene            313501..314298
FT                   /locus_tag="FB2170_00035"
FT   CDS_pept        313501..314298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00035"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99596"
FT                   /db_xref="GOA:A4AWS9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS9"
FT                   /protein_id="EAQ99596.1"
FT   gene            complement(314303..315622)
FT                   /locus_tag="FB2170_00040"
FT   CDS_pept        complement(314303..315622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00040"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99597"
FT                   /db_xref="GOA:A4AWT0"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT0"
FT                   /protein_id="EAQ99597.1"
FT   gene            complement(315600..317147)
FT                   /locus_tag="FB2170_00045"
FT   CDS_pept        complement(315600..317147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00045"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00045"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99598"
FT                   /db_xref="GOA:A4AWT1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT1"
FT                   /protein_id="EAQ99598.1"
FT   gene            complement(317315..318268)
FT                   /locus_tag="FB2170_00050"
FT   CDS_pept        complement(317315..318268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00050"
FT                   /product="Acetyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00050"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99599"
FT                   /db_xref="GOA:A4AWT2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT2"
FT                   /protein_id="EAQ99599.1"
FT   gene            complement(318332..319219)
FT                   /locus_tag="FB2170_00055"
FT   CDS_pept        complement(318332..319219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00055"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99600"
FT                   /db_xref="GOA:A4AWT3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT3"
FT                   /protein_id="EAQ99600.1"
FT                   ANGVLKQLNAKKNA"
FT   gene            complement(319206..320231)
FT                   /locus_tag="FB2170_00060"
FT   CDS_pept        complement(319206..320231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00060"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99601"
FT                   /db_xref="GOA:A4AWT4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT4"
FT                   /protein_id="EAQ99601.1"
FT                   R"
FT   gene            complement(320288..321364)
FT                   /locus_tag="FB2170_00065"
FT   CDS_pept        complement(320288..321364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00065"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00065"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99602"
FT                   /db_xref="GOA:A4AWT5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT5"
FT                   /protein_id="EAQ99602.1"
FT                   GDFTQWKNVMVKQMDKRL"
FT   gene            321685..322272
FT                   /locus_tag="FB2170_00070"
FT   CDS_pept        321685..322272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00070"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99603"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT6"
FT                   /protein_id="EAQ99603.1"
FT   gene            complement(322345..323301)
FT                   /locus_tag="FB2170_00075"
FT   CDS_pept        complement(322345..323301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00075"
FT                   /product="Peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00075"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99604"
FT                   /db_xref="GOA:A4AWT7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT7"
FT                   /protein_id="EAQ99604.1"
FT   gene            323379..323753
FT                   /locus_tag="FB2170_00080"
FT   CDS_pept        323379..323753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00080"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00080"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99605"
FT                   /db_xref="GOA:A4AWT8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT8"
FT                   /protein_id="EAQ99605.1"
FT   gene            323925..326366
FT                   /locus_tag="FB2170_00085"
FT   CDS_pept        323925..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00085"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99606"
FT                   /db_xref="GOA:A4AWT9"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT9"
FT                   /protein_id="EAQ99606.1"
FT                   P"
FT   gene            326413..326955
FT                   /locus_tag="FB2170_00090"
FT   CDS_pept        326413..326955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00090"
FT                   /product="pyrimidine regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00090"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99607"
FT                   /db_xref="GOA:A4AWU0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU0"
FT                   /protein_id="EAQ99607.1"
FT                   EHVHVKFQAKNDLVYLD"
FT   gene            complement(326947..327438)
FT                   /locus_tag="FB2170_00095"
FT   CDS_pept        complement(326947..327438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00095"
FT                   /product="putative shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00095"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99608"
FT                   /db_xref="GOA:A4AWU1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU1"
FT                   /protein_id="EAQ99608.1"
FT                   "
FT   gene            327603..327678
FT                   /locus_tag="FB2170_t00227"
FT   tRNA            327603..327678
FT                   /locus_tag="FB2170_t00227"
FT                   /product="tRNA-Lys"
FT   gene            328288..330120
FT                   /locus_tag="FB2170_00100"
FT   CDS_pept        328288..330120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00100"
FT                   /product="Na+/glucose symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00100"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99609"
FT                   /db_xref="GOA:A4AWU2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU2"
FT                   /protein_id="EAQ99609.1"
FT   gene            330121..331050
FT                   /locus_tag="FB2170_00105"
FT   CDS_pept        330121..331050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00105"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99610"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="InterPro:IPR033402"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU3"
FT                   /protein_id="EAQ99610.1"
FT   gene            331052..332923
FT                   /locus_tag="FB2170_00110"
FT   CDS_pept        331052..332923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00110"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99611"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU4"
FT                   /protein_id="EAQ99611.1"
FT   gene            333586..334710
FT                   /locus_tag="FB2170_00115"
FT   CDS_pept        333586..334710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00115"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00115"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99612"
FT                   /db_xref="GOA:A4AWU5"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU5"
FT                   /protein_id="EAQ99612.1"
FT   gene            334854..335414
FT                   /locus_tag="FB2170_00120"
FT   CDS_pept        334854..335414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00120"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00120"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99613"
FT                   /db_xref="GOA:A4AWU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU6"
FT                   /protein_id="EAQ99613.1"
FT   gene            335484..335900
FT                   /locus_tag="FB2170_00125"
FT   CDS_pept        335484..335900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00125"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99614"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU7"
FT                   /protein_id="EAQ99614.1"
FT   gene            336016..336570
FT                   /locus_tag="FB2170_00130"
FT   CDS_pept        336016..336570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00130"
FT                   /product="probable Mip protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00130"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99615"
FT                   /db_xref="GOA:A4AWU8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU8"
FT                   /protein_id="EAQ99615.1"
FT   gene            336509..337588
FT                   /locus_tag="FB2170_00135"
FT   CDS_pept        336509..337588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00135"
FT                   /product="hydrolase, alpha/beta hydrolase fold family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00135"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99616"
FT                   /db_xref="GOA:A4AWU9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU9"
FT                   /protein_id="EAQ99616.1"
FT   gene            337590..337763
FT                   /locus_tag="FB2170_00140"
FT   CDS_pept        337590..337763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00140"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99617"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV0"
FT                   /protein_id="EAQ99617.1"
FT                   LPYSLEIVLHMI"
FT   gene            337848..337985
FT                   /locus_tag="FB2170_00145"
FT   CDS_pept        337848..337985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00145"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99618"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV1"
FT                   /protein_id="EAQ99618.1"
FT                   "
FT   gene            338055..338549
FT                   /locus_tag="FB2170_00150"
FT   CDS_pept        338055..338549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00150"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99619"
FT                   /db_xref="GOA:A4AWV2"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV2"
FT                   /protein_id="EAQ99619.1"
FT                   S"
FT   gene            338625..339920
FT                   /locus_tag="FB2170_00155"
FT   CDS_pept        338625..339920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00155"
FT                   /product="penicillin-binding protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00155"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99620"
FT                   /db_xref="GOA:A4AWV3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV3"
FT                   /protein_id="EAQ99620.1"
FT   gene            339901..340365
FT                   /locus_tag="FB2170_00160"
FT   CDS_pept        339901..340365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00160"
FT                   /product="putative cytosine/adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00160"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99621"
FT                   /db_xref="GOA:A4AWV4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV4"
FT                   /protein_id="EAQ99621.1"
FT   gene            340369..340971
FT                   /locus_tag="FB2170_00165"
FT   CDS_pept        340369..340971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00165"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99622"
FT                   /db_xref="GOA:A4AWV5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV5"
FT                   /protein_id="EAQ99622.1"
FT   gene            340979..342082
FT                   /locus_tag="FB2170_00170"
FT   CDS_pept        340979..342082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00170"
FT                   /product="penicillin-binding protein 4*"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00170"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99623"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV6"
FT                   /protein_id="EAQ99623.1"
FT   gene            342086..342832
FT                   /locus_tag="FB2170_00175"
FT   CDS_pept        342086..342832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00175"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00175"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99624"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV7"
FT                   /protein_id="EAQ99624.1"
FT   gene            342858..343853
FT                   /locus_tag="FB2170_00180"
FT   CDS_pept        342858..343853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00180"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00180"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99625"
FT                   /db_xref="GOA:A4AWV8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV8"
FT                   /protein_id="EAQ99625.1"
FT   gene            343875..344591
FT                   /locus_tag="FB2170_00185"
FT   CDS_pept        343875..344591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00185"
FT                   /product="possible pirin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00185"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99626"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV9"
FT                   /protein_id="EAQ99626.1"
FT                   DSNSKLLLMEIPMTNK"
FT   gene            344599..345369
FT                   /locus_tag="FB2170_00190"
FT   CDS_pept        344599..345369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00190"
FT                   /product="predicted Zn-dependent hydrolase of the
FT                   beta-lactamase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00190"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99627"
FT                   /db_xref="GOA:A4AWW0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW0"
FT                   /protein_id="EAQ99627.1"
FT   gene            345442..346512
FT                   /locus_tag="FB2170_00195"
FT   CDS_pept        345442..346512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00195"
FT                   /product="NADH-dependent flavin oxidoreductase, Oye family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00195"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99628"
FT                   /db_xref="GOA:A4AWW1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW1"
FT                   /protein_id="EAQ99628.1"
FT                   DMNTFYSPGENGYTDY"
FT   gene            346659..348410
FT                   /locus_tag="FB2170_00200"
FT   CDS_pept        346659..348410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00200"
FT                   /product="FmtA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00200"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99629"
FT                   /db_xref="GOA:A4AWW2"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW2"
FT                   /protein_id="EAQ99629.1"
FT                   VPLRLWI"
FT   gene            348433..348975
FT                   /locus_tag="FB2170_00205"
FT   CDS_pept        348433..348975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00205"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99630"
FT                   /db_xref="GOA:A4AWW3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW3"
FT                   /protein_id="EAQ99630.1"
FT                   GIYIITIFILRKRKVMQ"
FT   gene            349258..349512
FT                   /locus_tag="FB2170_00210"
FT   CDS_pept        349258..349512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00210"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99631"
FT                   /db_xref="GOA:A4AWW4"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW4"
FT                   /protein_id="EAQ99631.1"
FT   gene            349533..350009
FT                   /locus_tag="FB2170_00215"
FT   CDS_pept        349533..350009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00215"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00215"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99632"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW5"
FT                   /protein_id="EAQ99632.1"
FT   gene            complement(350051..350935)
FT                   /locus_tag="FB2170_00235"
FT   CDS_pept        complement(350051..350935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00235"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99633"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW6"
FT                   /protein_id="EAQ99633.2"
FT                   EQYVAEHQAMFMS"
FT   gene            complement(350988..351848)
FT                   /locus_tag="FB2170_00240"
FT   CDS_pept        complement(350988..351848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00240"
FT                   /product="predicted hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily) protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00240"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00048"
FT                   /db_xref="GOA:A4AV26"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV26"
FT                   /protein_id="EAR00048.1"
FT                   ASKTN"
FT   gene            complement(351894..352295)
FT                   /locus_tag="FB2170_00245"
FT   CDS_pept        complement(351894..352295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00245"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00245"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00049"
FT                   /db_xref="GOA:A4AV27"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV27"
FT                   /protein_id="EAR00049.1"
FT   gene            352506..353102
FT                   /locus_tag="FB2170_00250"
FT   CDS_pept        352506..353102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00250"
FT                   /product="Catabolite gene activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00250"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00050"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV28"
FT                   /protein_id="EAR00050.1"
FT   gene            353445..354695
FT                   /locus_tag="FB2170_00255"
FT   CDS_pept        353445..354695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00255"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00051"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV29"
FT                   /protein_id="EAR00051.1"
FT                   QEVGYQKEIDRMKNSQE"
FT   gene            354849..355271
FT                   /locus_tag="FB2170_00260"
FT   CDS_pept        354849..355271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00260"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00052"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV30"
FT                   /protein_id="EAR00052.1"
FT   gene            355290..355919
FT                   /locus_tag="FB2170_00265"
FT   CDS_pept        355290..355919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00265"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00265"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00053"
FT                   /db_xref="GOA:A4AV31"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV31"
FT                   /protein_id="EAR00053.1"
FT   gene            355916..356365
FT                   /locus_tag="FB2170_00270"
FT   CDS_pept        355916..356365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00270"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00054"
FT                   /db_xref="GOA:A4AV32"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV32"
FT                   /protein_id="EAR00054.1"
FT   gene            356362..357099
FT                   /locus_tag="FB2170_00275"
FT   CDS_pept        356362..357099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00275"
FT                   /product="Protein containing acetyltransferase (GNAT
FT                   family) domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00275"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00055"
FT                   /db_xref="GOA:A4AV33"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV33"
FT                   /protein_id="EAR00055.1"
FT   gene            357143..357676
FT                   /locus_tag="FB2170_00280"
FT   CDS_pept        357143..357676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00280"
FT                   /product="ribosomal-protein-serine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00280"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00056"
FT                   /db_xref="GOA:A4AV34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV34"
FT                   /protein_id="EAR00056.1"
FT                   SNEIVDLNYYGRIF"
FT   gene            357745..357828
FT                   /locus_tag="FB2170_00285"
FT   CDS_pept        357745..357828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00285"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00057"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV35"
FT                   /protein_id="EAR00057.1"
FT                   /translation="MTVELMSDQKINIQSTARIVFEGKLRV"
FT   gene            358038..358892
FT                   /locus_tag="FB2170_00290"
FT   CDS_pept        358038..358892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00290"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00290"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00058"
FT                   /db_xref="GOA:A4AV36"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV36"
FT                   /protein_id="EAR00058.1"
FT                   QIK"
FT   gene            358983..359384
FT                   /locus_tag="FB2170_00295"
FT   CDS_pept        358983..359384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00295"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00059"
FT                   /db_xref="GOA:A4AV37"
FT                   /db_xref="InterPro:IPR020509"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV37"
FT                   /protein_id="EAR00059.1"
FT   gene            359389..359889
FT                   /locus_tag="FB2170_00300"
FT   CDS_pept        359389..359889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00300"
FT                   /product="probable integral-membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00300"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00060"
FT                   /db_xref="GOA:A4AV38"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV38"
FT                   /protein_id="EAR00060.1"
FT                   IKQ"
FT   gene            359909..360736
FT                   /locus_tag="FB2170_00305"
FT   CDS_pept        359909..360736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00305"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00061"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV39"
FT                   /protein_id="EAR00061.1"
FT   gene            360761..361330
FT                   /locus_tag="FB2170_00310"
FT   CDS_pept        360761..361330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00310"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00062"
FT                   /db_xref="GOA:A4AV40"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV40"
FT                   /protein_id="EAR00062.1"
FT   gene            361518..362627
FT                   /locus_tag="FB2170_00315"
FT   CDS_pept        361518..362627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00315"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00063"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV41"
FT                   /protein_id="EAR00063.1"
FT   gene            362652..362996
FT                   /locus_tag="FB2170_00320"
FT   CDS_pept        362652..362996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00320"
FT                   /product="putative 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00320"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00064"
FT                   /db_xref="GOA:A4AV42"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV42"
FT                   /protein_id="EAR00064.1"
FT                   RATYCNKSMF"
FT   gene            363138..364967
FT                   /locus_tag="FB2170_00325"
FT   CDS_pept        363138..364967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00325"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00065"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV43"
FT                   /protein_id="EAR00065.1"
FT   gene            365049..365246
FT                   /locus_tag="FB2170_00330"
FT   CDS_pept        365049..365246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00330"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV44"
FT                   /protein_id="EAR00066.1"
FT   gene            365266..366768
FT                   /locus_tag="FB2170_00335"
FT   CDS_pept        365266..366768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00335"
FT                   /product="penicillin-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00335"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00067"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV45"
FT                   /protein_id="EAR00067.1"
FT   gene            366786..368420
FT                   /locus_tag="FB2170_00340"
FT   CDS_pept        366786..368420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00340"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00068"
FT                   /db_xref="GOA:A4AV46"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV46"
FT                   /protein_id="EAR00068.1"
FT   gene            368520..368933
FT                   /locus_tag="FB2170_00345"
FT   CDS_pept        368520..368933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00345"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00345"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00069"
FT                   /db_xref="GOA:A4AV47"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV47"
FT                   /protein_id="EAR00069.1"
FT   gene            complement(368920..369618)
FT                   /locus_tag="FB2170_00350"
FT   CDS_pept        complement(368920..369618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00350"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00070"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV48"
FT                   /protein_id="EAR00070.1"
FT                   DKLKERFRLL"
FT   gene            369823..370290
FT                   /locus_tag="FB2170_00355"
FT   CDS_pept        369823..370290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00355"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00355"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00071"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV49"
FT                   /protein_id="EAR00071.1"
FT   gene            complement(370398..371174)
FT                   /locus_tag="FB2170_00360"
FT   CDS_pept        complement(370398..371174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00360"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00072"
FT                   /db_xref="GOA:A4AV50"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV50"
FT                   /protein_id="EAR00072.1"
FT   gene            complement(371278..371505)
FT                   /locus_tag="FB2170_00365"
FT   CDS_pept        complement(371278..371505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00365"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00073"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV51"
FT                   /protein_id="EAR00073.1"
FT   gene            complement(371508..371852)
FT                   /locus_tag="FB2170_00370"
FT   CDS_pept        complement(371508..371852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00370"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00074"
FT                   /db_xref="GOA:A4AV52"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV52"
FT                   /protein_id="EAR00074.1"
FT                   LKKFSKYYFD"
FT   gene            complement(371859..372188)
FT                   /locus_tag="FB2170_00375"
FT   CDS_pept        complement(371859..372188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00375"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00075"
FT                   /db_xref="GOA:A4AV53"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV53"
FT                   /protein_id="EAR00075.1"
FT                   TQLQK"
FT   gene            complement(372326..373513)
FT                   /locus_tag="FB2170_00380"
FT   CDS_pept        complement(372326..373513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00380"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00380"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00076"
FT                   /db_xref="GOA:A4AV54"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV54"
FT                   /protein_id="EAR00076.1"
FT   gene            complement(373519..375615)
FT                   /locus_tag="FB2170_00385"
FT   CDS_pept        complement(373519..375615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00385"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00385"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00077"
FT                   /db_xref="GOA:A4AV55"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV55"
FT                   /protein_id="EAR00077.1"
FT                   QDLE"
FT   gene            complement(375766..376629)
FT                   /locus_tag="FB2170_00390"
FT   CDS_pept        complement(375766..376629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00390"
FT                   /product="putative universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00390"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00078"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV56"
FT                   /protein_id="EAR00078.1"
FT                   QSLISN"
FT   gene            complement(376638..377492)
FT                   /locus_tag="FB2170_00395"
FT   CDS_pept        complement(376638..377492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00395"
FT                   /product="putative universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00395"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00079"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV57"
FT                   /protein_id="EAR00079.1"
FT                   SSK"
FT   gene            377670..378314
FT                   /locus_tag="FB2170_00400"
FT   CDS_pept        377670..378314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00400"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00400"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00080"
FT                   /db_xref="GOA:A4AV58"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV58"
FT                   /protein_id="EAR00080.1"
FT   gene            378326..379024
FT                   /locus_tag="FB2170_00405"
FT   CDS_pept        378326..379024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00405"
FT                   /product="Purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00405"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00081"
FT                   /db_xref="GOA:A4AV59"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV59"
FT                   /protein_id="EAR00081.1"
FT                   EMVEIALNIT"
FT   gene            379138..379590
FT                   /locus_tag="FB2170_00410"
FT   CDS_pept        379138..379590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00410"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00082"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV60"
FT                   /protein_id="EAR00082.1"
FT   gene            379623..380264
FT                   /locus_tag="FB2170_00415"
FT   CDS_pept        379623..380264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00415"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00083"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV61"
FT                   /protein_id="EAR00083.1"
FT   gene            380275..381036
FT                   /locus_tag="FB2170_00420"
FT   CDS_pept        380275..381036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00420"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00084"
FT                   /db_xref="GOA:A4AV62"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV62"
FT                   /protein_id="EAR00084.1"
FT   gene            381146..381913
FT                   /locus_tag="FB2170_00425"
FT   CDS_pept        381146..381913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00425"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00085"
FT                   /db_xref="GOA:A4AV63"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV63"
FT                   /protein_id="EAR00085.1"
FT   gene            complement(381945..382688)
FT                   /locus_tag="FB2170_00430"
FT   CDS_pept        complement(381945..382688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00430"
FT                   /product="SPFH domain / Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00430"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00086"
FT                   /db_xref="GOA:A4AV64"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV64"
FT                   /protein_id="EAR00086.1"
FT   gene            complement(382902..383549)
FT                   /locus_tag="FB2170_00435"
FT   CDS_pept        complement(382902..383549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00435"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00087"
FT                   /db_xref="GOA:A4AV65"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV65"
FT                   /protein_id="EAR00087.1"
FT   gene            complement(383576..384595)
FT                   /locus_tag="FB2170_00440"
FT   CDS_pept        complement(383576..384595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00088"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV66"
FT                   /protein_id="EAR00088.1"
FT   gene            complement(384608..385780)
FT                   /locus_tag="FB2170_00445"
FT   CDS_pept        complement(384608..385780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00445"
FT                   /product="carboxypeptidase G2"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00445"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00089"
FT                   /db_xref="GOA:A4AV67"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV67"
FT                   /protein_id="EAR00089.1"
FT   gene            complement(385777..386388)
FT                   /locus_tag="FB2170_00450"
FT   CDS_pept        complement(385777..386388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00450"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00090"
FT                   /db_xref="GOA:A4AV68"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV68"
FT                   /protein_id="EAR00090.1"
FT   gene            complement(386515..386904)
FT                   /locus_tag="FB2170_00455"
FT   CDS_pept        complement(386515..386904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00455"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00091"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV69"
FT                   /protein_id="EAR00091.1"
FT   gene            complement(387507..388487)
FT                   /locus_tag="FB2170_00460"
FT   CDS_pept        complement(387507..388487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00460"
FT                   /product="virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00460"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00092"
FT                   /db_xref="GOA:A4AV70"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV70"
FT                   /protein_id="EAR00092.1"
FT   gene            complement(388492..389286)
FT                   /locus_tag="FB2170_00465"
FT   CDS_pept        complement(388492..389286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00465"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00465"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00093"
FT                   /db_xref="GOA:A4AV71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV71"
FT                   /protein_id="EAR00093.1"
FT   gene            complement(389276..390070)
FT                   /locus_tag="FB2170_00470"
FT   CDS_pept        complement(389276..390070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00470"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00470"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00094"
FT                   /db_xref="GOA:A4AV72"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV72"
FT                   /protein_id="EAR00094.1"
FT   gene            complement(390009..390170)
FT                   /locus_tag="FB2170_00475"
FT   CDS_pept        complement(390009..390170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00475"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00095"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV73"
FT                   /protein_id="EAR00095.1"
FT                   PKVKAVLC"
FT   gene            390219..390455
FT                   /locus_tag="FB2170_00480"
FT   CDS_pept        390219..390455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00480"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00096"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV74"
FT                   /protein_id="EAR00096.1"
FT   gene            390477..391418
FT                   /locus_tag="FB2170_00485"
FT   CDS_pept        390477..391418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00485"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00097"
FT                   /db_xref="GOA:A4AV75"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV75"
FT                   /protein_id="EAR00097.1"
FT   gene            391501..391587
FT                   /locus_tag="FB2170_t07275"
FT   tRNA            391501..391587
FT                   /locus_tag="FB2170_t07275"
FT                   /product="tRNA-Leu"
FT   gene            complement(392061..392621)
FT                   /locus_tag="FB2170_00490"
FT   CDS_pept        complement(392061..392621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00490"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00490"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00098"
FT                   /db_xref="GOA:A4AV76"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV76"
FT                   /protein_id="EAR00098.1"
FT   gene            complement(392629..393189)
FT                   /locus_tag="FB2170_00495"
FT   CDS_pept        complement(392629..393189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00495"
FT                   /product="thiol:disulfide interchange protein tlpA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00495"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00099"
FT                   /db_xref="GOA:A4AV77"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV77"
FT                   /protein_id="EAR00099.1"
FT   gene            complement(393289..395556)
FT                   /locus_tag="FB2170_00500"
FT   CDS_pept        complement(393289..395556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00500"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00500"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00100"
FT                   /db_xref="GOA:A4AV78"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV78"
FT                   /protein_id="EAR00100.1"
FT                   AA"
FT   gene            complement(395729..396682)
FT                   /locus_tag="FB2170_00505"
FT   CDS_pept        complement(395729..396682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00505"
FT                   /product="methanol dehydrogenase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00505"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00101"
FT                   /db_xref="GOA:A4AV79"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV79"
FT                   /protein_id="EAR00101.1"
FT   gene            complement(396685..398136)
FT                   /locus_tag="FB2170_00510"
FT   CDS_pept        complement(396685..398136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00510"
FT                   /product="putative exported peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00510"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00102"
FT                   /db_xref="GOA:A4AV80"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV80"
FT                   /protein_id="EAR00102.1"
FT   gene            complement(398114..399007)
FT                   /locus_tag="FB2170_00515"
FT   CDS_pept        complement(398114..399007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00515"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00103"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV81"
FT                   /protein_id="EAR00103.1"
FT                   AIKEKEFEVYVQDKKD"
FT   gene            399069..399575
FT                   /locus_tag="FB2170_00520"
FT   CDS_pept        399069..399575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00520"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00104"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV82"
FT                   /protein_id="EAR00104.1"
FT                   SVANS"
FT   gene            399594..399836
FT                   /locus_tag="FB2170_00525"
FT   CDS_pept        399594..399836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00525"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00105"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV83"
FT                   /protein_id="EAR00105.1"
FT   gene            399854..400996
FT                   /locus_tag="FB2170_00530"
FT   CDS_pept        399854..400996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00530"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00106"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV84"
FT                   /protein_id="EAR00106.1"
FT   gene            401006..401743
FT                   /locus_tag="FB2170_00535"
FT   CDS_pept        401006..401743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00535"
FT                   /product="pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00535"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00107"
FT                   /db_xref="GOA:A4AV85"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV85"
FT                   /protein_id="EAR00107.1"
FT   gene            401928..403325
FT                   /locus_tag="FB2170_00540"
FT   CDS_pept        401928..403325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00108"
FT                   /db_xref="GOA:A4AV86"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV86"
FT                   /protein_id="EAR00108.1"
FT                   RGGTSAP"
FT   gene            complement(403401..405611)
FT                   /locus_tag="FB2170_00545"
FT   CDS_pept        complement(403401..405611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00545"
FT                   /product="ATP-dependent DNA helicase recQ"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00545"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00109"
FT                   /db_xref="GOA:A4AV87"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV87"
FT                   /protein_id="EAR00109.1"
FT   gene            405808..406773
FT                   /locus_tag="FB2170_00550"
FT   CDS_pept        405808..406773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00550"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00110"
FT                   /db_xref="GOA:A4AV88"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV88"
FT                   /protein_id="EAR00110.1"
FT   gene            406773..407615
FT                   /locus_tag="FB2170_00555"
FT   CDS_pept        406773..407615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00555"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00555"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00111"
FT                   /db_xref="GOA:A4AV89"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV89"
FT                   /protein_id="EAR00111.1"
FT   gene            407698..408438
FT                   /locus_tag="FB2170_00560"
FT   CDS_pept        407698..408438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00560"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00560"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00112"
FT                   /db_xref="GOA:A4AV90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV90"
FT                   /protein_id="EAR00112.1"
FT   gene            complement(408443..409285)
FT                   /locus_tag="FB2170_00565"
FT   CDS_pept        complement(408443..409285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00565"
FT                   /product="putative phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00565"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00113"
FT                   /db_xref="GOA:A4AV91"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV91"
FT                   /protein_id="EAR00113.1"
FT   gene            409301..410491
FT                   /locus_tag="FB2170_00570"
FT   CDS_pept        409301..410491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00114"
FT                   /db_xref="GOA:A4AV92"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV92"
FT                   /protein_id="EAR00114.1"
FT   gene            410488..412368
FT                   /locus_tag="FB2170_00575"
FT   CDS_pept        410488..412368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00575"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00575"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00115"
FT                   /db_xref="GOA:A4AV93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV93"
FT                   /protein_id="EAR00115.1"
FT   gene            412382..412885
FT                   /locus_tag="FB2170_00580"
FT   CDS_pept        412382..412885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00116"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV94"
FT                   /protein_id="EAR00116.1"
FT                   KIRI"
FT   gene            412940..413089
FT                   /locus_tag="FB2170_00585"
FT   CDS_pept        412940..413089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00585"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00117"
FT                   /db_xref="GOA:A4AV95"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV95"
FT                   /protein_id="EAR00117.1"
FT                   SNNE"
FT   gene            413108..413683
FT                   /locus_tag="FB2170_00590"
FT   CDS_pept        413108..413683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00590"
FT                   /product="putative vitamin B12 related Cobalamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00590"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00118"
FT                   /db_xref="GOA:A4AV96"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV96"
FT                   /protein_id="EAR00118.1"
FT   gene            413798..414022
FT                   /locus_tag="FB2170_00595"
FT   CDS_pept        413798..414022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00595"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00119"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV97"
FT                   /protein_id="EAR00119.1"
FT   gene            414317..417679
FT                   /locus_tag="FB2170_00600"
FT   CDS_pept        414317..417679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00600"
FT                   /product="translocase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00600"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00120"
FT                   /db_xref="GOA:A4AV98"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV98"
FT                   /protein_id="EAR00120.1"
FT                   PLIDKGEWVLTED"
FT   gene            417812..419167
FT                   /locus_tag="FB2170_00605"
FT   CDS_pept        417812..419167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00605"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00121"
FT                   /db_xref="GOA:A4AV99"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV99"
FT                   /protein_id="EAR00121.1"
FT   gene            419365..420579
FT                   /locus_tag="FB2170_00610"
FT   CDS_pept        419365..420579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00610"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00122"
FT                   /db_xref="GOA:A4AVA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA0"
FT                   /protein_id="EAR00122.1"
FT                   FRSIV"
FT   gene            420682..423201
FT                   /locus_tag="FB2170_00615"
FT   CDS_pept        420682..423201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00615"
FT                   /product="Secreted protein containing N-terminal
FT                   zinc-dependent carboxypeptidase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00615"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00123"
FT                   /db_xref="GOA:A4AVA1"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA1"
FT                   /protein_id="EAR00123.1"
FT   gene            423283..424803
FT                   /locus_tag="FB2170_00620"
FT   CDS_pept        423283..424803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00620"
FT                   /product="Amidohydrolase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00124"
FT                   /db_xref="GOA:A4AVA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA2"
FT                   /protein_id="EAR00124.1"
FT   gene            complement(424879..424989)
FT                   /locus_tag="FB2170_00625"
FT   CDS_pept        complement(424879..424989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00625"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00125"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA3"
FT                   /protein_id="EAR00125.1"
FT   gene            complement(425039..425296)
FT                   /locus_tag="FB2170_00630"
FT   CDS_pept        complement(425039..425296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00630"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00126"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA4"
FT                   /protein_id="EAR00126.1"
FT   gene            complement(425677..425904)
FT                   /locus_tag="FB2170_00635"
FT   CDS_pept        complement(425677..425904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00635"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00127"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA5"
FT                   /protein_id="EAR00127.1"
FT   gene            426283..426864
FT                   /locus_tag="FB2170_00640"
FT   CDS_pept        426283..426864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00640"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00128"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA6"
FT                   /protein_id="EAR00128.1"
FT   gene            426843..428306
FT                   /locus_tag="FB2170_00645"
FT   CDS_pept        426843..428306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00645"
FT                   /product="aryl-sulphate sulphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00645"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00129"
FT                   /db_xref="GOA:A4AVA7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA7"
FT                   /protein_id="EAR00129.1"
FT   gene            complement(428331..428708)
FT                   /locus_tag="FB2170_00650"
FT   CDS_pept        complement(428331..428708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00650"
FT                   /product="Glyoxalase/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00650"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00130"
FT                   /db_xref="GOA:A4AVA8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA8"
FT                   /protein_id="EAR00130.1"
FT   gene            complement(428705..428911)
FT                   /locus_tag="FB2170_00655"
FT   CDS_pept        complement(428705..428911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00655"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00131"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA9"
FT                   /protein_id="EAR00131.1"
FT   gene            429202..429924
FT                   /locus_tag="FB2170_00660"
FT   CDS_pept        429202..429924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00660"
FT                   /product="dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00660"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00132"
FT                   /db_xref="GOA:A4AVB0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB0"
FT                   /protein_id="EAR00132.1"
FT                   NKRSWNAMKYFFNEIFKN"
FT   gene            429956..430687
FT                   /locus_tag="FB2170_00665"
FT   CDS_pept        429956..430687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00665"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00665"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00133"
FT                   /db_xref="GOA:A4AVB1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB1"
FT                   /protein_id="EAR00133.1"
FT   gene            430796..432181
FT                   /locus_tag="FB2170_00670"
FT   CDS_pept        430796..432181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00134"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB2"
FT                   /protein_id="EAR00134.1"
FT                   IKK"
FT   gene            432185..433513
FT                   /locus_tag="FB2170_00675"
FT   CDS_pept        432185..433513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00675"
FT                   /product="putative dehydrogenase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00675"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00135"
FT                   /db_xref="GOA:A4AVB3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB3"
FT                   /protein_id="EAR00135.1"
FT   gene            433517..434707
FT                   /locus_tag="FB2170_00680"
FT   CDS_pept        433517..434707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00680"
FT                   /product="putative hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00680"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00136"
FT                   /db_xref="GOA:A4AVB4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB4"
FT                   /protein_id="EAR00136.1"
FT   gene            complement(434806..436278)
FT                   /locus_tag="FB2170_00685"
FT   CDS_pept        complement(434806..436278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00685"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00137"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB5"
FT                   /protein_id="EAR00137.1"
FT   gene            complement(436259..436843)
FT                   /locus_tag="FB2170_00690"
FT   CDS_pept        complement(436259..436843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00690"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00138"
FT                   /db_xref="GOA:A4AVB6"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB6"
FT                   /protein_id="EAR00138.1"
FT   gene            complement(436827..437369)
FT                   /locus_tag="FB2170_00695"
FT   CDS_pept        complement(436827..437369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00695"
FT                   /product="RNA polymerase sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00695"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00139"
FT                   /db_xref="GOA:A4AVB7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB7"
FT                   /protein_id="EAR00139.1"
FT                   KSYLKELLKEKAYGTGS"
FT   gene            437477..438385
FT                   /locus_tag="FB2170_00700"
FT   CDS_pept        437477..438385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00700"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00700"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00140"
FT                   /db_xref="GOA:A4AVB8"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB8"
FT                   /protein_id="EAR00140.1"
FT   gene            438412..438972
FT                   /locus_tag="FB2170_00705"
FT   CDS_pept        438412..438972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00705"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00141"
FT                   /db_xref="GOA:A4AVB9"
FT                   /db_xref="InterPro:IPR021314"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB9"
FT                   /protein_id="EAR00141.1"
FT   gene            439067..440026
FT                   /locus_tag="FB2170_00710"
FT   CDS_pept        439067..440026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00710"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00710"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00142"
FT                   /db_xref="GOA:A4AVC0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC0"
FT                   /protein_id="EAR00142.1"
FT   gene            440268..440879
FT                   /locus_tag="FB2170_00715"
FT   CDS_pept        440268..440879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00715"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00143"
FT                   /db_xref="GOA:A4AVC1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC1"
FT                   /protein_id="EAR00143.1"
FT   gene            complement(440876..442534)
FT                   /locus_tag="FB2170_00720"
FT   CDS_pept        complement(440876..442534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00720"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00144"
FT                   /db_xref="GOA:A4AVC2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC2"
FT                   /protein_id="EAR00144.1"
FT   gene            complement(442531..443100)
FT                   /locus_tag="FB2170_00725"
FT   CDS_pept        complement(442531..443100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00725"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00145"
FT                   /db_xref="GOA:A4AVC3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC3"
FT                   /protein_id="EAR00145.1"
FT   gene            complement(443106..443333)
FT                   /locus_tag="FB2170_00730"
FT   CDS_pept        complement(443106..443333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00730"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00146"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC4"
FT                   /protein_id="EAR00146.1"
FT   gene            complement(443401..444705)
FT                   /locus_tag="FB2170_00735"
FT   CDS_pept        complement(443401..444705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00735"
FT                   /product="putative transport protein, multidrug efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00735"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00147"
FT                   /db_xref="GOA:A4AVC5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC5"
FT                   /protein_id="EAR00147.1"
FT   gene            complement(444855..445628)
FT                   /locus_tag="FB2170_00740"
FT   CDS_pept        complement(444855..445628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00740"
FT                   /product="MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00740"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00148"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC6"
FT                   /protein_id="EAR00148.1"
FT   gene            445723..447231
FT                   /locus_tag="FB2170_00745"
FT   CDS_pept        445723..447231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00745"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00149"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC7"
FT                   /protein_id="EAR00149.1"
FT   gene            447228..448133
FT                   /locus_tag="FB2170_00750"
FT   CDS_pept        447228..448133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00750"
FT                   /product="possible gluconolactonase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00750"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00150"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC8"
FT                   /protein_id="EAR00150.1"
FT   gene            448161..449822
FT                   /locus_tag="FB2170_00755"
FT   CDS_pept        448161..449822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00755"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00151"
FT                   /db_xref="InterPro:IPR025150"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC9"
FT                   /protein_id="EAR00151.1"
FT   gene            449859..450575
FT                   /locus_tag="FB2170_00760"
FT   CDS_pept        449859..450575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00760"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00760"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00152"
FT                   /db_xref="GOA:A4AVD0"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD0"
FT                   /protein_id="EAR00152.1"
FT                   EILKRFVRKYTSHSIS"
FT   gene            450634..451092
FT                   /locus_tag="FB2170_00765"
FT   CDS_pept        450634..451092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00765"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00153"
FT                   /db_xref="InterPro:IPR011463"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD1"
FT                   /protein_id="EAR00153.1"
FT   gene            complement(451097..451696)
FT                   /locus_tag="FB2170_00770"
FT   CDS_pept        complement(451097..451696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00770"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00154"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD2"
FT                   /protein_id="EAR00154.1"
FT   gene            complement(451739..453940)
FT                   /locus_tag="FB2170_00775"
FT   CDS_pept        complement(451739..453940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00775"
FT                   /product="putative membrane associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00775"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00155"
FT                   /db_xref="GOA:A4AVD3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD3"
FT                   /protein_id="EAR00155.1"
FT   gene            complement(454026..454358)
FT                   /locus_tag="FB2170_00780"
FT   CDS_pept        complement(454026..454358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00780"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00156"
FT                   /db_xref="InterPro:IPR021274"
FT                   /db_xref="InterPro:IPR023154"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD4"
FT                   /protein_id="EAR00156.1"
FT                   VQQELS"
FT   gene            454590..455831
FT                   /locus_tag="FB2170_00785"
FT   CDS_pept        454590..455831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00785"
FT                   /product="Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00785"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00157"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD5"
FT                   /protein_id="EAR00157.1"
FT                   SEKMRQFVYQTIVD"
FT   gene            455893..456618
FT                   /locus_tag="FB2170_00790"
FT   CDS_pept        455893..456618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00790"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00790"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00158"
FT                   /db_xref="GOA:A4AVD6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD6"
FT                   /protein_id="EAR00158.1"
FT   gene            456630..457490
FT                   /locus_tag="FB2170_00795"
FT   CDS_pept        456630..457490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00795"
FT                   /product="putative xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00795"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00159"
FT                   /db_xref="GOA:A4AVD7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD7"
FT                   /protein_id="EAR00159.1"
FT                   FTTAE"
FT   gene            457494..458156
FT                   /locus_tag="FB2170_00800"
FT   CDS_pept        457494..458156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00800"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00800"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00160"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD8"
FT                   /protein_id="EAR00160.1"
FT   gene            458179..459795
FT                   /locus_tag="FB2170_00805"
FT   CDS_pept        458179..459795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00805"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00805"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00161"
FT                   /db_xref="GOA:A4AVD9"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD9"
FT                   /protein_id="EAR00161.1"
FT   gene            459812..461350
FT                   /locus_tag="FB2170_00810"
FT   CDS_pept        459812..461350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00810"
FT                   /product="carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00810"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00162"
FT                   /db_xref="GOA:A4AVE0"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE0"
FT                   /protein_id="EAR00162.1"
FT   gene            complement(461417..461836)
FT                   /locus_tag="FB2170_00815"
FT   CDS_pept        complement(461417..461836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00815"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00163"
FT                   /db_xref="InterPro:IPR041218"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE1"
FT                   /protein_id="EAR00163.1"
FT   gene            complement(461892..462482)
FT                   /locus_tag="FB2170_00820"
FT   CDS_pept        complement(461892..462482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00820"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00820"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00164"
FT                   /db_xref="GOA:A4AVE2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE2"
FT                   /protein_id="EAR00164.1"
FT   gene            complement(462483..462947)
FT                   /locus_tag="FB2170_00825"
FT   CDS_pept        complement(462483..462947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00825"
FT                   /product="Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00825"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00165"
FT                   /db_xref="GOA:A4AVE3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE3"
FT                   /protein_id="EAR00165.1"
FT   gene            462998..463813
FT                   /locus_tag="FB2170_00830"
FT   CDS_pept        462998..463813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00830"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00166"
FT                   /db_xref="GOA:A4AVE4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE4"
FT                   /protein_id="EAR00166.1"
FT   gene            464022..464819
FT                   /locus_tag="FB2170_00835"
FT   CDS_pept        464022..464819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00835"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00835"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00167"
FT                   /db_xref="GOA:A4AVE5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE5"
FT                   /protein_id="EAR00167.1"
FT   gene            464932..465516
FT                   /locus_tag="FB2170_00840"
FT   CDS_pept        464932..465516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00840"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00168"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE6"
FT                   /protein_id="EAR00168.1"
FT   gene            complement(465513..466127)
FT                   /locus_tag="FB2170_00845"
FT   CDS_pept        complement(465513..466127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00845"
FT                   /product="probable glycerol-3-phosphate cytidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00845"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00169"
FT                   /db_xref="GOA:A4AVE7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE7"
FT                   /protein_id="EAR00169.1"
FT   gene            466303..466986
FT                   /locus_tag="FB2170_00850"
FT   CDS_pept        466303..466986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00850"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00850"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00170"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE8"
FT                   /protein_id="EAR00170.1"
FT                   NNLFR"
FT   gene            466986..468818
FT                   /locus_tag="FB2170_00855"
FT   CDS_pept        466986..468818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00855"
FT                   /product="CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00855"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00171"
FT                   /db_xref="GOA:A4AVE9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE9"
FT                   /protein_id="EAR00171.1"
FT   gene            468818..469387
FT                   /locus_tag="FB2170_00860"
FT   CDS_pept        468818..469387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00860"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00172"
FT                   /db_xref="GOA:A4AVF0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF0"
FT                   /protein_id="EAR00172.1"
FT   gene            469390..470826
FT                   /locus_tag="FB2170_00865"
FT   CDS_pept        469390..470826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00865"
FT                   /product="putative polyA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00865"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00173"
FT                   /db_xref="GOA:A4AVF1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF1"
FT                   /protein_id="EAR00173.1"
FT   gene            470827..471843
FT                   /locus_tag="FB2170_00870"
FT   CDS_pept        470827..471843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00870"
FT                   /product="Cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00870"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00174"
FT                   /db_xref="GOA:A4AVF2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF2"
FT                   /protein_id="EAR00174.1"
FT   gene            471885..472382
FT                   /locus_tag="FB2170_00875"
FT   CDS_pept        471885..472382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00875"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00175"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF3"
FT                   /protein_id="EAR00175.1"
FT                   WN"
FT   gene            472455..473513
FT                   /locus_tag="FB2170_00880"
FT   CDS_pept        472455..473513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00880"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00176"
FT                   /db_xref="GOA:A4AVF4"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF4"
FT                   /protein_id="EAR00176.1"
FT                   YYLVYFNKEQKS"
FT   gene            complement(473522..474604)
FT                   /locus_tag="FB2170_00885"
FT   CDS_pept        complement(473522..474604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00885"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00177"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF5"
FT                   /protein_id="EAR00177.1"
FT   gene            474603..475598
FT                   /locus_tag="FB2170_00890"
FT   CDS_pept        474603..475598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00890"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00178"
FT                   /db_xref="GOA:A4AVF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF6"
FT                   /protein_id="EAR00178.1"
FT   gene            475614..476447
FT                   /locus_tag="FB2170_00895"
FT   CDS_pept        475614..476447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00895"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00895"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00179"
FT                   /db_xref="GOA:A4AVF7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF7"
FT                   /protein_id="EAR00179.1"
FT   gene            476474..479182
FT                   /locus_tag="FB2170_00900"
FT   CDS_pept        476474..479182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00900"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00180"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF8"
FT                   /protein_id="EAR00180.1"
FT   gene            479244..480149
FT                   /locus_tag="FB2170_00905"
FT   CDS_pept        479244..480149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00905"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00181"
FT                   /db_xref="GOA:A4AVF9"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF9"
FT                   /protein_id="EAR00181.1"
FT   gene            480206..482197
FT                   /locus_tag="FB2170_00910"
FT   CDS_pept        480206..482197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00910"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00910"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00182"
FT                   /db_xref="GOA:A4AVG0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG0"
FT                   /protein_id="EAR00182.1"
FT   gene            complement(482301..482726)
FT                   /locus_tag="FB2170_00915"
FT   CDS_pept        complement(482301..482726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00915"
FT                   /product="putative heat-shock related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00915"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00183"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG1"
FT                   /protein_id="EAR00183.1"
FT   gene            complement(482858..483259)
FT                   /locus_tag="FB2170_00920"
FT   CDS_pept        complement(482858..483259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00920"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00184"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG2"
FT                   /protein_id="EAR00184.1"
FT   gene            complement(483299..483832)
FT                   /locus_tag="FB2170_00925"
FT   CDS_pept        complement(483299..483832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00925"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00185"
FT                   /db_xref="GOA:A4AVG3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG3"
FT                   /protein_id="EAR00185.1"
FT                   MRVTKEDPNRFMPK"
FT   gene            483966..484334
FT                   /locus_tag="FB2170_00930"
FT   CDS_pept        483966..484334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00930"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00186"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG4"
FT                   /protein_id="EAR00186.1"
FT                   KKFNTDISPVKYKNKKKS"
FT   gene            complement(484371..484829)
FT                   /locus_tag="FB2170_00935"
FT   CDS_pept        complement(484371..484829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00935"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00187"
FT                   /db_xref="GOA:A4AVG5"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG5"
FT                   /protein_id="EAR00187.1"
FT   gene            complement(484983..486176)
FT                   /locus_tag="FB2170_00940"
FT   CDS_pept        complement(484983..486176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00940"
FT                   /product="Succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00940"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00188"
FT                   /db_xref="GOA:A4AVG6"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG6"
FT                   /protein_id="EAR00188.1"
FT   gene            complement(486253..486891)
FT                   /locus_tag="FB2170_00945"
FT   CDS_pept        complement(486253..486891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00945"
FT                   /product="ATP-dependent protease La domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00945"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00189"
FT                   /db_xref="GOA:A4AVG7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG7"
FT                   /protein_id="EAR00189.1"
FT   gene            487056..488297
FT                   /locus_tag="FB2170_00950"
FT   CDS_pept        487056..488297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00950"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00950"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00190"
FT                   /db_xref="GOA:A4AVG8"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG8"
FT                   /protein_id="EAR00190.1"
FT                   KDLFVPEKVKVAVK"
FT   gene            488360..488893
FT                   /locus_tag="FB2170_00955"
FT   CDS_pept        488360..488893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00955"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00191"
FT                   /db_xref="GOA:A4AVG9"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG9"
FT                   /protein_id="EAR00191.1"
FT                   YLEKDWKTYSGQGK"
FT   gene            complement(488957..490429)
FT                   /locus_tag="FB2170_00960"
FT   CDS_pept        complement(488957..490429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00960"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00960"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00192"
FT                   /db_xref="GOA:A4AVH0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH0"
FT                   /protein_id="EAR00192.1"
FT   gene            complement(490489..490995)
FT                   /locus_tag="FB2170_00965"
FT   CDS_pept        complement(490489..490995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00965"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00193"
FT                   /db_xref="GOA:A4AVH1"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH1"
FT                   /protein_id="EAR00193.1"
FT                   NPDKI"
FT   gene            complement(490995..491498)
FT                   /locus_tag="FB2170_00970"
FT   CDS_pept        complement(490995..491498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00970"
FT                   /product="FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00970"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00194"
FT                   /db_xref="GOA:A4AVH2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH2"
FT                   /protein_id="EAR00194.1"
FT                   NQIL"
FT   gene            complement(491631..492809)
FT                   /locus_tag="FB2170_00975"
FT   CDS_pept        complement(491631..492809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00195"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH3"
FT                   /protein_id="EAR00195.1"
FT   gene            complement(492976..493842)
FT                   /locus_tag="FB2170_00980"
FT   CDS_pept        complement(492976..493842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00980"
FT                   /product="hydroxymethylglutaryl-CoA lyase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00980"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00196"
FT                   /db_xref="GOA:A4AVH4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH4"
FT                   /protein_id="EAR00196.1"
FT                   ELFSKFH"
FT   gene            complement(493875..494531)
FT                   /locus_tag="FB2170_00985"
FT   CDS_pept        complement(493875..494531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00985"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00985"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00197"
FT                   /db_xref="GOA:A4AVH5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH5"
FT                   /protein_id="EAR00197.1"
FT   gene            494671..495003
FT                   /locus_tag="FB2170_00990"
FT   CDS_pept        494671..495003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00990"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00198"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH6"
FT                   /protein_id="EAR00198.1"
FT                   IDYWTK"
FT   gene            complement(495012..496052)
FT                   /locus_tag="FB2170_00995"
FT   CDS_pept        complement(495012..496052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00995"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00995"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00199"
FT                   /db_xref="GOA:A4AVH7"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH7"
FT                   /protein_id="EAR00199.1"
FT                   ALLAKI"
FT   gene            complement(496141..496587)
FT                   /locus_tag="FB2170_01000"
FT   CDS_pept        complement(496141..496587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01000"
FT                   /product="peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00200"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH8"
FT                   /protein_id="EAR00200.1"
FT   gene            496662..497888
FT                   /locus_tag="FB2170_01005"
FT   CDS_pept        496662..497888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01005"
FT                   /product="peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01005"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00201"
FT                   /db_xref="GOA:A4AVH9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH9"
FT                   /protein_id="EAR00201.1"
FT                   ICELTASKI"
FT   gene            497903..498496
FT                   /locus_tag="FB2170_01010"
FT   CDS_pept        497903..498496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00202"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI0"
FT                   /protein_id="EAR00202.1"
FT   gene            complement(498532..499857)
FT                   /locus_tag="FB2170_01015"
FT   CDS_pept        complement(498532..499857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01015"
FT                   /product="probable NADH-dependent dihydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01015"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00203"
FT                   /db_xref="GOA:A4AVI1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI1"
FT                   /protein_id="EAR00203.1"
FT   gene            complement(499980..500273)
FT                   /locus_tag="FB2170_01020"
FT   CDS_pept        complement(499980..500273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01020"
FT                   /product="YajC"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01020"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00204"
FT                   /db_xref="GOA:A4AVI2"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI2"
FT                   /protein_id="EAR00204.1"
FT   gene            complement(500299..500769)
FT                   /locus_tag="FB2170_01025"
FT   CDS_pept        complement(500299..500769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01025"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00205"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI3"
FT                   /protein_id="EAR00205.1"
FT   gene            complement(500811..501725)
FT                   /locus_tag="FB2170_01030"
FT   CDS_pept        complement(500811..501725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01030"
FT                   /product="putative N utilization substance protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00206"
FT                   /db_xref="GOA:A4AVI4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI4"
FT                   /protein_id="EAR00206.1"
FT   gene            501936..503690
FT                   /locus_tag="FB2170_01035"
FT   CDS_pept        501936..503690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01035"
FT                   /product="ABC transporter, ATP-binding protein, MDR family"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00207"
FT                   /db_xref="GOA:A4AVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI5"
FT                   /protein_id="EAR00207.1"
FT                   HQLAEKEN"
FT   gene            503769..504140
FT                   /locus_tag="FB2170_01040"
FT   CDS_pept        503769..504140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00208"
FT                   /db_xref="GOA:A4AVI6"
FT                   /db_xref="InterPro:IPR006628"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI6"
FT                   /protein_id="EAR00208.1"
FT   gene            504224..506746
FT                   /locus_tag="FB2170_01045"
FT   CDS_pept        504224..506746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01045"
FT                   /product="Secreted protein containing N-terminal
FT                   zinc-dependent carboxypeptidase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01045"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00209"
FT                   /db_xref="GOA:A4AVI7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI7"
FT                   /protein_id="EAR00209.1"
FT   gene            complement(506748..507791)
FT                   /locus_tag="FB2170_01050"
FT   CDS_pept        complement(506748..507791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01050"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00210"
FT                   /db_xref="GOA:A4AVI8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI8"
FT                   /protein_id="EAR00210.1"
FT                   LLYVKLK"
FT   gene            complement(507788..508711)
FT                   /locus_tag="FB2170_01055"
FT   CDS_pept        complement(507788..508711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01055"
FT                   /product="bile acid transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00211"
FT                   /db_xref="GOA:A4AVI9"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI9"
FT                   /protein_id="EAR00211.1"
FT   gene            complement(508716..509054)
FT                   /locus_tag="FB2170_01060"
FT   CDS_pept        complement(508716..509054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01060"
FT                   /product="t-RNA-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01060"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00212"
FT                   /db_xref="GOA:A4AVJ0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ0"
FT                   /protein_id="EAR00212.1"
FT                   VTNGLKIS"
FT   gene            509162..509722
FT                   /locus_tag="FB2170_01065"
FT   CDS_pept        509162..509722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00213"
FT                   /db_xref="GOA:A4AVJ1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ1"
FT                   /protein_id="EAR00213.1"
FT   gene            complement(509752..510294)
FT                   /locus_tag="FB2170_01070"
FT   CDS_pept        complement(509752..510294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01070"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00214"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ2"
FT                   /protein_id="EAR00214.1"
FT                   SKHHCAHIQGLLDRNDW"
FT   gene            510404..511042
FT                   /locus_tag="FB2170_01075"
FT   CDS_pept        510404..511042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01075"
FT                   /product="Peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00215"
FT                   /db_xref="GOA:A4AVJ3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ3"
FT                   /protein_id="EAR00215.1"
FT   gene            511197..511391
FT                   /locus_tag="FB2170_01080"
FT   CDS_pept        511197..511391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01080"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01080"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00216"
FT                   /db_xref="GOA:A4AVJ4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ4"
FT                   /protein_id="EAR00216.1"
FT   gene            511414..511512
FT                   /locus_tag="FB2170_01085"
FT   CDS_pept        511414..511512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01085"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00217"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ5"
FT                   /protein_id="EAR00217.1"
FT                   /translation="MAPDDISLGVFFETILVKKYATFRYRKNLFVK"
FT   gene            511775..511861
FT                   /locus_tag="FB2170_01090"
FT   CDS_pept        511775..511861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01090"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00218"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ6"
FT                   /protein_id="EAR00218.1"
FT                   /translation="MLFYLLQVWANNPKNDENNSIKKASVNY"
FT   gene            complement(511892..512824)
FT                   /locus_tag="FB2170_01095"
FT   CDS_pept        complement(511892..512824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01095"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01095"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00219"
FT                   /db_xref="GOA:A4AVJ7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ7"
FT                   /protein_id="EAR00219.1"
FT   gene            complement(512905..514305)
FT                   /locus_tag="FB2170_01100"
FT   CDS_pept        complement(512905..514305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01100"
FT                   /product="peptidase, M28D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00220"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ8"
FT                   /protein_id="EAR00220.1"
FT                   VKPPKIKG"
FT   gene            complement(514302..515216)
FT                   /locus_tag="FB2170_01105"
FT   CDS_pept        complement(514302..515216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00221"
FT                   /db_xref="GOA:A4AVJ9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ9"
FT                   /protein_id="EAR00221.1"
FT   gene            515379..516065
FT                   /locus_tag="FB2170_01110"
FT   CDS_pept        515379..516065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01110"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00222"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK0"
FT                   /protein_id="EAR00222.1"
FT                   KLNECK"
FT   gene            complement(516073..517236)
FT                   /locus_tag="FB2170_01115"
FT   CDS_pept        complement(516073..517236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01115"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01115"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00223"
FT                   /db_xref="GOA:A4AVK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK1"
FT                   /protein_id="EAR00223.1"
FT   gene            complement(517248..518141)
FT                   /locus_tag="FB2170_01120"
FT   CDS_pept        complement(517248..518141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00224"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK2"
FT                   /protein_id="EAR00224.1"
FT                   NDEPSLYFRTGFRIGI"
FT   gene            complement(518187..519533)
FT                   /locus_tag="FB2170_01125"
FT   CDS_pept        complement(518187..519533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01125"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01125"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00225"
FT                   /db_xref="GOA:A4AVK3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK3"
FT                   /protein_id="EAR00225.1"
FT   gene            complement(519520..520455)
FT                   /locus_tag="FB2170_01130"
FT   CDS_pept        complement(519520..520455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01130"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00226"
FT                   /db_xref="GOA:A4AVK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK4"
FT                   /protein_id="EAR00226.1"
FT   gene            complement(520635..521759)
FT                   /locus_tag="FB2170_01135"
FT   CDS_pept        complement(520635..521759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01135"
FT                   /product="chaperone protein dnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01135"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00227"
FT                   /db_xref="GOA:A4AVK5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK5"
FT                   /protein_id="EAR00227.1"
FT   gene            complement(521769..522329)
FT                   /locus_tag="FB2170_01140"
FT   CDS_pept        complement(521769..522329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01140"
FT                   /product="GrpE protein (Hsp-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01140"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00228"
FT                   /db_xref="GOA:A4AVK6"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK6"
FT                   /protein_id="EAR00228.1"
FT   gene            complement(522472..523434)
FT                   /locus_tag="FB2170_01145"
FT   CDS_pept        complement(522472..523434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01145"
FT                   /product="Cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01145"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00229"
FT                   /db_xref="GOA:A4AVK7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK7"
FT                   /protein_id="EAR00229.1"
FT   gene            complement(523556..524218)
FT                   /locus_tag="FB2170_01150"
FT   CDS_pept        complement(523556..524218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01150"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00230"
FT                   /db_xref="GOA:A4AVK8"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK8"
FT                   /protein_id="EAR00230.1"
FT   gene            complement(524218..524760)
FT                   /locus_tag="FB2170_01155"
FT   CDS_pept        complement(524218..524760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01155"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00231"
FT                   /db_xref="InterPro:IPR032577"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK9"
FT                   /protein_id="EAR00231.1"
FT                   EPKKTFGFEADGVLLKE"
FT   gene            525052..525891
FT                   /locus_tag="FB2170_01167"
FT   CDS_pept        525052..525891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01167"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01167"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99941"
FT                   /db_xref="GOA:A4AVL1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL1"
FT                   /protein_id="EAQ99941.1"
FT   gene            complement(525919..526305)
FT                   /locus_tag="FB2170_01172"
FT   CDS_pept        complement(525919..526305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01172"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99942"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL2"
FT                   /protein_id="EAQ99942.1"
FT   gene            526472..526660
FT                   /locus_tag="FB2170_01177"
FT   CDS_pept        526472..526660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01177"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99943"
FT                   /db_xref="GOA:A4AVL3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL3"
FT                   /protein_id="EAQ99943.1"
FT                   FIIFLLILFLIKYLLKN"
FT   gene            527049..527426
FT                   /locus_tag="FB2170_01182"
FT   CDS_pept        527049..527426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01182"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99944"
FT                   /db_xref="GOA:A4AVL4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL4"
FT                   /protein_id="EAQ99944.1"
FT   gene            527582..528022
FT                   /locus_tag="FB2170_01187"
FT   CDS_pept        527582..528022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01187"
FT                   /product="P-II family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01187"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99945"
FT                   /db_xref="GOA:A4AVL5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL5"
FT                   /protein_id="EAQ99945.1"
FT   gene            528049..529293
FT                   /locus_tag="FB2170_01192"
FT   CDS_pept        528049..529293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01192"
FT                   /product="Ammonium transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01192"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99946"
FT                   /db_xref="GOA:A4AVL6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL6"
FT                   /protein_id="EAQ99946.1"
FT                   EHGMDAYPDFRMNQH"
FT   gene            529404..530414
FT                   /locus_tag="FB2170_01197"
FT   CDS_pept        529404..530414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01197"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99947"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL7"
FT                   /protein_id="EAQ99947.1"
FT   gene            complement(530477..531133)
FT                   /locus_tag="FB2170_01202"
FT   CDS_pept        complement(530477..531133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01202"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99948"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL8"
FT                   /protein_id="EAQ99948.1"
FT   gene            531349..532551
FT                   /locus_tag="FB2170_01207"
FT   CDS_pept        531349..532551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01207"
FT                   /product="putative integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01207"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99949"
FT                   /db_xref="GOA:A4AVL9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL9"
FT                   /protein_id="EAQ99949.1"
FT                   K"
FT   gene            532551..533288
FT                   /locus_tag="FB2170_01212"
FT   CDS_pept        532551..533288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01212"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99950"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM0"
FT                   /protein_id="EAQ99950.1"
FT   gene            complement(533275..534687)
FT                   /locus_tag="FB2170_01217"
FT   CDS_pept        complement(533275..534687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01217"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99951"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM1"
FT                   /protein_id="EAQ99951.1"
FT                   YLKKARYEIIEE"
FT   gene            complement(534749..535573)
FT                   /locus_tag="FB2170_01222"
FT   CDS_pept        complement(534749..535573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01222"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01222"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99952"
FT                   /db_xref="GOA:A4AVM2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM2"
FT                   /protein_id="EAQ99952.1"
FT   gene            complement(535641..536093)
FT                   /locus_tag="FB2170_01227"
FT   CDS_pept        complement(535641..536093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01227"
FT                   /product="probable transcriptional regulatory protein, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01227"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99953"
FT                   /db_xref="GOA:A4AVM3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM3"
FT                   /protein_id="EAQ99953.1"
FT   gene            536203..536616
FT                   /locus_tag="FB2170_01232"
FT   CDS_pept        536203..536616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01232"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99954"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM4"
FT                   /protein_id="EAQ99954.1"
FT   gene            536689..537561
FT                   /locus_tag="FB2170_01237"
FT   CDS_pept        536689..537561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01237"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01237"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99955"
FT                   /db_xref="GOA:A4AVM5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM5"
FT                   /protein_id="EAQ99955.1"
FT                   YNNKTVIFS"
FT   gene            537585..538292
FT                   /locus_tag="FB2170_01242"
FT   CDS_pept        537585..538292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01242"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99956"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM6"
FT                   /protein_id="EAQ99956.1"
FT                   TTDLLRKVFTLQD"
FT   gene            538669..540096
FT                   /locus_tag="FB2170_01247"
FT   CDS_pept        538669..540096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01247"
FT                   /product="DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01247"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99957"
FT                   /db_xref="GOA:A4AVM7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM7"
FT                   /protein_id="EAQ99957.1"
FT                   NLTPSEYQRVALKATTM"
FT   gene            540699..543911
FT                   /locus_tag="FB2170_01252"
FT   CDS_pept        540699..543911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01252"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01252"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99958"
FT                   /db_xref="GOA:A4AVM8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM8"
FT                   /protein_id="EAQ99958.1"
FT   gene            543933..545600
FT                   /locus_tag="FB2170_01257"
FT   CDS_pept        543933..545600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01257"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM9"
FT                   /protein_id="EAQ99959.1"
FT   gene            545612..546487
FT                   /locus_tag="FB2170_01262"
FT   CDS_pept        545612..546487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01262"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99960"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN0"
FT                   /protein_id="EAQ99960.1"
FT                   GEITLNLCNE"
FT   gene            complement(546777..547289)
FT                   /locus_tag="FB2170_01267"
FT   CDS_pept        complement(546777..547289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01267"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99961"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN1"
FT                   /protein_id="EAQ99961.1"
FT                   GLYKKVE"
FT   gene            complement(547308..548096)
FT                   /locus_tag="FB2170_01272"
FT   CDS_pept        complement(547308..548096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01272"
FT                   /product="beta-ketoadipate enol-lactone hydrolase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01272"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99962"
FT                   /db_xref="GOA:A4AVN2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN2"
FT                   /protein_id="EAQ99962.1"
FT   gene            548324..548518
FT                   /locus_tag="FB2170_01277"
FT   CDS_pept        548324..548518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01277"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99963"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN3"
FT                   /protein_id="EAQ99963.1"
FT   gene            complement(548522..549346)
FT                   /locus_tag="FB2170_01282"
FT   CDS_pept        complement(548522..549346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01282"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01282"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99964"
FT                   /db_xref="GOA:A4AVN4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN4"
FT                   /protein_id="EAQ99964.1"
FT   gene            complement(549357..550433)
FT                   /locus_tag="FB2170_01287"
FT   CDS_pept        complement(549357..550433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01287"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01287"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99965"
FT                   /db_xref="GOA:A4AVN5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN5"
FT                   /protein_id="EAQ99965.1"
FT                   ELSLVENTEKLKEASEIF"
FT   gene            complement(550536..551816)
FT                   /locus_tag="FB2170_01292"
FT   CDS_pept        complement(550536..551816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01292"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99966"
FT                   /db_xref="InterPro:IPR021953"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN6"
FT                   /protein_id="EAQ99966.1"
FT   gene            complement(551936..552145)
FT                   /locus_tag="FB2170_01297"
FT   CDS_pept        complement(551936..552145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01297"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99967"
FT                   /db_xref="InterPro:IPR025362"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN7"
FT                   /protein_id="EAQ99967.1"
FT   gene            complement(552155..553150)
FT                   /locus_tag="FB2170_01302"
FT   CDS_pept        complement(552155..553150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01302"
FT                   /product="Membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01302"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99968"
FT                   /db_xref="GOA:A4AVN8"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN8"
FT                   /protein_id="EAQ99968.1"
FT   gene            complement(553147..553581)
FT                   /locus_tag="FB2170_01307"
FT   CDS_pept        complement(553147..553581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01307"
FT                   /product="putative thioredoxin disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01307"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99969"
FT                   /db_xref="GOA:A4AVN9"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN9"
FT                   /protein_id="EAQ99969.1"
FT   gene            complement(553605..554045)
FT                   /locus_tag="FB2170_01312"
FT   CDS_pept        complement(553605..554045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01312"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99970"
FT                   /db_xref="GOA:A4AVP0"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP0"
FT                   /protein_id="EAQ99970.1"
FT   gene            complement(554095..555273)
FT                   /locus_tag="FB2170_01317"
FT   CDS_pept        complement(554095..555273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01317"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01317"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99971"
FT                   /db_xref="GOA:A4AVP1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP1"
FT                   /protein_id="EAQ99971.1"
FT   gene            complement(555383..557569)
FT                   /locus_tag="FB2170_01322"
FT   CDS_pept        complement(555383..557569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01322"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01322"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99972"
FT                   /db_xref="GOA:A4AVP2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP2"
FT                   /protein_id="EAQ99972.1"
FT   gene            557782..558792
FT                   /locus_tag="FB2170_01327"
FT   CDS_pept        557782..558792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01327"
FT                   /product="glutamine synthetase II"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01327"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99973"
FT                   /db_xref="GOA:A4AVP3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP3"
FT                   /protein_id="EAQ99973.1"
FT   gene            complement(558856..560466)
FT                   /locus_tag="FB2170_01332"
FT   CDS_pept        complement(558856..560466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01332"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01332"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99974"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP4"
FT                   /protein_id="EAQ99974.1"
FT   gene            complement(560478..561416)
FT                   /locus_tag="FB2170_01337"
FT   CDS_pept        complement(560478..561416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01337"
FT                   /product="sodium/calcium exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01337"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99975"
FT                   /db_xref="GOA:A4AVP5"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP5"
FT                   /protein_id="EAQ99975.1"
FT   gene            561577..561936
FT                   /locus_tag="FB2170_01342"
FT   CDS_pept        561577..561936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01342"
FT                   /product="putative antibiotic resistance-related regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01342"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99976"
FT                   /db_xref="GOA:A4AVP6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP6"
FT                   /protein_id="EAQ99976.1"
FT                   VEELKEIINLIEKKK"
FT   gene            561936..563648
FT                   /locus_tag="FB2170_01347"
FT   CDS_pept        561936..563648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01347"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99977"
FT                   /db_xref="GOA:A4AVP7"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP7"
FT                   /protein_id="EAQ99977.1"
FT   gene            complement(563666..563809)
FT                   /locus_tag="FB2170_01352"
FT   CDS_pept        complement(563666..563809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01352"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99978"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP8"
FT                   /protein_id="EAQ99978.1"
FT                   EV"
FT   gene            564095..565432
FT                   /locus_tag="FB2170_01357"
FT   CDS_pept        564095..565432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01357"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99979"
FT                   /db_xref="GOA:A4AVP9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP9"
FT                   /protein_id="EAQ99979.1"
FT   gene            565486..565653
FT                   /locus_tag="FB2170_01362"
FT   CDS_pept        565486..565653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01362"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01362"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99980"
FT                   /db_xref="GOA:A4AVQ0"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ0"
FT                   /protein_id="EAQ99980.1"
FT                   RYFVTTKALG"
FT   gene            complement(565650..566162)
FT                   /locus_tag="FB2170_01367"
FT   CDS_pept        complement(565650..566162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01367"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01367"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99981"
FT                   /db_xref="GOA:A4AVQ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ1"
FT                   /protein_id="EAQ99981.1"
FT                   VKSLLLY"
FT   gene            566226..566302
FT                   /locus_tag="FB2170_t07269"
FT   tRNA            566226..566302
FT                   /locus_tag="FB2170_t07269"
FT                   /product="tRNA-Arg"
FT   gene            complement(566375..569686)
FT                   /locus_tag="FB2170_01372"
FT   CDS_pept        complement(566375..569686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01372"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99982"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ2"
FT                   /protein_id="EAQ99982.1"
FT   gene            complement(569789..571702)
FT                   /locus_tag="FB2170_01377"
FT   CDS_pept        complement(569789..571702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01377"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99983"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024302"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ3"
FT                   /protein_id="EAQ99983.1"
FT                   QN"
FT   gene            complement(571714..574830)
FT                   /locus_tag="FB2170_01382"
FT   CDS_pept        complement(571714..574830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01382"
FT                   /product="putative outer membrane protein probably involved
FT                   in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01382"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99984"
FT                   /db_xref="GOA:A4AVQ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ4"
FT                   /protein_id="EAQ99984.1"
FT   gene            complement(575075..577306)
FT                   /locus_tag="FB2170_01387"
FT   CDS_pept        complement(575075..577306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01387"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99985"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032287"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ5"
FT                   /protein_id="EAQ99985.1"
FT   gene            complement(577324..578532)
FT                   /locus_tag="FB2170_01392"
FT   CDS_pept        complement(577324..578532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01392"
FT                   /product="chitinase A1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01392"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99986"
FT                   /db_xref="GOA:A4AVQ6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ6"
FT                   /protein_id="EAQ99986.1"
FT                   KGL"
FT   gene            complement(578678..580903)
FT                   /locus_tag="FB2170_01397"
FT   CDS_pept        complement(578678..580903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01397"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01397"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99987"
FT                   /db_xref="GOA:A4AVQ7"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ7"
FT                   /protein_id="EAQ99987.1"
FT   gene            complement(580963..582174)
FT                   /locus_tag="FB2170_01402"
FT   CDS_pept        complement(580963..582174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01402"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99988"
FT                   /db_xref="GOA:A4AVQ8"
FT                   /db_xref="InterPro:IPR008977"
FT                   /db_xref="InterPro:IPR014784"
FT                   /db_xref="InterPro:IPR015196"
FT                   /db_xref="InterPro:IPR015197"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ8"
FT                   /protein_id="EAQ99988.1"
FT                   TYEE"
FT   gene            complement(582227..583573)
FT                   /locus_tag="FB2170_01407"
FT   CDS_pept        complement(582227..583573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01407"
FT                   /product="putative alpha-L-fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01407"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99989"
FT                   /db_xref="GOA:A4AVQ9"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ9"
FT                   /protein_id="EAQ99989.1"
FT   gene            complement(583575..585899)
FT                   /locus_tag="FB2170_01412"
FT   CDS_pept        complement(583575..585899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01412"
FT                   /product="putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01412"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99990"
FT                   /db_xref="GOA:A4AVR0"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR0"
FT                   /protein_id="EAQ99990.1"
FT   gene            complement(585896..586969)
FT                   /locus_tag="FB2170_01417"
FT   CDS_pept        complement(585896..586969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01417"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99991"
FT                   /db_xref="GOA:A4AVR1"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR1"
FT                   /protein_id="EAQ99991.1"
FT                   RKKLIIKEDGKFISTNK"
FT   gene            complement(586976..587938)
FT                   /locus_tag="FB2170_01422"
FT   CDS_pept        complement(586976..587938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01422"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99992"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR2"
FT                   /protein_id="EAQ99992.1"
FT   gene            complement(587964..589841)
FT                   /locus_tag="FB2170_01427"
FT   CDS_pept        complement(587964..589841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01427"
FT                   /product="Na+/glucose symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01427"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99993"
FT                   /db_xref="GOA:A4AVR3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR3"
FT                   /protein_id="EAQ99993.1"
FT   gene            complement(589848..592100)
FT                   /locus_tag="FB2170_01432"
FT   CDS_pept        complement(589848..592100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01432"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01432"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99994"
FT                   /db_xref="GOA:A4AVR4"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR4"
FT                   /protein_id="EAQ99994.1"
FT   gene            592312..593397
FT                   /locus_tag="FB2170_01437"
FT   CDS_pept        592312..593397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01437"
FT                   /product="putative two-component system sensor protein,
FT                   without kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01437"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99995"
FT                   /db_xref="GOA:A4AVR5"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR5"
FT                   /protein_id="EAQ99995.1"
FT   gene            593397..594113
FT                   /locus_tag="FB2170_01442"
FT   CDS_pept        593397..594113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01442"
FT                   /product="two-component system response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01442"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99996"
FT                   /db_xref="GOA:A4AVR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR6"
FT                   /protein_id="EAQ99996.1"
FT                   SYLNDVKSKILNNSIS"
FT   gene            594302..596647
FT                   /locus_tag="FB2170_01447"
FT   CDS_pept        594302..596647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01447"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99997"
FT                   /db_xref="GOA:A4AVR7"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR7"
FT                   /protein_id="EAQ99997.1"
FT   gene            596650..598143
FT                   /locus_tag="FB2170_01452"
FT   CDS_pept        596650..598143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01452"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99998"
FT                   /db_xref="GOA:A4AVR8"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR8"
FT                   /protein_id="EAQ99998.1"
FT   gene            598154..599188
FT                   /locus_tag="FB2170_01457"
FT   CDS_pept        598154..599188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01457"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99999"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR9"
FT                   /protein_id="EAQ99999.1"
FT                   LFRV"
FT   gene            599191..599988
FT                   /locus_tag="FB2170_01462"
FT   CDS_pept        599191..599988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01462"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01462"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00000"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS0"
FT                   /protein_id="EAR00000.1"
FT   gene            599989..602052
FT                   /locus_tag="FB2170_01467"
FT   CDS_pept        599989..602052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01467"
FT                   /product="beta-hexosaminidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01467"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00001"
FT                   /db_xref="GOA:A4AVS1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS1"
FT                   /protein_id="EAR00001.1"
FT   gene            602243..602731
FT                   /locus_tag="FB2170_01472"
FT   CDS_pept        602243..602731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01472"
FT                   /product="Histone acetyltransferase HPA2/related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01472"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00002"
FT                   /db_xref="GOA:A4AVS2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS2"
FT                   /protein_id="EAR00002.1"
FT   gene            602913..603470
FT                   /locus_tag="FB2170_01477"
FT   CDS_pept        602913..603470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01477"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00003"
FT                   /db_xref="GOA:A4AVS3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS3"
FT                   /protein_id="EAR00003.1"
FT   gene            603713..604447
FT                   /locus_tag="FB2170_01482"
FT   CDS_pept        603713..604447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01482"
FT                   /product="lipase, putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01482"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00004"
FT                   /db_xref="GOA:A4AVS4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS4"
FT                   /protein_id="EAR00004.1"
FT   gene            604608..605540
FT                   /locus_tag="FB2170_01487"
FT   CDS_pept        604608..605540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01487"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01487"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00005"
FT                   /db_xref="GOA:A4AVS5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS5"
FT                   /protein_id="EAR00005.1"
FT   gene            605686..607098
FT                   /locus_tag="FB2170_01492"
FT   CDS_pept        605686..607098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01492"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01492"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00006"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS6"
FT                   /protein_id="EAR00006.1"
FT                   AGRVTNLKFEKK"
FT   gene            607275..607532
FT                   /locus_tag="FB2170_01497"
FT   CDS_pept        607275..607532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01497"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00007"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS7"
FT                   /protein_id="EAR00007.1"
FT   gene            607529..607993
FT                   /locus_tag="FB2170_01502"
FT   CDS_pept        607529..607993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01502"
FT                   /product="alkylhydroperoxidase, AhpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01502"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00008"
FT                   /db_xref="GOA:A4AVS8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS8"
FT                   /protein_id="EAR00008.1"
FT   gene            607995..608936
FT                   /locus_tag="FB2170_01507"
FT   CDS_pept        607995..608936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01507"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01507"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00009"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS9"
FT                   /protein_id="EAR00009.1"
FT   gene            608989..609549
FT                   /locus_tag="FB2170_01512"
FT   CDS_pept        608989..609549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01512"
FT                   /product="putative peptide methionine sulfoxide reductase
FT                   MsrA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01512"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00010"
FT                   /db_xref="GOA:A4AVT0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT0"
FT                   /protein_id="EAR00010.1"
FT   gene            609554..609832
FT                   /locus_tag="FB2170_01517"
FT   CDS_pept        609554..609832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01517"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00011"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT1"
FT                   /protein_id="EAR00011.1"
FT   gene            609916..610125
FT                   /locus_tag="FB2170_01522"
FT   CDS_pept        609916..610125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01522"
FT                   /product="lipase, putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01522"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00012"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT2"
FT                   /protein_id="EAR00012.1"
FT   gene            610216..610809
FT                   /locus_tag="FB2170_01527"
FT   CDS_pept        610216..610809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01527"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00013"
FT                   /db_xref="GOA:A4AVT3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT3"
FT                   /protein_id="EAR00013.1"
FT   gene            complement(610892..611677)
FT                   /locus_tag="FB2170_01532"
FT   CDS_pept        complement(610892..611677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01532"
FT                   /product="DNA-binding response regulator RprY"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01532"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00014"
FT                   /db_xref="GOA:A4AVT4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT4"
FT                   /protein_id="EAR00014.1"
FT   gene            611929..612489
FT                   /locus_tag="FB2170_01537"
FT   CDS_pept        611929..612489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01537"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00015"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT5"
FT                   /protein_id="EAR00015.1"
FT   gene            612851..613393
FT                   /locus_tag="FB2170_01542"
FT   CDS_pept        612851..613393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01542"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00016"
FT                   /db_xref="GOA:A4AVT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT6"
FT                   /protein_id="EAR00016.1"
FT                   EFPDLEKCICYGINKNM"
FT   gene            613496..614071
FT                   /locus_tag="FB2170_01547"
FT   CDS_pept        613496..614071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01547"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00017"
FT                   /db_xref="GOA:A4AVT7"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT7"
FT                   /protein_id="EAR00017.1"
FT   gene            614290..616392
FT                   /locus_tag="FB2170_01552"
FT   CDS_pept        614290..616392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01552"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00018"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT8"
FT                   /protein_id="EAR00018.1"
FT                   ENMNRD"
FT   gene            616407..617747
FT                   /locus_tag="FB2170_01557"
FT   CDS_pept        616407..617747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01557"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00019"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT9"
FT                   /protein_id="EAR00019.1"
FT   gene            617784..618674
FT                   /locus_tag="FB2170_01562"
FT   CDS_pept        617784..618674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01562"
FT                   /product="putative endo-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01562"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00020"
FT                   /db_xref="GOA:A4AVU0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU0"
FT                   /protein_id="EAR00020.1"
FT                   ELPISMTVDWVRLYQ"
FT   gene            618778..619395
FT                   /locus_tag="FB2170_01567"
FT   CDS_pept        618778..619395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01567"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00021"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU1"
FT                   /protein_id="EAR00021.1"
FT   gene            619524..620024
FT                   /locus_tag="FB2170_01572"
FT   CDS_pept        619524..620024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01572"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00022"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU2"
FT                   /protein_id="EAR00022.1"
FT                   RIK"
FT   gene            620185..621171
FT                   /locus_tag="FB2170_01577"
FT   CDS_pept        620185..621171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01577"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00023"
FT                   /db_xref="GOA:A4AVU3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU3"
FT                   /protein_id="EAR00023.1"
FT   gene            complement(621154..621522)
FT                   /locus_tag="FB2170_01582"
FT   CDS_pept        complement(621154..621522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01582"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00024"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU4"
FT                   /protein_id="EAR00024.1"
FT                   THSNLWLVDGWFTLVVLV"
FT   gene            621713..622594
FT                   /locus_tag="FB2170_01587"
FT   CDS_pept        621713..622594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01587"
FT                   /product="YflS"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01587"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00025"
FT                   /db_xref="GOA:A4AVU5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU5"
FT                   /protein_id="EAR00025.1"
FT                   LATPWIMWASSL"
FT   gene            622888..623586
FT                   /locus_tag="FB2170_01592"
FT   CDS_pept        622888..623586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01592"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00026"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU6"
FT                   /protein_id="EAR00026.1"
FT                   QLQVSLHHKI"
FT   gene            623704..624267
FT                   /locus_tag="FB2170_01597"
FT   CDS_pept        623704..624267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01597"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00027"
FT                   /db_xref="GOA:A4AVU7"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU7"
FT                   /protein_id="EAR00027.1"
FT   gene            624267..624680
FT                   /locus_tag="FB2170_01602"
FT   CDS_pept        624267..624680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01602"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00028"
FT                   /db_xref="GOA:A4AVU8"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU8"
FT                   /protein_id="EAR00028.1"
FT   gene            complement(624684..627119)
FT                   /locus_tag="FB2170_01607"
FT   CDS_pept        complement(624684..627119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01607"
FT                   /product="cellobiose-phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01607"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00029"
FT                   /db_xref="GOA:A4AVU9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037825"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU9"
FT                   /protein_id="EAR00029.1"
FT   gene            complement(627148..628752)
FT                   /locus_tag="FB2170_01612"
FT   CDS_pept        complement(627148..628752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01612"
FT                   /product="sugar:cation symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01612"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00030"
FT                   /db_xref="GOA:A4AVV0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV0"
FT                   /protein_id="EAR00030.1"
FT                   KKLDEITLELKNRRLQE"
FT   gene            complement(628941..629714)
FT                   /locus_tag="FB2170_01617"
FT   CDS_pept        complement(628941..629714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01617"
FT                   /product="laminarinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01617"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00031"
FT                   /db_xref="GOA:A4AVV1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV1"
FT                   /protein_id="EAR00031.1"
FT   gene            complement(629707..629982)
FT                   /locus_tag="FB2170_01622"
FT   CDS_pept        complement(629707..629982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01622"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01622"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00032"
FT                   /db_xref="GOA:A4AVV2"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV2"
FT                   /protein_id="EAR00032.1"
FT   gene            complement(630015..630818)
FT                   /locus_tag="FB2170_01627"
FT   CDS_pept        complement(630015..630818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01627"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01627"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00033"
FT                   /db_xref="GOA:A4AVV3"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV3"
FT                   /protein_id="EAR00033.1"
FT   gene            complement(630920..631669)
FT                   /locus_tag="FB2170_01632"
FT   CDS_pept        complement(630920..631669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01632"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01632"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00034"
FT                   /db_xref="GOA:A4AVV4"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV4"
FT                   /protein_id="EAR00034.1"
FT   gene            complement(631721..632818)
FT                   /locus_tag="FB2170_01637"
FT   CDS_pept        complement(631721..632818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01637"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00035"
FT                   /db_xref="GOA:A4AVV5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV5"
FT                   /protein_id="EAR00035.1"
FT   gene            complement(632815..633360)
FT                   /locus_tag="FB2170_01642"
FT   CDS_pept        complement(632815..633360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01642"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00036"
FT                   /db_xref="InterPro:IPR011630"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV6"
FT                   /protein_id="EAR00036.1"
FT                   DMVNYAVFAMIHLNEETE"
FT   gene            633475..634296
FT                   /locus_tag="FB2170_01647"
FT   CDS_pept        633475..634296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01647"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01647"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00037"
FT                   /db_xref="GOA:A4AVV7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV7"
FT                   /protein_id="EAR00037.1"
FT   gene            634324..635136
FT                   /locus_tag="FB2170_01652"
FT   CDS_pept        634324..635136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01652"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00038"
FT                   /db_xref="GOA:A4AVV8"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV8"
FT                   /protein_id="EAR00038.1"
FT   gene            complement(635133..636899)
FT                   /locus_tag="FB2170_01657"
FT   CDS_pept        complement(635133..636899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01657"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01657"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00039"
FT                   /db_xref="GOA:A4AVV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV9"
FT                   /protein_id="EAR00039.1"
FT                   LYEAQFMEEEVA"
FT   gene            complement(636892..637566)
FT                   /locus_tag="FB2170_01662"
FT   CDS_pept        complement(636892..637566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01662"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01662"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00040"
FT                   /db_xref="GOA:A4AVW0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW0"
FT                   /protein_id="EAR00040.1"
FT                   NE"
FT   gene            637733..638227
FT                   /locus_tag="FB2170_01667"
FT   CDS_pept        637733..638227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01667"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00041"
FT                   /db_xref="GOA:A4AVW1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW1"
FT                   /protein_id="EAR00041.1"
FT                   R"
FT   gene            complement(638316..638726)
FT                   /locus_tag="FB2170_01672"
FT   CDS_pept        complement(638316..638726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01672"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00042"
FT                   /db_xref="GOA:A4AVW2"
FT                   /db_xref="InterPro:IPR025635"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW2"
FT                   /protein_id="EAR00042.1"
FT   gene            638921..640552
FT                   /locus_tag="FB2170_01677"
FT   CDS_pept        638921..640552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01677"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01677"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00043"
FT                   /db_xref="GOA:A4AVW3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW3"
FT                   /protein_id="EAR00043.1"
FT   gene            640751..641446
FT                   /locus_tag="FB2170_01682"
FT   CDS_pept        640751..641446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01682"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW4"
FT                   /protein_id="EAR00044.1"
FT                   GGGAPPPYN"
FT   gene            641468..642142
FT                   /locus_tag="FB2170_01687"
FT   CDS_pept        641468..642142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01687"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00045"
FT                   /db_xref="GOA:A4AVW5"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW5"
FT                   /protein_id="EAR00045.1"
FT                   EA"
FT   gene            642198..642896
FT                   /locus_tag="FB2170_01692"
FT   CDS_pept        642198..642896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01692"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00046"
FT                   /db_xref="GOA:A4AVW6"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW6"
FT                   /protein_id="EAR00046.1"
FT                   KRNVRQKKMP"
FT   gene            complement(642939..643190)
FT                   /locus_tag="FB2170_01701"
FT   CDS_pept        complement(642939..643190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01701"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01701"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99634"
FT                   /db_xref="GOA:A4AWM0"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM0"
FT                   /protein_id="EAQ99634.2"
FT   gene            complement(643236..643310)
FT                   /locus_tag="FB2170_t01970"
FT   tRNA            complement(643236..643310)
FT                   /locus_tag="FB2170_t01970"
FT                   /product="tRNA-Glu"
FT   gene            complement(643366..643440)
FT                   /locus_tag="FB2170_t01968"
FT   tRNA            complement(643366..643440)
FT                   /locus_tag="FB2170_t01968"
FT                   /product="tRNA-Glu"
FT   gene            complement(643612..645087)
FT                   /locus_tag="FB2170_01706"
FT   CDS_pept        complement(643612..645087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01706"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01706"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99635"
FT                   /db_xref="GOA:A4AWM1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM1"
FT                   /protein_id="EAQ99635.1"
FT   gene            645523..645639
FT                   /locus_tag="FB2170_01711"
FT   CDS_pept        645523..645639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01711"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99636"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM2"
FT                   /protein_id="EAQ99636.1"
FT   gene            645688..645918
FT                   /locus_tag="FB2170_01716"
FT   CDS_pept        645688..645918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01716"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99637"
FT                   /db_xref="GOA:A4AWM3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM3"
FT                   /protein_id="EAQ99637.1"
FT   gene            646015..646581
FT                   /locus_tag="FB2170_01721"
FT   CDS_pept        646015..646581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01721"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99638"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM4"
FT                   /protein_id="EAQ99638.1"
FT   gene            646583..648085
FT                   /locus_tag="FB2170_01726"
FT   CDS_pept        646583..648085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01726"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99639"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM5"
FT                   /protein_id="EAQ99639.1"
FT   gene            complement(648138..649517)
FT                   /locus_tag="FB2170_01731"
FT   CDS_pept        complement(648138..649517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01731"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01731"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99640"
FT                   /db_xref="GOA:A4AWM6"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM6"
FT                   /protein_id="EAQ99640.1"
FT                   R"
FT   gene            complement(649694..651502)
FT                   /locus_tag="FB2170_01736"
FT   CDS_pept        complement(649694..651502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01736"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99641"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM7"
FT                   /protein_id="EAQ99641.1"
FT   gene            651640..652320
FT                   /locus_tag="FB2170_01741"
FT   CDS_pept        651640..652320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01741"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01741"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99642"
FT                   /db_xref="GOA:A4AWM8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM8"
FT                   /protein_id="EAQ99642.1"
FT                   DTKF"
FT   gene            652336..653817
FT                   /locus_tag="FB2170_01746"
FT   CDS_pept        652336..653817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01746"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01746"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99643"
FT                   /db_xref="GOA:A4AWM9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM9"
FT                   /protein_id="EAQ99643.1"
FT   gene            653858..654097
FT                   /locus_tag="FB2170_01751"
FT   CDS_pept        653858..654097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01751"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99644"
FT                   /db_xref="GOA:A4AWN0"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN0"
FT                   /protein_id="EAQ99644.1"
FT   gene            654196..655158
FT                   /locus_tag="FB2170_01756"
FT   CDS_pept        654196..655158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01756"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01756"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99645"
FT                   /db_xref="GOA:A4AWN1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN1"
FT                   /protein_id="EAQ99645.1"
FT   gene            655196..655687
FT                   /locus_tag="FB2170_01761"
FT   CDS_pept        655196..655687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01761"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99646"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN2"
FT                   /protein_id="EAQ99646.1"
FT                   "
FT   gene            655684..656214
FT                   /locus_tag="FB2170_01766"
FT   CDS_pept        655684..656214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01766"
FT                   /product="YkkB"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01766"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99647"
FT                   /db_xref="GOA:A4AWN3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN3"
FT                   /protein_id="EAQ99647.1"
FT                   KNNPVHIFRVNNH"
FT   gene            656277..657515
FT                   /locus_tag="FB2170_01771"
FT   CDS_pept        656277..657515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01771"
FT                   /product="putative anion transport protein (ABC
FT                   superfamily, ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01771"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99648"
FT                   /db_xref="GOA:A4AWN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN4"
FT                   /protein_id="EAQ99648.1"
FT                   LKTSDMGSIGQTS"
FT   gene            657678..657872
FT                   /locus_tag="FB2170_01776"
FT   CDS_pept        657678..657872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01776"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99649"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN5"
FT                   /protein_id="EAQ99649.1"
FT   gene            658071..658451
FT                   /locus_tag="FB2170_01781"
FT   CDS_pept        658071..658451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01781"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99650"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN6"
FT                   /protein_id="EAQ99650.1"
FT   gene            complement(658521..661493)
FT                   /locus_tag="FB2170_01786"
FT   CDS_pept        complement(658521..661493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01786"
FT                   /product="putative protein-export transmembrane SecDF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01786"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99651"
FT                   /db_xref="GOA:A4AWN7"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN7"
FT                   /protein_id="EAQ99651.1"
FT                   E"
FT   gene            complement(661649..662575)
FT                   /locus_tag="FB2170_01791"
FT   CDS_pept        complement(661649..662575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01791"
FT                   /product="putative malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01791"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99652"
FT                   /db_xref="GOA:A4AWN8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN8"
FT                   /protein_id="EAQ99652.1"
FT   gene            662829..663200
FT                   /locus_tag="FB2170_01796"
FT   CDS_pept        662829..663200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01796"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99653"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN9"
FT                   /protein_id="EAQ99653.1"
FT   gene            complement(663278..664282)
FT                   /locus_tag="FB2170_01801"
FT   CDS_pept        complement(663278..664282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01801"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99654"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP0"
FT                   /protein_id="EAQ99654.1"
FT   gene            complement(664355..666295)
FT                   /locus_tag="FB2170_01806"
FT   CDS_pept        complement(664355..666295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01806"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01806"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99655"
FT                   /db_xref="GOA:A4AWP1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP1"
FT                   /protein_id="EAQ99655.1"
FT                   EKNAVYANIDA"
FT   gene            complement(666588..668252)
FT                   /locus_tag="FB2170_01811"
FT   CDS_pept        complement(666588..668252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01811"
FT                   /product="asparagine synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01811"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99656"
FT                   /db_xref="GOA:A4AWP2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP2"
FT                   /protein_id="EAQ99656.1"
FT   gene            668447..669034
FT                   /locus_tag="FB2170_01816"
FT   CDS_pept        668447..669034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01816"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99657"
FT                   /db_xref="InterPro:IPR021314"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP3"
FT                   /protein_id="EAQ99657.1"
FT   gene            complement(669115..670629)
FT                   /locus_tag="FB2170_01821"
FT   CDS_pept        complement(669115..670629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01821"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01821"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99658"
FT                   /db_xref="GOA:A4AWP4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP4"
FT                   /protein_id="EAQ99658.1"
FT   gene            complement(670768..671184)
FT                   /locus_tag="FB2170_01826"
FT   CDS_pept        complement(670768..671184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01826"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99659"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP5"
FT                   /protein_id="EAQ99659.1"
FT   gene            complement(671280..672047)
FT                   /locus_tag="FB2170_01831"
FT   CDS_pept        complement(671280..672047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01831"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99660"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP6"
FT                   /protein_id="EAQ99660.1"
FT   gene            complement(672109..675354)
FT                   /locus_tag="FB2170_01836"
FT   CDS_pept        complement(672109..675354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01836"
FT                   /product="protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01836"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99661"
FT                   /db_xref="GOA:A4AWP7"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR029414"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP7"
FT                   /protein_id="EAQ99661.1"
FT   gene            complement(675377..675884)
FT                   /pseudo
FT                   /locus_tag="FB2170_01841"
FT                   /note="hypothetical protein"
FT   gene            complement(675862..676596)
FT                   /locus_tag="FB2170_01851"
FT   CDS_pept        complement(675862..676596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01851"
FT                   /product="beta-lactamase II"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01851"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99664"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ0"
FT                   /protein_id="EAQ99664.1"
FT   gene            complement(676723..676914)
FT                   /locus_tag="FB2170_01856"
FT   CDS_pept        complement(676723..676914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01856"
FT                   /product="cold shock protein-like CspA family"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01856"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99665"
FT                   /db_xref="GOA:A4AWQ1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ1"
FT                   /protein_id="EAQ99665.1"
FT                   FDLQEGNKGLNAVNVKVI"
FT   gene            complement(677045..678349)
FT                   /locus_tag="FB2170_01861"
FT   CDS_pept        complement(677045..678349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01861"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99666"
FT                   /db_xref="GOA:A4AWQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ2"
FT                   /protein_id="EAQ99666.1"
FT   gene            678480..679271
FT                   /locus_tag="FB2170_01866"
FT   CDS_pept        678480..679271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01866"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01866"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99667"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ3"
FT                   /protein_id="EAQ99667.1"
FT   gene            complement(679268..680482)
FT                   /locus_tag="FB2170_01871"
FT   CDS_pept        complement(679268..680482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01871"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01871"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99668"
FT                   /db_xref="GOA:A4AWQ4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ4"
FT                   /protein_id="EAQ99668.1"
FT                   KKIDH"
FT   gene            complement(680566..682317)
FT                   /locus_tag="FB2170_01876"
FT   CDS_pept        complement(680566..682317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01876"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01876"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99669"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ5"
FT                   /protein_id="EAQ99669.1"
FT                   ATYKFDF"
FT   gene            complement(682339..685362)
FT                   /locus_tag="FB2170_01881"
FT   CDS_pept        complement(682339..685362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01881"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99670"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ6"
FT                   /protein_id="EAQ99670.1"
FT                   IIKSKEAQSNSSINPDGN"
FT   gene            685621..686304
FT                   /locus_tag="FB2170_01886"
FT   CDS_pept        685621..686304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01886"
FT                   /product="Cell division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01886"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99671"
FT                   /db_xref="GOA:A4AWQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ7"
FT                   /protein_id="EAQ99671.1"
FT                   VQKAV"
FT   gene            complement(686324..687511)
FT                   /locus_tag="FB2170_01891"
FT   CDS_pept        complement(686324..687511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01891"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99672"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ8"
FT                   /protein_id="EAQ99672.1"
FT   gene            687739..689244
FT                   /locus_tag="FB2170_01896"
FT   CDS_pept        687739..689244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01896"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01896"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99673"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ9"
FT                   /protein_id="EAQ99673.1"
FT   gene            689250..689672
FT                   /locus_tag="FB2170_01901"
FT   CDS_pept        689250..689672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01901"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99674"
FT                   /db_xref="GOA:A4AWR0"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR0"
FT                   /protein_id="EAQ99674.1"
FT   gene            689746..690495
FT                   /locus_tag="FB2170_01906"
FT   CDS_pept        689746..690495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01906"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01906"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99675"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR1"
FT                   /protein_id="EAQ99675.1"
FT   gene            complement(690562..692289)
FT                   /locus_tag="FB2170_01911"
FT   CDS_pept        complement(690562..692289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01911"
FT                   /product="GTP-binding elongation factor family protein
FT                   TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01911"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99676"
FT                   /db_xref="GOA:A4AWR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR2"
FT                   /protein_id="EAQ99676.1"
FT   gene            692527..693348
FT                   /locus_tag="FB2170_01916"
FT   CDS_pept        692527..693348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01916"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01916"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99677"
FT                   /db_xref="GOA:A4AWR3"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR3"
FT                   /protein_id="EAQ99677.1"
FT   gene            complement(693362..693523)
FT                   /locus_tag="FB2170_01921"
FT   CDS_pept        complement(693362..693523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01921"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99678"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR4"
FT                   /protein_id="EAQ99678.1"
FT                   LVPIRFDI"
FT   gene            693534..694742
FT                   /locus_tag="FB2170_01926"
FT   CDS_pept        693534..694742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01926"
FT                   /product="arylsulphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01926"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99679"
FT                   /db_xref="GOA:A4AWR5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR5"
FT                   /protein_id="EAQ99679.1"
FT                   IMK"
FT   gene            694795..696402
FT                   /locus_tag="FB2170_01931"
FT   CDS_pept        694795..696402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01931"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01931"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99680"
FT                   /db_xref="GOA:A4AWR6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR6"
FT                   /protein_id="EAQ99680.1"
FT                   DEISNGYIQLYKDKGWIE"
FT   gene            696538..697677
FT                   /locus_tag="FB2170_01936"
FT   CDS_pept        696538..697677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01936"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01936"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99681"
FT                   /db_xref="GOA:A4AWR7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR032165"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR7"
FT                   /protein_id="EAQ99681.1"
FT   gene            697649..699145
FT                   /locus_tag="FB2170_01941"
FT   CDS_pept        697649..699145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01941"
FT                   /product="iduronate-2-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01941"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99682"
FT                   /db_xref="GOA:A4AWR8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="InterPro:IPR035874"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR8"
FT                   /protein_id="EAQ99682.1"
FT   gene            699224..699832
FT                   /locus_tag="FB2170_01946"
FT   CDS_pept        699224..699832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01946"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99683"
FT                   /db_xref="GOA:A4AWR9"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR9"
FT                   /protein_id="EAQ99683.1"
FT   gene            699892..700131
FT                   /locus_tag="FB2170_01951"
FT   CDS_pept        699892..700131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01951"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99684"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS0"
FT                   /protein_id="EAQ99684.1"
FT   gene            700181..701527
FT                   /locus_tag="FB2170_01956"
FT   CDS_pept        700181..701527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01956"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01956"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99685"
FT                   /db_xref="GOA:A4AWS1"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS1"
FT                   /protein_id="EAQ99685.1"
FT   gene            complement(701595..702800)
FT                   /locus_tag="FB2170_01970"
FT   CDS_pept        complement(701595..702800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01970"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99686"
FT                   /db_xref="GOA:A4AWS2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR027281"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS2"
FT                   /protein_id="EAQ99686.2"
FT                   KE"
FT   gene            702890..702970
FT                   /locus_tag="FB2170_01975"
FT   CDS_pept        702890..702970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02012"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ0"
FT                   /protein_id="EAR02012.1"
FT                   /translation="MFFENMGPTGFDSETNGNVSMSSAGE"
FT   gene            complement(703621..706695)
FT                   /locus_tag="FB2170_01980"
FT   CDS_pept        complement(703621..706695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01980"
FT                   /product="helicase IV"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01980"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02013"
FT                   /db_xref="GOA:A4ALZ1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ1"
FT                   /protein_id="EAR02013.1"
FT   gene            707393..708973
FT                   /locus_tag="FB2170_01985"
FT   CDS_pept        707393..708973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01985"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02014"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ2"
FT                   /protein_id="EAR02014.1"
FT                   TLEEYFKLK"
FT   gene            709000..710061
FT                   /locus_tag="FB2170_01990"
FT   CDS_pept        709000..710061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01990"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02015"
FT                   /db_xref="InterPro:IPR025935"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ3"
FT                   /protein_id="EAR02015.1"
FT                   QLKLDLFPNEKTA"
FT   gene            710065..712188
FT                   /locus_tag="FB2170_01995"
FT   CDS_pept        710065..712188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01995"
FT                   /product="DNA-methyltransferase, type I
FT                   restriction-modification enzyme subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01995"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02016"
FT                   /db_xref="GOA:A4ALZ4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ4"
FT                   /protein_id="EAR02016.1"
FT                   ETFEASIEELESA"
FT   gene            712191..714638
FT                   /locus_tag="FB2170_02000"
FT   CDS_pept        712191..714638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02000"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02017"
FT                   /db_xref="GOA:A4ALZ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ5"
FT                   /protein_id="EAR02017.1"
FT                   RAM"
FT   gene            complement(714711..716108)
FT                   /locus_tag="FB2170_02005"
FT   CDS_pept        complement(714711..716108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02005"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02018"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ6"
FT                   /protein_id="EAR02018.1"
FT                   KLLITLM"
FT   gene            complement(716114..716395)
FT                   /locus_tag="FB2170_02010"
FT   CDS_pept        complement(716114..716395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02019"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ7"
FT                   /protein_id="EAR02019.1"
FT   gene            complement(716550..717221)
FT                   /locus_tag="FB2170_02015"
FT   CDS_pept        complement(716550..717221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02015"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02020"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ8"
FT                   /protein_id="EAR02020.1"
FT                   T"
FT   gene            complement(717279..718487)
FT                   /locus_tag="FB2170_02020"
FT   CDS_pept        complement(717279..718487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02020"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02020"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02021"
FT                   /db_xref="GOA:A4ALZ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ9"
FT                   /protein_id="EAR02021.1"
FT                   TKN"
FT   gene            complement(718956..719327)
FT                   /locus_tag="FB2170_02025"
FT   CDS_pept        complement(718956..719327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02025"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02022"
FT                   /db_xref="GOA:A4AM00"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM00"
FT                   /protein_id="EAR02022.1"
FT   gene            719587..719745
FT                   /locus_tag="FB2170_02030"
FT   CDS_pept        719587..719745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02023"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM01"
FT                   /protein_id="EAR02023.1"
FT                   LLSIKKQ"
FT   gene            719742..720749
FT                   /locus_tag="FB2170_02035"
FT   CDS_pept        719742..720749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02035"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02024"
FT                   /db_xref="GOA:A4AM02"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM02"
FT                   /protein_id="EAR02024.1"
FT   gene            720746..721378
FT                   /locus_tag="FB2170_02040"
FT   CDS_pept        720746..721378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02025"
FT                   /db_xref="GOA:A4AM03"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM03"
FT                   /protein_id="EAR02025.1"
FT   gene            721378..722535
FT                   /locus_tag="FB2170_02045"
FT   CDS_pept        721378..722535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02045"
FT                   /product="galactonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02045"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02026"
FT                   /db_xref="GOA:A4AM04"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM04"
FT                   /protein_id="EAR02026.1"
FT   gene            722581..723903
FT                   /locus_tag="FB2170_02050"
FT   CDS_pept        722581..723903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02050"
FT                   /product="GntP family permease"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02050"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02027"
FT                   /db_xref="GOA:A4AM05"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM05"
FT                   /protein_id="EAR02027.1"
FT   gene            723906..724937
FT                   /locus_tag="FB2170_02055"
FT   CDS_pept        723906..724937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02055"
FT                   /product="gluconolactonase (precursor)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02028"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM06"
FT                   /protein_id="EAR02028.1"
FT                   NLK"
FT   gene            complement(725044..726348)
FT                   /locus_tag="FB2170_02060"
FT   CDS_pept        complement(725044..726348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02060"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02029"
FT                   /db_xref="GOA:A4AM07"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM07"
FT                   /protein_id="EAR02029.1"
FT   gene            726680..726973
FT                   /locus_tag="FB2170_02065"
FT   CDS_pept        726680..726973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02030"
FT                   /db_xref="GOA:A4AM08"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM08"
FT                   /protein_id="EAR02030.1"
FT   gene            727265..727474
FT                   /locus_tag="FB2170_02070"
FT   CDS_pept        727265..727474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02070"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02031"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM09"
FT                   /protein_id="EAR02031.1"
FT   gene            complement(727537..728745)
FT                   /locus_tag="FB2170_02075"
FT   CDS_pept        complement(727537..728745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02075"
FT                   /product="BNR repeat protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02032"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM10"
FT                   /protein_id="EAR02032.1"
FT                   DSF"
FT   gene            complement(728745..729224)
FT                   /locus_tag="FB2170_02080"
FT   CDS_pept        complement(728745..729224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02080"
FT                   /product="thiol:disulfide interchange protein tlpA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02080"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02033"
FT                   /db_xref="GOA:A4AM11"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM11"
FT                   /protein_id="EAR02033.1"
FT   gene            complement(729369..730370)
FT                   /locus_tag="FB2170_02085"
FT   CDS_pept        complement(729369..730370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02085"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02034"
FT                   /db_xref="GOA:A4AM12"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM12"
FT                   /protein_id="EAR02034.1"
FT   gene            complement(730385..732523)
FT                   /locus_tag="FB2170_02090"
FT   CDS_pept        complement(730385..732523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02090"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02090"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02035"
FT                   /db_xref="GOA:A4AM13"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM13"
FT                   /protein_id="EAR02035.1"
FT                   GEDYTTSFGEIGVITEKL"
FT   gene            complement(732520..733341)
FT                   /locus_tag="FB2170_02095"
FT   CDS_pept        complement(732520..733341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02095"
FT                   /product="putative endo-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02095"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02036"
FT                   /db_xref="GOA:A4AM14"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM14"
FT                   /protein_id="EAR02036.1"
FT   gene            complement(733363..735531)
FT                   /locus_tag="FB2170_02100"
FT   CDS_pept        complement(733363..735531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02037"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM15"
FT                   /protein_id="EAR02037.1"
FT   gene            complement(735614..738058)
FT                   /locus_tag="FB2170_02105"
FT   CDS_pept        complement(735614..738058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02038"
FT                   /db_xref="GOA:A4AM16"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM16"
FT                   /protein_id="EAR02038.1"
FT                   NK"
FT   gene            complement(738058..740595)
FT                   /locus_tag="FB2170_02110"
FT   CDS_pept        complement(738058..740595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02110"
FT                   /product="putative secreted sulfatase ydeN precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02110"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02039"
FT                   /db_xref="GOA:A4AM17"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM17"
FT                   /protein_id="EAR02039.1"
FT   gene            complement(740582..741460)
FT                   /locus_tag="FB2170_02115"
FT   CDS_pept        complement(740582..741460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02115"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02040"
FT                   /db_xref="GOA:A4AM18"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM18"
FT                   /protein_id="EAR02040.1"
FT                   PVIKAFENDKN"
FT   gene            complement(741501..743864)
FT                   /locus_tag="FB2170_02120"
FT   CDS_pept        complement(741501..743864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02041"
FT                   /db_xref="GOA:A4AM19"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM19"
FT                   /protein_id="EAR02041.1"
FT   gene            complement(743884..745290)
FT                   /locus_tag="FB2170_02125"
FT   CDS_pept        complement(743884..745290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02125"
FT                   /product="sialic acid-specific 9-O-acetylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02125"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02042"
FT                   /db_xref="GOA:A4AM20"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM20"
FT                   /protein_id="EAR02042.1"
FT                   AFRTDSWKFE"
FT   gene            complement(745287..746894)
FT                   /locus_tag="FB2170_02130"
FT   CDS_pept        complement(745287..746894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02130"
FT                   /product="arylsulfatase A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02043"
FT                   /db_xref="GOA:A4AM21"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM21"
FT                   /protein_id="EAR02043.1"
FT                   GNEEWNQLTALRNNILEK"
FT   gene            complement(746891..749248)
FT                   /locus_tag="FB2170_02135"
FT   CDS_pept        complement(746891..749248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02135"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02044"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM22"
FT                   /protein_id="EAR02044.1"
FT   gene            complement(749282..751462)
FT                   /locus_tag="FB2170_02140"
FT   CDS_pept        complement(749282..751462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02140"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02045"
FT                   /db_xref="GOA:A4AM23"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM23"
FT                   /protein_id="EAR02045.1"
FT   gene            complement(751526..753007)
FT                   /locus_tag="FB2170_02145"
FT   CDS_pept        complement(751526..753007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02145"
FT                   /product="alpha-L-fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02145"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02046"
FT                   /db_xref="GOA:A4AM24"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031919"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM24"
FT                   /protein_id="EAR02046.1"
FT                   ESEAPEF