(data stored in ACNUC7421 zone)

EMBL: CP002158

ID   CP002158; SV 1; circular; genomic DNA; STD; PRO; 3843004 BP.
XX
AC   CP002158;
XX
PR   Project:PRJNA47;
XX
DT   11-AUG-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Fibrobacter succinogenes subsp. succinogenes S85, complete genome.
XX
KW   .
XX
OS   Fibrobacter succinogenes subsp. succinogenes S85
OC   Bacteria; Fibrobacteres; Fibrobacterales; Fibrobacteraceae; Fibrobacter.
XX
RN   [1]
RP   1-3843004
RA   Durkin A.S., Nelson K.E., Morrison M., Forsberg C.W., Wilson D.B.,
RA   Russell J.B., Cann I.K.O., Mackie R.I., White B.A.;
RT   ;
RL   Submitted (04-AUG-2010) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr., Rockville, MD
RL   20850, USA
XX
DR   MD5; 7dcebbd5ba0c52c29f73d84981d8f2d8.
DR   BioSample; SAMN02603971.
DR   EnsemblGenomes-Gn; EBG00001218143.
DR   EnsemblGenomes-Gn; EBG00001218144.
DR   EnsemblGenomes-Gn; EBG00001218145.
DR   EnsemblGenomes-Gn; EBG00001218146.
DR   EnsemblGenomes-Gn; EBG00001218147.
DR   EnsemblGenomes-Gn; EBG00001218148.
DR   EnsemblGenomes-Gn; EBG00001218149.
DR   EnsemblGenomes-Gn; EBG00001218150.
DR   EnsemblGenomes-Gn; EBG00001218151.
DR   EnsemblGenomes-Gn; EBG00001218152.
DR   EnsemblGenomes-Gn; EBG00001218153.
DR   EnsemblGenomes-Gn; EBG00001218154.
DR   EnsemblGenomes-Gn; EBG00001218155.
DR   EnsemblGenomes-Gn; EBG00001218156.
DR   EnsemblGenomes-Gn; EBG00001218157.
DR   EnsemblGenomes-Gn; EBG00001218158.
DR   EnsemblGenomes-Gn; EBG00001218159.
DR   EnsemblGenomes-Gn; EBG00001218160.
DR   EnsemblGenomes-Gn; EBG00001218161.
DR   EnsemblGenomes-Gn; EBG00001218162.
DR   EnsemblGenomes-Gn; EBG00001218163.
DR   EnsemblGenomes-Gn; EBG00001218164.
DR   EnsemblGenomes-Gn; EBG00001218165.
DR   EnsemblGenomes-Gn; EBG00001218166.
DR   EnsemblGenomes-Gn; EBG00001218167.
DR   EnsemblGenomes-Gn; EBG00001218168.
DR   EnsemblGenomes-Gn; EBG00001218169.
DR   EnsemblGenomes-Gn; EBG00001218170.
DR   EnsemblGenomes-Gn; EBG00001218171.
DR   EnsemblGenomes-Gn; EBG00001218172.
DR   EnsemblGenomes-Gn; EBG00001218173.
DR   EnsemblGenomes-Gn; EBG00001218174.
DR   EnsemblGenomes-Gn; EBG00001218175.
DR   EnsemblGenomes-Gn; EBG00001218176.
DR   EnsemblGenomes-Gn; EBG00001218177.
DR   EnsemblGenomes-Gn; EBG00001218178.
DR   EnsemblGenomes-Gn; EBG00001218179.
DR   EnsemblGenomes-Gn; EBG00001218180.
DR   EnsemblGenomes-Gn; EBG00001218183.
DR   EnsemblGenomes-Gn; EBG00001218184.
DR   EnsemblGenomes-Gn; EBG00001218185.
DR   EnsemblGenomes-Gn; EBG00001218187.
DR   EnsemblGenomes-Gn; EBG00001218188.
DR   EnsemblGenomes-Gn; EBG00001218189.
DR   EnsemblGenomes-Gn; EBG00001218190.
DR   EnsemblGenomes-Gn; EBG00001218191.
DR   EnsemblGenomes-Gn; EBG00001218192.
DR   EnsemblGenomes-Gn; EBG00001218193.
DR   EnsemblGenomes-Gn; EBG00001218194.
DR   EnsemblGenomes-Gn; EBG00001218195.
DR   EnsemblGenomes-Gn; EBG00001218196.
DR   EnsemblGenomes-Gn; EBG00001218197.
DR   EnsemblGenomes-Gn; EBG00001218198.
DR   EnsemblGenomes-Gn; EBG00001218199.
DR   EnsemblGenomes-Gn; EBG00001218200.
DR   EnsemblGenomes-Gn; EBG00001218201.
DR   EnsemblGenomes-Gn; EBG00001218202.
DR   EnsemblGenomes-Gn; EBG00001218203.
DR   EnsemblGenomes-Gn; EBG00001218204.
DR   EnsemblGenomes-Gn; EBG00001218205.
DR   EnsemblGenomes-Gn; EBG00001218206.
DR   EnsemblGenomes-Gn; EBG00001218207.
DR   EnsemblGenomes-Gn; EBG00001218208.
DR   EnsemblGenomes-Gn; EBG00001218209.
DR   EnsemblGenomes-Gn; EBG00001218210.
DR   EnsemblGenomes-Gn; EBG00001218211.
DR   EnsemblGenomes-Gn; EBG00001218212.
DR   EnsemblGenomes-Gn; EBG00001218213.
DR   EnsemblGenomes-Gn; EBG00001218214.
DR   EnsemblGenomes-Gn; EBG00001218215.
DR   EnsemblGenomes-Gn; EBG00001218216.
DR   EnsemblGenomes-Gn; EBG00001218217.
DR   EnsemblGenomes-Gn; EBG00001218218.
DR   EnsemblGenomes-Gn; EBG00001218219.
DR   EnsemblGenomes-Gn; EBG00001218220.
DR   EnsemblGenomes-Gn; EBG00001218221.
DR   EnsemblGenomes-Gn; EBG00001218222.
DR   EnsemblGenomes-Gn; FSU_0014.
DR   EnsemblGenomes-Gn; FSU_0044.
DR   EnsemblGenomes-Gn; FSU_0045.
DR   EnsemblGenomes-Gn; FSU_0046.
DR   EnsemblGenomes-Gn; FSU_0078.
DR   EnsemblGenomes-Gn; FSU_0156.
DR   EnsemblGenomes-Gn; FSU_0377.
DR   EnsemblGenomes-Gn; FSU_0378.
DR   EnsemblGenomes-Gn; FSU_0379.
DR   EnsemblGenomes-Gn; FSU_0458.
DR   EnsemblGenomes-Gn; FSU_0500.
DR   EnsemblGenomes-Gn; FSU_0646.
DR   EnsemblGenomes-Gn; FSU_0668.
DR   EnsemblGenomes-Gn; FSU_0858.
DR   EnsemblGenomes-Gn; FSU_0871.
DR   EnsemblGenomes-Gn; FSU_0927.
DR   EnsemblGenomes-Gn; FSU_1001.
DR   EnsemblGenomes-Gn; FSU_1027.
DR   EnsemblGenomes-Gn; FSU_1039.
DR   EnsemblGenomes-Gn; FSU_1099.
DR   EnsemblGenomes-Gn; FSU_1100.
DR   EnsemblGenomes-Gn; FSU_1101.
DR   EnsemblGenomes-Gn; FSU_1102.
DR   EnsemblGenomes-Gn; FSU_1103.
DR   EnsemblGenomes-Gn; FSU_1237.
DR   EnsemblGenomes-Gn; FSU_1714.
DR   EnsemblGenomes-Gn; FSU_1741.
DR   EnsemblGenomes-Gn; FSU_1744.
DR   EnsemblGenomes-Gn; FSU_1745.
DR   EnsemblGenomes-Gn; FSU_1746.
DR   EnsemblGenomes-Gn; FSU_1858.
DR   EnsemblGenomes-Gn; FSU_1911.
DR   EnsemblGenomes-Gn; FSU_1948.
DR   EnsemblGenomes-Gn; FSU_1949.
DR   EnsemblGenomes-Gn; FSU_1950.
DR   EnsemblGenomes-Gn; FSU_1951.
DR   EnsemblGenomes-Gn; FSU_1952.
DR   EnsemblGenomes-Gn; FSU_2057.
DR   EnsemblGenomes-Gn; FSU_2104.
DR   EnsemblGenomes-Gn; FSU_2379.
DR   EnsemblGenomes-Gn; FSU_2412.
DR   EnsemblGenomes-Gn; FSU_2414.
DR   EnsemblGenomes-Gn; FSU_2431.
DR   EnsemblGenomes-Gn; FSU_2438.
DR   EnsemblGenomes-Gn; FSU_2444.
DR   EnsemblGenomes-Gn; FSU_2445.
DR   EnsemblGenomes-Gn; FSU_2446.
DR   EnsemblGenomes-Gn; FSU_2447.
DR   EnsemblGenomes-Gn; FSU_2448.
DR   EnsemblGenomes-Gn; FSU_2452.
DR   EnsemblGenomes-Gn; FSU_2454.
DR   EnsemblGenomes-Gn; FSU_2455.
DR   EnsemblGenomes-Gn; FSU_2463.
DR   EnsemblGenomes-Gn; FSU_2549.
DR   EnsemblGenomes-Gn; FSU_2594.
DR   EnsemblGenomes-Gn; FSU_2646.
DR   EnsemblGenomes-Gn; FSU_2647.
DR   EnsemblGenomes-Gn; FSU_2648.
DR   EnsemblGenomes-Gn; FSU_2683.
DR   EnsemblGenomes-Gn; FSU_2818.
DR   EnsemblGenomes-Gn; FSU_2871.
DR   EnsemblGenomes-Gn; FSU_2916.
DR   EnsemblGenomes-Gn; FSU_2918.
DR   EnsemblGenomes-Gn; FSU_2937.
DR   EnsemblGenomes-Gn; FSU_2938.
DR   EnsemblGenomes-Gn; FSU_3002.
DR   EnsemblGenomes-Gn; FSU_3176.
DR   EnsemblGenomes-Gn; FSU_3388.
DR   EnsemblGenomes-Gn; FSU_3508.
DR   EnsemblGenomes-Gn; FSU_3509.
DR   EnsemblGenomes-Tr; EBT00001786872.
DR   EnsemblGenomes-Tr; EBT00001786873.
DR   EnsemblGenomes-Tr; EBT00001786875.
DR   EnsemblGenomes-Tr; EBT00001786876.
DR   EnsemblGenomes-Tr; EBT00001786877.
DR   EnsemblGenomes-Tr; EBT00001786878.
DR   EnsemblGenomes-Tr; EBT00001786882.
DR   EnsemblGenomes-Tr; EBT00001786883.
DR   EnsemblGenomes-Tr; EBT00001786885.
DR   EnsemblGenomes-Tr; EBT00001786888.
DR   EnsemblGenomes-Tr; EBT00001786889.
DR   EnsemblGenomes-Tr; EBT00001786890.
DR   EnsemblGenomes-Tr; EBT00001786892.
DR   EnsemblGenomes-Tr; EBT00001786893.
DR   EnsemblGenomes-Tr; EBT00001786894.
DR   EnsemblGenomes-Tr; EBT00001786897.
DR   EnsemblGenomes-Tr; EBT00001786899.
DR   EnsemblGenomes-Tr; EBT00001786900.
DR   EnsemblGenomes-Tr; EBT00001786901.
DR   EnsemblGenomes-Tr; EBT00001786902.
DR   EnsemblGenomes-Tr; EBT00001786904.
DR   EnsemblGenomes-Tr; EBT00001786906.
DR   EnsemblGenomes-Tr; EBT00001786909.
DR   EnsemblGenomes-Tr; EBT00001786910.
DR   EnsemblGenomes-Tr; EBT00001786911.
DR   EnsemblGenomes-Tr; EBT00001786912.
DR   EnsemblGenomes-Tr; EBT00001786913.
DR   EnsemblGenomes-Tr; EBT00001786914.
DR   EnsemblGenomes-Tr; EBT00001786916.
DR   EnsemblGenomes-Tr; EBT00001786917.
DR   EnsemblGenomes-Tr; EBT00001786919.
DR   EnsemblGenomes-Tr; EBT00001786921.
DR   EnsemblGenomes-Tr; EBT00001786924.
DR   EnsemblGenomes-Tr; EBT00001786926.
DR   EnsemblGenomes-Tr; EBT00001786928.
DR   EnsemblGenomes-Tr; EBT00001786929.
DR   EnsemblGenomes-Tr; EBT00001786930.
DR   EnsemblGenomes-Tr; EBT00001786932.
DR   EnsemblGenomes-Tr; EBT00001786934.
DR   EnsemblGenomes-Tr; EBT00001786936.
DR   EnsemblGenomes-Tr; EBT00001786937.
DR   EnsemblGenomes-Tr; EBT00001786939.
DR   EnsemblGenomes-Tr; EBT00001786940.
DR   EnsemblGenomes-Tr; EBT00001786941.
DR   EnsemblGenomes-Tr; EBT00001786943.
DR   EnsemblGenomes-Tr; EBT00001786944.
DR   EnsemblGenomes-Tr; EBT00001786946.
DR   EnsemblGenomes-Tr; EBT00001786948.
DR   EnsemblGenomes-Tr; EBT00001786949.
DR   EnsemblGenomes-Tr; EBT00001786950.
DR   EnsemblGenomes-Tr; EBT00001786951.
DR   EnsemblGenomes-Tr; EBT00001786952.
DR   EnsemblGenomes-Tr; EBT00001786953.
DR   EnsemblGenomes-Tr; EBT00001786954.
DR   EnsemblGenomes-Tr; EBT00001786955.
DR   EnsemblGenomes-Tr; EBT00001786956.
DR   EnsemblGenomes-Tr; EBT00001786957.
DR   EnsemblGenomes-Tr; EBT00001786959.
DR   EnsemblGenomes-Tr; EBT00001786960.
DR   EnsemblGenomes-Tr; EBT00001786961.
DR   EnsemblGenomes-Tr; EBT00001786962.
DR   EnsemblGenomes-Tr; EBT00001786963.
DR   EnsemblGenomes-Tr; EBT00001786964.
DR   EnsemblGenomes-Tr; EBT00001786965.
DR   EnsemblGenomes-Tr; EBT00001786966.
DR   EnsemblGenomes-Tr; EBT00001786967.
DR   EnsemblGenomes-Tr; EBT00001786968.
DR   EnsemblGenomes-Tr; EBT00001786969.
DR   EnsemblGenomes-Tr; EBT00001786971.
DR   EnsemblGenomes-Tr; EBT00001786972.
DR   EnsemblGenomes-Tr; EBT00001786973.
DR   EnsemblGenomes-Tr; EBT00001786974.
DR   EnsemblGenomes-Tr; EBT00001786975.
DR   EnsemblGenomes-Tr; EBT00001786976.
DR   EnsemblGenomes-Tr; EBT00001786977.
DR   EnsemblGenomes-Tr; EBT00001786978.
DR   EnsemblGenomes-Tr; EBT00001786979.
DR   EnsemblGenomes-Tr; FSU_0014-1.
DR   EnsemblGenomes-Tr; FSU_0044-1.
DR   EnsemblGenomes-Tr; FSU_0045-1.
DR   EnsemblGenomes-Tr; FSU_0046-1.
DR   EnsemblGenomes-Tr; FSU_0078-1.
DR   EnsemblGenomes-Tr; FSU_0156-1.
DR   EnsemblGenomes-Tr; FSU_0377-1.
DR   EnsemblGenomes-Tr; FSU_0378-1.
DR   EnsemblGenomes-Tr; FSU_0379-1.
DR   EnsemblGenomes-Tr; FSU_0458-1.
DR   EnsemblGenomes-Tr; FSU_0500-1.
DR   EnsemblGenomes-Tr; FSU_0646-1.
DR   EnsemblGenomes-Tr; FSU_0668-1.
DR   EnsemblGenomes-Tr; FSU_0858-1.
DR   EnsemblGenomes-Tr; FSU_0871-1.
DR   EnsemblGenomes-Tr; FSU_0927-1.
DR   EnsemblGenomes-Tr; FSU_1001-1.
DR   EnsemblGenomes-Tr; FSU_1027-1.
DR   EnsemblGenomes-Tr; FSU_1039-1.
DR   EnsemblGenomes-Tr; FSU_1099-1.
DR   EnsemblGenomes-Tr; FSU_1100-1.
DR   EnsemblGenomes-Tr; FSU_1101-1.
DR   EnsemblGenomes-Tr; FSU_1102-1.
DR   EnsemblGenomes-Tr; FSU_1103-1.
DR   EnsemblGenomes-Tr; FSU_1237-1.
DR   EnsemblGenomes-Tr; FSU_1714-1.
DR   EnsemblGenomes-Tr; FSU_1741-1.
DR   EnsemblGenomes-Tr; FSU_1744-1.
DR   EnsemblGenomes-Tr; FSU_1745-1.
DR   EnsemblGenomes-Tr; FSU_1746-1.
DR   EnsemblGenomes-Tr; FSU_1858-1.
DR   EnsemblGenomes-Tr; FSU_1911-1.
DR   EnsemblGenomes-Tr; FSU_1948-1.
DR   EnsemblGenomes-Tr; FSU_1949-1.
DR   EnsemblGenomes-Tr; FSU_1950-1.
DR   EnsemblGenomes-Tr; FSU_1951-1.
DR   EnsemblGenomes-Tr; FSU_1952-1.
DR   EnsemblGenomes-Tr; FSU_2057-1.
DR   EnsemblGenomes-Tr; FSU_2104-1.
DR   EnsemblGenomes-Tr; FSU_2379-1.
DR   EnsemblGenomes-Tr; FSU_2412-1.
DR   EnsemblGenomes-Tr; FSU_2414-1.
DR   EnsemblGenomes-Tr; FSU_2431-1.
DR   EnsemblGenomes-Tr; FSU_2438-1.
DR   EnsemblGenomes-Tr; FSU_2444-1.
DR   EnsemblGenomes-Tr; FSU_2445-1.
DR   EnsemblGenomes-Tr; FSU_2446-1.
DR   EnsemblGenomes-Tr; FSU_2447-1.
DR   EnsemblGenomes-Tr; FSU_2448-1.
DR   EnsemblGenomes-Tr; FSU_2452-1.
DR   EnsemblGenomes-Tr; FSU_2454-1.
DR   EnsemblGenomes-Tr; FSU_2455-1.
DR   EnsemblGenomes-Tr; FSU_2463-1.
DR   EnsemblGenomes-Tr; FSU_2549-1.
DR   EnsemblGenomes-Tr; FSU_2594-1.
DR   EnsemblGenomes-Tr; FSU_2646-1.
DR   EnsemblGenomes-Tr; FSU_2647-1.
DR   EnsemblGenomes-Tr; FSU_2648-1.
DR   EnsemblGenomes-Tr; FSU_2683-1.
DR   EnsemblGenomes-Tr; FSU_2818-1.
DR   EnsemblGenomes-Tr; FSU_2871-1.
DR   EnsemblGenomes-Tr; FSU_2916-1.
DR   EnsemblGenomes-Tr; FSU_2918-1.
DR   EnsemblGenomes-Tr; FSU_2937-1.
DR   EnsemblGenomes-Tr; FSU_2938-1.
DR   EnsemblGenomes-Tr; FSU_3002-1.
DR   EnsemblGenomes-Tr; FSU_3176-1.
DR   EnsemblGenomes-Tr; FSU_3388-1.
DR   EnsemblGenomes-Tr; FSU_3508-1.
DR   EnsemblGenomes-Tr; FSU_3509-1.
DR   EuropePMC; PMC3079729; 21526192.
DR   EuropePMC; PMC3277595; 22347999.
DR   GOA; P0DN68.
DR   InterPro; IPR006197; Peptidase_S24_LexA.
DR   InterPro; IPR006199; LexA_DNA-bd_dom.
DR   InterPro; IPR006200; LexA.
DR   InterPro; IPR015927; Peptidase_S24_S26A/B/C.
DR   InterPro; IPR039418; LexA-like.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002158.
DR   SILVA-SSU; CP002158.
DR   StrainInfo; 267071; 1.
DR   UniProtKB/Swiss-Prot; P0DN68; LEXA_FIBSS.
XX
CC   The source of DNA was Professor Cecil Forsberg, University of
CC   Guelph (cforsber@uoguelph.ca).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3843004
FT                   /organism="Fibrobacter succinogenes subsp. succinogenes
FT                   S85"
FT                   /sub_species="succinogenes"
FT                   /strain="S85"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:59374"
FT   gene            58..1503
FT                   /gene="dnaA_1"
FT                   /locus_tag="FSU_0001"
FT   CDS_pept        58..1503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA_1"
FT                   /locus_tag="FSU_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26595"
FT                   /db_xref="GOA:D9S480"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S480"
FT                   /protein_id="ADL26595.1"
FT                   /translation="MLDIAESPWQQVLDRVRSECKDFFGAVILDALGYEGMCNGYALLT
FT                   VPDELRENWVNSHYGDLLRKSFTAVFGSEFVDYRIRQIAPSDPIPEIKLTMPVIPRPEK
FT                   KKAEVKRPKQPLALYARYTFENFVEGECNSTAFRACQAVAENPGDPALNPLFVYGESGL
FT                   GKTHLLQSIAAKIQKSRPEASIVYCHAYDFLRDATAMASALHNKTGNVRELAEKFRERY
FT                   ELCDVLLLDDVQLLEKGLWTQDRLAILIKHLRAEGKQVVISCDRHPNLFRVVDTDNESR
FT                   GSSRSSIPSISKKLLAPLASCVAVGIDEPDLATRMNLISKKSEDLPFAKGDREEICRYL
FT                   SMQPRKNVRLIEGLLNFLGAMNMFCKADLNLNGVKRLVAPSEHGGHVELTAKNIIEAVA
FT                   MDYRVEVCELSSKRQAAAISMPRKVAMFLCRELTTDSLQNIGAMFCRDYATVIAAINSL
FT                   KKQMETDASLARRVQDIRYMLEA"
FT   gene            1505..2371
FT                   /pseudo
FT                   /locus_tag="FSU_0002"
FT                   /note="putative oxidoreductase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00106; match to
FT                   protein family HMM PF01073; match to protein family HMM
FT                   PF01370; match to protein family HMM PF02719; match to
FT                   protein family HMM PF04321; match to protein family HMM
FT                   PF07993; match to protein family HMM PF08659"
FT   gene            2584..3951
FT                   /locus_tag="FSU_0003"
FT   CDS_pept        2584..3951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0003"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26097"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN83"
FT                   /protein_id="ADL26097.1"
FT                   /translation="MGMNKKKLLALLVSSAFLFTACDEEDLPSAPKKEISSSSVEEDDC
FT                   DSDECEVKSSSSKSEDKKSSDSKDDDKKSSDSKDNKSSDSKSESNSSSSAKDEAKSSSS
FT                   AEAPKSSSSVDVPKGARAAKLTDLEKNVELKLFDQTVYLSTGSKQGLVALRIQDELWLV
FT                   TYTDFANGEVKFVDGNVGKQYAETDAVKKILEKLKDKNGFTISFIVDENGVVKYAVNGS
FT                   KEYSEAVKASVAVAKGKVSKAEDIKDKIYKCTDGDTTRTFTFFDNSYIVENGVGDKVAY
FT                   WIGGHYDIQRSTLLMRPAYYNKPVYSMYAYSVGTENTISMSNGETTTTMNCKVEASEYE
FT                   YEKASDFVGEWQAQKDGVEWKFTLKADGTYELVAFEGNNVNSAEYKIGSWEIYGYHLMM
FT                   HNTGCQHQDKCTSSIHGQLQTGPIDKATNKISGFSFIHSDPDTPKIPTSFDAPQYE"
FT   gene            4011..5567
FT                   /locus_tag="FSU_0004"
FT   CDS_pept        4011..5567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0004"
FT                   /product="NAD+ synthetase, glutamine-dependent"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24653"
FT                   /db_xref="GOA:D9S482"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D9S482"
FT                   /protein_id="ADL24653.1"
FT                   /translation="MHFIVHLKKCIAYGRCIFLFSSAEDIEMKLYVVQMKILPGNVSAN
FT                   MQTMKAAFDRAKAAEVDCVVFPRYALTGPSNRALPVDWAEIRKYAGNMPFFLCGDVLDD
FT                   TPLLNVAHVTHGSDFYVVGRREVENKELSHLAQDCAMPVVCLNGVGTDNTGKNIYALSG
FT                   GSRVFDCDGKIVFEMPLFSEAEAVIEFVDGQVQVYAESSKPYTNEIAEIHDALVFMIRE
FT                   NLKMFHISRMVIGASGGIDSAVSAALYAEAIGPENVYLVNMPTRFNSDTTKNAARDLAE
FT                   NLGTPYMVAPISDIIESVCHTLERCSFVRNDTVMKIAGINHENLQARTRSASILSTVAS
FT                   VVGAGVTCNGNKSEAMVGYCTLYGDTCGVMCALGDLWKTQVYELARYINRDKEIIPKAS
FT                   IDIPASAELSDAMNVDEGKGDPILYPYHDKLFAMWVEKCVSLEFTEKLLLEGTLGEMLG
FT                   VDAAYFKAHLPTTEAALEDMRFWYRRFKGLALAKRIQFPPILSVSGHAFGGEYRESQIS
FT                   G"
FT   gene            5757..6368
FT                   /gene="slyD"
FT                   /locus_tag="FSU_0005"
FT   CDS_pept        5757..6368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="FSU_0005"
FT                   /product="peptidyl-prolyl cis-trans isomerase SlyD"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P30856; match to
FT                   protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26233"
FT                   /db_xref="GOA:C9RN85"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN85"
FT                   /protein_id="ADL26233.1"
FT                   /translation="MKIAEKTVVQMHYTLKSDEGAVVESSAGREPLQYIQGMHMIVPGL
FT                   EKAMVGHDVGDKFDVVVIPAEGYGEYDERMTQEVPLNVFQGVDHVEAGMAFYAQTPGGP
FT                   MQIRIKSVGEKTAIIDANHELAGKNLNFAIEVVSVREATEEDLKPFQHHCCCGGHDGED
FT                   HECKCGEEGHECECGGHGNKENCDGNGGCGCEHHAEHHGK"
FT   gene            6491..7972
FT                   /locus_tag="FSU_0006"
FT   CDS_pept        6491..7972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0006"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07581"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27066"
FT                   /db_xref="UniProtKB/TrEMBL:D9S484"
FT                   /protein_id="ADL27066.1"
FT                   /translation="MDMRFAKVLSVAALPMFLFACGDDNSSLKVSNPEGETPQDSSTVE
FT                   PPPNIPDEELKPIARDYSLIWSGKGTAEEPFLIASEQDLASLAFYVNDSSMTFKDFYFK
FT                   QTADIALSGAWSPIGIFGKNAYGYGNRPFSGVYDGGLKTITGLSITDTASYSGLFGLVR
FT                   GAQVSNVVIKGAKLNVGSYAGVLAGKMDSTTVENCSFEDVEIKGADRVGGLVGEATHVQ
FT                   AKNVSVTGTIQGVNSVGGVVGRMQDGSLENVTNKANVSGTSTVAGVVGSFASVASEGVI
FT                   SAALNYGAVTGTKDVAGVVATLSATKLERSGNSGAVVADSSQMSNVGGVIAVASSKSAI
FT                   NEVFNTATVSVRRVMIAGGVIGALKNSSATNLFNLGEVSGTASNMGGLVGVVDGSDATL
FT                   TFGYNAGKIPDNNFSGTVAGKVTSTATVTNVYYDKTVGGTCLVVASQMNMELPTGFTTD
FT                   EMKAATFIATLNGTGSAWKAGSATFGGYPAFTWTE"
FT   gene            7989..9104
FT                   /locus_tag="FSU_0007"
FT   CDS_pept        7989..9104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24998"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN87"
FT                   /protein_id="ADL24998.1"
FT                   /translation="MAKKKKFWKSPSAEAAFRGKEDRLRKTLCEIVNGQSRLLHRPDEL
FT                   YEAIANGLDDIEKIKDVKLQLELLAWTLRCDFLAFKADDEEMDTWNDLFYDAGTFFIEV
FT                   AKTYDDKDYIADLIHDLAVRHVGGEGREVVFLSIEDVMPVQRAKALIEELLGVIDATEL
FT                   ENREDVLDAICDMADAIKDTENFAKASLYKDPDKSNATLIDIANSYFVAGNISMAKQWL
FT                   GDVKDPGAEDEEAFLDLQAAIADREGRKTDCLKYATRLYECYPKVMNLSRLCMLKDDAG
FT                   VDKLLFDHIKYRDSGKCDTSLMMLLANLKKFELLESYVNHYERDLPGLEASELNAISDE
FT                   VERAGATELAKHIREWTVEEPEDAEPLDDRE"
FT   gene            9163..10770
FT                   /locus_tag="FSU_0008"
FT   CDS_pept        9163..10770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0008"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF08502; match to protein
FT                   family HMM TIGR00977"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25862"
FT                   /db_xref="GOA:C9RN88"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN88"
FT                   /protein_id="ADL25862.1"
FT                   /translation="MKVLLYDTTLRDGNQDRKISLSLADKVQIARILDHFGFDYIEGGW
FT                   PNPSNPTDEEFFKLIKDVKLKHAKIAAFGSTRRPGILPENDPLLQALIKSEAPVKTIFG
FT                   KSWDLHVTDVIRTTLEENLDMIESSVAYLKEHSEEVIYDAEHFFDGYKANPEYALETLK
FT                   AAELGHADCIVLCDTNGGTMPWEIEEIVKKVQTRISTPLGIHVHNDSGLAVANSIYAVK
FT                   AGCVMVQGVVNGYGERCGNANLTTIAADLKFKMDRDFAAAKKLSHLRQLSGNIDQIVNL
FT                   PSDVHAPYVGDAAFAHKGGAHIDGVMKVSRSFEHIDPHSVGNDRVFVTSDQAGGSLVVE
FT                   KLKAIKPGIDKKDPVVASLLKEIKERENAGWHFDSAEASFKLLVYRHLGMVKEPFKVLN
FT                   YRVIEDKTPQGVSVSQATVKLQVGDKISHQVSEGDGPVNALDAALRKALLPFFPCMGSV
FT                   RLDDFKVRVLGSNVASDATVRVWTTFGDEHGYWNMVGVSSNIIEACWTAFVDGLTYKIL
FT                   LEDNVIPNAYKHLDVASV"
FT   gene            10842..12131
FT                   /gene="hisD"
FT                   /locus_tag="FSU_0009"
FT   CDS_pept        10842..12131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="FSU_0009"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="identified by similarity to SP:O34651; match to
FT                   protein family HMM PF00815; match to protein family HMM
FT                   TIGR00069"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26164"
FT                   /db_xref="GOA:C9RN89"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN89"
FT                   /protein_id="ADL26164.1"
FT                   /translation="MKIVKVTPKSQEIDRICGREVAPSKEIHDKVMDILADIKNGGYAK
FT                   AVEYAQKFDGLKGKNLRVSEAEIKKSAAKCPPEMQRALKQAIKNVRDFHVNQMEDSWLM
FT                   EGKDGVVLGQRIRPMKRVGLYVPGGAGIYPSTVIMNAVPAIVAGVKDIVVVTPIKGEIN
FT                   RAVAFVLCELGITEVYHIGGAQAIGMLAYGAKDGKGKVVVERVDKIVGPGNVFAAVAKK
FT                   EVFGIVDIDMVAGPSEVLVLADNTCDPDFVAADLLSQAEHGSGFEAAICITDNMETAQM
FT                   ISECVDIQVENSPKRELLQKVLDNFGRILVVKDWFDGVAIANAIAPEHMEIMTDEAESM
FT                   AAQIENAGAVFIGPWSSEPVGDYFAGPNHVLPTNGTGRFFSPLGVYDFLKRMSIIKYSE
FT                   KAIKKNAKAIAVVANEEGFIHHAAAVLKRL"
FT   gene            complement(12251..12982)
FT                   /locus_tag="FSU_0010"
FT   CDS_pept        complement(12251..12982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0010"
FT                   /product="CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26787"
FT                   /db_xref="GOA:C9RN90"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN90"
FT                   /protein_id="ADL26787.1"
FT                   /translation="MNWIDIACAACLLVFGIIGLWRGLLSSVFRLCAWVAAILGAYFAQ
FT                   GLLGDFFIHNFAFSDFTAHLICTCIGFLVPFLLFSLIGHIVGDSIKNTIVGKTNRILGM
FT                   LFGIIKAVLVCFVLLTILHLLPVEGNLKNLRNNAIAYSVYKSSLKTMGYSSNEVDLRKL
FT                   ATEKASELTKSFTDKAINSTEQAADSAKAAVKNAADSVTTKVTETAEKAKDAAIAAKDA
FT                   AIKTFENGKSSASKDSSNTKR"
FT   gene            complement(12996..14045)
FT                   /locus_tag="FSU_0011"
FT   CDS_pept        complement(12996..14045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0011"
FT                   /product="putative protein kinase"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26703"
FT                   /db_xref="GOA:C9RN91"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN91"
FT                   /protein_id="ADL26703.1"
FT                   /translation="MEEVKATQSRKKVKDQLPSKIGGYKPIQALNSGAMGSLWLCRDPS
FT                   LDRLVVAKRLNTNLNQQDIYIKRFLQEGSILAHLNHPNILQPYALWKDSDGNYTMSMEY
FT                   IQGSSLKDLLLKNKRPPIWVVETILYELLSALSHAHRNGVTHRDLKPANMMIDKDGRVR
FT                   LLDFGIAHTDTPLEIGKELTQTGCIIGTAAYMSPEQIMGQKVNYASDIFSVGIIASEML
FT                   IGENLFRGKDFEETRENILKMKFKLEVFPDDVPKPLRKFVLKLLNKRPSKRPSSACDAA
FT                   NELADIMKEYPRDMTPYIAEWADTVNEDQPIESVISPKPQKTTFKYGIGFILGVIVTAM
FT                   VFLTIQLAV"
FT   gene            complement(14068..15648)
FT                   /gene="nadB"
FT                   /locus_tag="FSU_0012"
FT   CDS_pept        complement(14068..15648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="FSU_0012"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02910; match to protein family HMM PF03486;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR00551"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27310"
FT                   /db_xref="GOA:C9RN92"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN92"
FT                   /protein_id="ADL27310.1"
FT                   /translation="MYDILVLGAGISGLSAALHAAEKGFHVVILTKGAKPDGSSNYAQG
FT                   GICSVTEKTDKFEFHVADTLEAGAGLCKKDSVKILVKNGPTTIKQLVKWGVQFTPSPED
FT                   KSQFDLHLEGGHSHHRILHAADLTGKEIMRALLCELHKQKNIDYLENCYIKDLICEGEG
FT                   KNKRCVGAKIIHQKSGEVESIYAKATILSTGGAGRIWQYTVCPPDSCGDGMAIAARAGA
FT                   ALQDIEFMQFHPTSLYAPKFKKPFLISEAVRGFGGILKNDKGEEFMNQVHPLHSLAPRD
FT                   IVARAIHSEMQRLGKDHMFIDLSGRTPKDIKSHFPHIYSKCMDAGIDITKEWIPVVPAA
FT                   HYMCGGVLVDTWSRTEIKGLYACGEVAATGVHGANRLASNSLLESVVFAIRAVDDIEKS
FT                   GITKDKFTAPKSKKETVSFAKAAYWRKRKKMLQDMMWTHCGIVRTVAGLNQGLKVIESL
FT                   EADVAAAIKNKETENLHFLEFLNALQVSKMILIAALRRKESRGLHYILDYPNQDPKTKH
FT                   QSIYLSDKK"
FT   gene            15723..17738
FT                   /locus_tag="FSU_0013"
FT   CDS_pept        15723..17738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0013"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24974"
FT                   /db_xref="GOA:D9S491"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D9S491"
FT                   /protein_id="ADL24974.1"
FT                   /translation="MACNFNKIKCKHFFLLFFGRQNFNGVVSMLTWINEKAKWVIVIFA
FT                   AGIAIGLLAMDRVPDQGRSYPIGIVNDTKISYTDFDSRVKMIVQNQYQNQHLDDEQYSQ
FT                   LRAQVFSSFVRQALFAEQYEKAELSASVAELKNEFKRNSDAVRARLVQEAQARLYAIQQ
FT                   QATSQEDLIQRSQAYLASLPKFLTDTTFNKADYDAWIETPAAYRWSAMLSLEDEMKNNS
FT                   IPARQLQTLVGASVHPTSLEAKWSVERRMTDYELQVAVAPSSAFVVDSNSVDSVMVAGY
FT                   FNAHIDSFFVQKDAAQFQYVSIPVEATAGDDASIREYAMTLYYQLTDSSSTTTFEDMAR
FT                   VSSEDPGSAEKGGILSEDFVGRGSYVKPFEEAAFALDSGKISEPVRSQFGYHIIKSYGN
FT                   VKNAKGEVEKVKVGHILLTVTASSNTIDSLEKILTNIKKDVDAGSDLLTEAQARGLEVK
FT                   TSEWVSRDGNIGAFGYLKGLASFAWPNENLPKEESEISGVLRNNKWVVIAKKIGSFTAG
FT                   ERSLPLYYNDIKETLLKQKAGKAAEAYLSSVAAQVKEWNPADTAAKIEKVELETKNASV
FT                   DGFVPGFGYGNAQIARVVGKAKAGEWTAPVVAENGAVMVKVVSKKTPKVEEVEEAIKQD
FT                   VDNSYRFGVMTAFNDYVTSLEASTPVKSNLDLFYRD"
FT   gene            17848..17923
FT                   /locus_tag="FSU_0014"
FT   tRNA            17848..17923
FT                   /locus_tag="FSU_0014"
FT                   /product="tRNA-Glu"
FT   gene            complement(18166..19218)
FT                   /locus_tag="FSU_0015"
FT   CDS_pept        complement(18166..19218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24953"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN94"
FT                   /protein_id="ADL24953.1"
FT                   /translation="MNFKKMTSALLVAGMCSAAFAADGEFSLKGNVQTQATKMIADTDN
FT                   NLSSLWIRANIGGLYKSENFDAQVMLRIFAPQFGNKIKDGDGKTTSYDKILADLYWANY
FT                   KWNFDTYKLNLKIGHWKTDWSQSTHFGTYIDKDLTARGLWMRDYAHNALEFGWQTGYSN
FT                   FTAMLATRDNKANTGYIRIEEDLKFDFPLEAKLAYRVNAVDVVQNTASITHRLATYLSY
FT                   KPLDFLRVYGEYGFIVTNSEKVLTTAHNYVAPESKYMKPGDAYHPFYLGAEYSPKKDCI
FT                   MSTFMSSLYVEWEHINDRAALTGGKDIDNWAWTVAWAKKIANSKLQFSVYSGDEISDVG
FT                   FAFRLTSTIK"
FT   gene            19342..20040
FT                   /locus_tag="FSU_0016"
FT   CDS_pept        19342..20040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0016"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25786"
FT                   /db_xref="GOA:C9RN95"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN95"
FT                   /protein_id="ADL25786.1"
FT                   /translation="MRMISRIAFSAIVAVSFASAGKLAPNKTHAVLNVTYTNEENVPHA
FT                   KKKLTFVGQNKGKKVVITTDVYGEASFHIPREDSYTILCESLTGPFECGETPYVSRTAS
FT                   TGGISVVFDDTRSELTGVTFKAGSAELVPSSLKTLNAAIAGLKRNPKAKIEVEGHTSSD
FT                   GSAELNQQLSEDRANSVRNYMIEQGIDADRVTAVGYGPSRPKGDNSTEAGRRANRRIEL
FT                   KVLNADEVNF"
FT   gene            complement(20376..21209)
FT                   /locus_tag="FSU_0017"
FT   CDS_pept        complement(20376..21209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN70136.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26615"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN96"
FT                   /protein_id="ADL26615.1"
FT                   /translation="MELGRINRARVESITPQGYYLELETGGSVLLPGNRNKFTLVEGEI
FT                   IDVFVYTDSEDRPIATLDKPLAQVGEFAVLTVKEVNRVGAFLDWGLNKDLFLPFKQQLG
FT                   ELQKGDRCVVFVLEDEKSGRIIATEKIKSFIDPDTNDLHIGQRVELAAYEVTPDYVDCL
FT                   VDYRYTGRLMMTPGMERIYIGDTMPGFIQRFTSDGKITLNLTPIGYKGVMKSESPNAVM
FT                   QKLEAAGGFLPYGDHTDPETIRREFGMSKKTFKKIIGTLFREEKIVITEDGIRAV"
FT   gene            complement(21284..21820)
FT                   /locus_tag="FSU_0018"
FT   CDS_pept        complement(21284..21820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26601"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN97"
FT                   /protein_id="ADL26601.1"
FT                   /translation="MFHPIRHFITITKHRNEVIRLCIKAGIGLQGLFHDLSKYSPTEFI
FT                   PGAKYYTGKESPNNGERRETGYSLAWMHHKGRNKHHFEFWYDYDMKTKKIVPMDMPDRY
FT                   IKEMFCDRVAASKTYNKKSYTQEAPLLYLTKSTAHEKMTETTYKKLLFLLKKLAKDGEK
FT                   ETLRFMRHCKELPTE"
FT   gene            complement(21859..22677)
FT                   /locus_tag="FSU_0019"
FT   CDS_pept        complement(21859..22677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0019"
FT                   /product="ADP-ribosylglycohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF03747"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25983"
FT                   /db_xref="GOA:C9RN98"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN98"
FT                   /protein_id="ADL25983.1"
FT                   /translation="MIGAIIGDTVGSIYEFENYKAKDFELFPDGVSPTDDSILSFATAD
FT                   WIMRGGEAWKYYVAYASKYECPVGGYGGGFTRYVAKARRDGFGTPYDSCGNGSAMRISP
FT                   VGWAFNTKEEVLAKAKESAECTHNHPEGIKGAQATALAIFMARMGASKDEIKTTIESEF
FT                   GYDLNFTIDELRPEYSWSYPGAALCQGTVPQAIRCVLEATDYEDAIRNAVSLGGDSDTL
FT                   ACIAGGIAEAVFGVPQKIYKVGMNILKYYFPEPHKLVTEFEKKYGNRIFQ"
FT   gene            22791..23870
FT                   /locus_tag="FSU_0020"
FT   CDS_pept        22791..23870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03382;
FT                   match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24961"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C9RN99"
FT                   /protein_id="ADL24961.1"
FT                   /translation="MSGKVVVYSKQHLQRIIEKIIKEKGPKCDLNFIDVSRMTDMSGLF
FT                   DHSCFDGDISQWDVSNVKNMNHMFYDSAFTGDISSWDVSNVTDMNYMFFGSNFNGDISR
FT                   WNVSNVTNMNTMFSACSFTGDISGWDVSSVTDMDSLFAYSRFNGDISKWDVSNVRNMHS
FT                   MFETSIFMGDISHWNVSNVTNMSSMFCRADFNGDISQWDVSNVTDMSHMFSGFWVNDDV
FT                   SHFNGDISGWNVSNVKNMSYMFYYSLFTGDISRWNVSNVTDMRGMFCGSAFSGDISKWN
FT                   ISNVIRMTAMFVKSQFRGDITRWDASKVINMRNMFEESALEKENCLPTWYAERGARRSL
FT                   DYSRPSYCTCCNFDFSRMF"
FT   gene            24058..24612
FT                   /locus_tag="FSU_0021"
FT   CDS_pept        24058..24612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0021"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25555"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA0"
FT                   /protein_id="ADL25555.1"
FT                   /translation="MAEILEKMVSGIGALSKSLAIGIFGILGCSEDSSECVPQTEIVEQ
FT                   SLEMHRDSAQQVFHEDMLSMTLHKPGVCFKNLRPEMDSAISVVVSVYHIASNDEEYKPL
FT                   ITSANDYEGHSAGSAHYAGAALDFRIKNMGSLEKRQEIAQMVRVFLGKRYLVLHEDVGL
FT                   ENEHLHVQMRNGTYNRNVEWD"
FT   gene            complement(24684..26279)
FT                   /locus_tag="FSU_0022"
FT   CDS_pept        complement(24684..26279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0022"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26329"
FT                   /db_xref="GOA:C9RNA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA1"
FT                   /protein_id="ADL26329.1"
FT                   /translation="MLNVSNVSLQYGSRVLFKEVNLSFKRGNCYGVIGANGAGKSTFLK
FT                   ILSGELEPNTGEVTKDPGERIAVLKQDHFAYENNTVLETVMMGFPELYELGKKRDELYA
FT                   LPEMTEEQGMQAMEIETRFGEIGGYEADSNAAVLLKGLGIPEEFHYNLMSELDGGQKIR
FT                   VLLAQALFGNPDILLLDEPTNHLDLETVGWLEDYLERFENIVIVVSHDRHFLNAVCTHT
FT                   CDIDYGKINIYGGNYEFWYAASQLAQKQRKDQNRRAEEKIEELKAFIRRFASNAAKAKQ
FT                   ATSRKKLLDKMTVEEMPASSRKFPWVNFKMDREPGKIVLEVKNATVDGGDGIVCKGFDF
FT                   SLGNQDKVALVGEYDTLKTAFFQLIAEEIKAPDGVLKWGNTISYNYFPKNNDAYFKTDL
FT                   SLVDWLRQYSKEQDETFIRGFLGRMLFTGEEALKSANVLSGGEKVRCMLSKMMLSNANC
FT                   LLLDEPTAHLDLEAITALNNGLKAFQGPVIFCSQDHEFVQTVANRVLELTPNGVVDRSI
FT                   TFDEWLETKKTKKK"
FT   gene            26948..27127
FT                   /locus_tag="FSU_0023"
FT   CDS_pept        26948..27127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26829"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4A0"
FT                   /protein_id="ADL26829.1"
FT                   /translation="MWEDEKALVTSGERDPDKKEDYSYIGHYLNMKGNYKTVACGIALT
FT                   EDGKKGWLNINFFR"
FT   gene            27202..28698
FT                   /locus_tag="FSU_0024"
FT   CDS_pept        27202..28698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0024"
FT                   /product="putative amino acid ABC transporter,
FT                   permease/amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24880"
FT                   /db_xref="GOA:C9RNA3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA3"
FT                   /protein_id="ADL24880.1"
FT                   /translation="MIRKLYLPLLIALFSLALTSCQSEKQTVIPNRVHSISDLGHKKVG
FT                   VQIGNTADIYASDFGGDTAKIDVERYTKLADAVQALLQGKIDAVMSDDQPAKAFVLQNP
FT                   SLRILEEVFVEEMYAGVVAKGNEALLDSVNQALEAMKKDGVYDSLFNTYIYRSGNYHYQ
FT                   KKVTEGPKLVVSTNAQFPPYEYYENTKIVGLDIEIVNYIADYLNRTVEIQDIEFDAIIN
FT                   AVASGKADVGFSGFTVTEERKKSINFTTPYTLSKVVVIVRGDQAVESEESFGDHVYKNF
FT                   VKDSRWKFIVEGLRNTLVISFFAALLGIMIGFVIAQIRTSNEFNGRFKVLNWFAKAYLA
FT                   VIRGTPMMIQLLIIYYIVFSSVNINKILVAIVAFGINSGAYVSEIIRSGIKGVDPGQIE
FT                   AGRSLGLKFRTVLYYIVYPQAFKNSLPALTNEFISLIKETSICGYIGLTDLTRGGDIIR
FT                   SMTYEAMLPLLAVAAIYFIIVAGLSACVAKLEKRLKKNER"
FT   gene            28688..29434
FT                   /locus_tag="FSU_0025"
FT   CDS_pept        28688..29434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0025"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P10346; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26441"
FT                   /db_xref="GOA:C9RNA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA4"
FT                   /protein_id="ADL26441.1"
FT                   /translation="MNANAETLIQVKNLCKSYGDKQILKGISLDIHRGDVIAIIGPSGC
FT                   GKSTFLRQLNLLEQPTSGDILLDGKSILAKDVSKPSIRERVGMVFQQFNLFKNMTALKN
FT                   IMFAPVKLGRLSKAEAETRARELLKRVGLLDRADHYPAQLSGGQQQRIAIARAMAMQPE
FT                   AILFDEPTSALDPEMVGEVLKIMKDLAKSGMTMIVVTHEMSFAREVANRVLFFADGYVK
FT                   EDGNPEEVFDNPKDTRLKEFLSALKK"
FT   gene            complement(29563..29940)
FT                   /locus_tag="FSU_0026"
FT   CDS_pept        complement(29563..29940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0026"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26103"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA5"
FT                   /protein_id="ADL26103.1"
FT                   /translation="MKTKLILSALLLSSFTFFGCNNEKPNYTGYWKGEADMIFEVLTEN
FT                   NVDYTIRNVNGDLTAKYENNALRGKNSLNMDILMRVKGDSAYYEFGEDESGKIVTGYMR
FT                   ISKDEYDKIFKAQSEAKNSYN"
FT   gene            complement(30008..31234)
FT                   /locus_tag="FSU_0027"
FT   CDS_pept        complement(30008..31234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27037"
FT                   /db_xref="GOA:C9RNA6"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA6"
FT                   /protein_id="ADL27037.1"
FT                   /translation="MANNEKNSTKNAQNAQGNQKKKNGKRNLVILILMFLLLICLFVVQ
FT                   CQLNKVKQQALEEQKLSELALRQQQILDSLRAEQAKADSLKALEEARIADSLRIADSIR
FT                   TADSLANLPKVPAVNKDSIRAYRKFRRDSLARVNDSLARIERDRQDSLNKARFADSLRN
FT                   SDKVPPTAEITPPAGRYYDPIKLKVKCDEIKCKTFVSIGDTLNPQDASKGIEYNKTGSV
FT                   FFYATDSVGNRSAWEEAKYDMASDNICGKNAYPVPVGGKTVCVDAYEYPNQPDATPKDM
FT                   VSQEEAARICKNEGKHLCTIEEWQAACRGKDGFKFSYGNGYKQSKCNTNTKAAKRSGRK
FT                   AQCRSWYGMYDMNGNLWEWTASTSKQHPDKFLVAGGAWNTNNESSCSVSKFSFYPQNQY
FT                   PSVGFRCCK"
FT   gene            complement(31238..32086)
FT                   /locus_tag="FSU_0028"
FT   CDS_pept        complement(31238..32086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0028"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /note="identified by similarity to GB:AAO37009.1; match to
FT                   protein family HMM PF02457; match to protein family HMM
FT                   TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27076"
FT                   /db_xref="GOA:C9RNA7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA7"
FT                   /protein_id="ADL27076.1"
FT                   /translation="MTLFKLFGIIDVRMADILDVLLISVILYYIFLLFRGTRAAQMIFG
FT                   GFLLILAWLIAQWWELHTLVWMLSNLATLGIIAIVILFQPEIRSALTRIGQSVSKVDLR
FT                   NILFHASGLDDIAQKICTAVQDLAKTKTGALIVLEKRVGLKNYADTGEYLDARISSRLL
FT                   RALFFPNSALHDGAVILNCKSIVAAGCILPMPTGNAEGDAGYGMRHRAAKALAAESDAL
FT                   IIIVSEETGKISTAYRNNLRRGLTPKELKAEIFRHWHDLFNEVIEEDQAEGENEAVENK
FT                   V"
FT   gene            complement(32073..32987)
FT                   /gene="folP"
FT                   /locus_tag="FSU_0029"
FT   CDS_pept        complement(32073..32987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="FSU_0029"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26767"
FT                   /db_xref="GOA:C9RNA8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNA8"
FT                   /protein_id="ADL26767.1"
FT                   /translation="MLRSLLESNRAISWKIGNDIIPASRMPLVMGIVNVTPDSFFDGGK
FT                   HNTPEAAYEHAISLVEQGAVILDIGGESSRPGSAPVSLQEELDRVCPVVEALAQTATIS
FT                   EDLDNPGFRKFYISVDTVKAKVAEECMKLGAHIINDISACMMDPKMIETVASTKASVVL
FT                   NHMRGNFGTMQQDFKPYTNVVQEVQEELLAQVKKLLDAGVEKERICIDPGIGFGKTVQD
FT                   NIDLMKSVDVMLKDGYPVLIGTSRKSYIGKMPGLETSDRLIPTVTADIIAALGGASVIR
FT                   VHDVREAKESLLYLEALKSHDAV"
FT   gene            complement(32997..35027)
FT                   /gene="ftsH"
FT                   /locus_tag="FSU_0030"
FT   CDS_pept        complement(32997..35027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="FSU_0030"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to SP:P28691; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF01434; match to protein family HMM PF06480; match to
FT                   protein family HMM PF07728; match to protein family HMM
FT                   TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26591"
FT                   /db_xref="GOA:D9S4A7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4A7"
FT                   /protein_id="ADL26591.1"
FT                   /translation="MLLMLFVMFPMTGKDSSKDITRTEFLAMMGDSTKIITELTLQKTP
FT                   DGVIIEGAYEMSPEEIAEAKKSQSALARFTRNSTDTKNKHFKSHMLDISNEQISTWEAF
FT                   KGVKVKVIHESTTWIDTLVAFLPAILLIAFFYIMMSRQMGGGGKSPFSFGKSQVRQLNS
FT                   QKKTTFNDVAGCDEAKQDLQELVEFLKDPKKYDKLGGRIPKGALLVGPPGTGKTLLARA
FT                   VAGEAGVPFFSMSGSDFVEMFVGVGASRVRDLFETGKKNAPCILFIDEIDAVGRQRGAG
FT                   LGGGHDEREQTLNQLLVEMDGFTANEGVILIAATNRPDVLDKALLRPGRFDRQIVVGLP
FT                   DLKGREEILKVHLKKRKVPLGDDVDVKAVAKGTPGLAGADLENLVNEAALLAARFNNKK
FT                   VTMLDFEEARDKLSMGAERRTLLMTDEEKRHTAYHEAGHALMTLLCKHSDPLHKITIIP
FT                   RGRALGVTMSLPERDQVSYSREYAEERIMIMMSGRLAELIFFNHQSTGASNDIQRATEL
FT                   ARKMVTEWGFDEEIGPVCYSRADGEVFLGREISKPKEMSEMMAEKIDNAINNLIKRMDN
FT                   KARELLEENKDKLTDLAEALFEFEVLDREEIDKVMAGEKLTGTKKSRQYKAMEELAKKR
FT                   EEENTPPPDPGDQPPVAPIADVQPAPAAGNETATNSVKGNE"
FT   gene            complement(35074..36255)
FT                   /gene="tilS"
FT                   /locus_tag="FSU_0031"
FT   CDS_pept        complement(35074..36255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="FSU_0031"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by similarity to SP:P52097; match to
FT                   protein family HMM PF01171; match to protein family HMM
FT                   TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27386"
FT                   /db_xref="GOA:C9RNB0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB0"
FT                   /protein_id="ADL27386.1"
FT                   /translation="MSLNLVENIRHHGFKRLLLAVSGGLDSICLAHYFIENSAALGIEW
FT                   LGIAHVHHGLREGTADRDAKFVEEFAKSHDVPFFLKKLDGEALKNAEGSLEENARDARY
FT                   KALVEIALNKKWRSRNGVRDDIEEGGVTIAIVTAHHAGDQAETMYMRLKRGTTLAGLRG
FT                   IQEVRIIQDDTSLVSRLSSLVFLYRPFLNVTRKELLTYARENGLSWCEDESNADVKFAR
FT                   NKIRHEFLPNLERECPGAIQQLCKIAGLADRAYAKVMAKCSRSFGFAQDDTRGFPLTSA
FT                   SPQDDASLVSRLSSFVSLDKKKLNKILREYADADLSEMFRLWLTEKGFRFPIGFFYGPK
FT                   EPAHVKIPVRAVYRRRSVVKIAHTVWICEFKDALSAAKFVSCEKKEKDYNEST"
FT   gene            complement(36364..37380)
FT                   /locus_tag="FSU_0032"
FT   CDS_pept        complement(36364..37380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0032"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24920"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB1"
FT                   /protein_id="ADL24920.1"
FT                   /translation="MKKAYAVLFGMFMFVACSDDNPTSGLNNTQNTNPSAQTNVDFGEG
FT                   YTYVIPIKYDETTGRVYQGTYVCNYHPDTKTFAWEEYPESLDPGSYKIVGDSLWMGPAE
FT                   KQVSDNPDEQEFLDLYRNYETLSLSNDHNDIYGTWKVTGCKRQLGETDIKCSKFIGGMS
FT                   GIARTMKITKDSVYITTTVDTENLEQNDINIGAILDRNFGYDIGDAIIKQLLVEKTITK
FT                   EPKELLKQSFSIGNQLFEVVSAPKFDASGMNYITTMSSNGKTCTNTQRLGFINEKLCKE
FT                   ESAEFLLSDRDKSEEQFYYEEGPVEGFKIDNNNEFYECTKGLPTEETKQLLSQYAKN"
FT   gene            complement(37646..38509)
FT                   /locus_tag="FSU_0033"
FT   CDS_pept        complement(37646..38509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0033"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAE12748.1; match to
FT                   protein family HMM PF08843"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25478"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB3"
FT                   /protein_id="ADL25478.1"
FT                   /translation="MASVIESMLTKYNCKNISDYRNALKEIAQEVALCGLSRGGFFEKA
FT                   AFYGGTALRIFYGLDRFSEDMDFSLIQVDEKFELPHYFDILEQELQAVGLEMIVESKIK
FT                   SLDSQVQSAFLKGNTLKHLLKIMPTKHSPLPIPSNEILKIKFEVDTNPPELATFENKYR
FT                   LLPSPFAVKLYDKPSLFAGKLHALLCRGWKNRVKGRDFYDFVWYVSQNTSVNLPHLQRR
FT                   MEQTGHWNSTEILTTAKLKILLKERFHAVDFNEAKRDVQPFIADSSKLALWSTDFFCAL
FT                   TDEWKG"
FT   gene            complement(38512..39087)
FT                   /locus_tag="FSU_0034"
FT   CDS_pept        complement(38512..39087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25426"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB4"
FT                   /protein_id="ADL25426.1"
FT                   /translation="MIRTASEILSTLSQEYKQPQMKLRQMTLHGEIFKIIRGLYETDRN
FT                   TPGEVLAGAIYGPSYLSFEYALSRHGLIPERVNLYTSASFQKNKNKLYQTPFGEFSYSD
FT                   IPTEVFPNGVNIENIEDRPYAMATCEKALCDRLYKESPITSKRAMESFLFENLRIENED
FT                   FNNLDFNFIHKIALLYKKKNLYILSKMR"
FT   gene            complement(39165..39317)
FT                   /locus_tag="FSU_0035"
FT   CDS_pept        complement(39165..39317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24611"
FT                   /db_xref="GOA:C9RNB5"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB5"
FT                   /protein_id="ADL24611.1"
FT                   /translation="MLTTFLIIFAILAILGLGGVGDACAITLLLQILPFLIIVGIVCCL
FT                   WFCGG"
FT   gene            complement(39380..39934)
FT                   /locus_tag="FSU_0036"
FT   CDS_pept        complement(39380..39934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25129"
FT                   /db_xref="GOA:C9RNB6"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB6"
FT                   /protein_id="ADL25129.1"
FT                   /translation="MIKRIFAFLIIAAALGFGQATASEDNGQTHFYKDSVQAIQHAEFT
FT                   QVDFDGYYQNLIQSEKDMVSRATTTSIISGITLGFGVFTTIVAFSDNGNIDKNSWAEVH
FT                   RQTLQIAGVGLIVAGSIGLAFSLHDIICGTGENSKRASYERAYDIYKRRRTELKDGSKI
FT                   IVTPTVDPLAAAAGLKMDVAF"
FT   gene            complement(39931..40047)
FT                   /locus_tag="FSU_0037"
FT   CDS_pept        complement(39931..40047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26465"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4B4"
FT                   /protein_id="ADL26465.1"
FT                   /translation="MLNTTSKKKQASDKIANKLYKADRIQAVCFCILFKEKI"
FT   gene            complement(40028..41236)
FT                   /gene="metK"
FT                   /locus_tag="FSU_0038"
FT   CDS_pept        complement(40028..41236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="FSU_0038"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by similarity to SP:P54419; match to
FT                   protein family HMM PF00438; match to protein family HMM
FT                   PF02772; match to protein family HMM PF02773; match to
FT                   protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25651"
FT                   /db_xref="GOA:C9RNB7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB7"
FT                   /protein_id="ADL25651.1"
FT                   /translation="MAHYLFTSESVSKGHPDKVADQISDSILDACLAQDPKSRVACETL
FT                   VNTGLVVISGEITTKAVVDFQEVARNTIKNIGYVNPDLQFDYKGCAVLVAMDKQSPDIA
FT                   QGVDAKAAEGKKDDQQGAGDQGMMFGYAVKETKELMPLPISLAHKLMEEIQNLREKGKI
FT                   KWLRPDAKSQVTVEYDENDKPVRVDTVVISTQHDEKVNGKELKHSQIEKEIIEKLIKKV
FT                   IPAKLLDKKTRYLVNPTGKFVVGGPHGDCGLTGRKIIVDTYGGMGRHGGGAFSGKDPSK
FT                   VDRSAAYAARYVAKNIVAAGLAYRCEVQLAYAIGYSKPVSVLVNTFGTGKIDDRKIEEI
FT                   VAQNFDLSPAGIEKMLDLRKPGYVATAALGHFGRTGARFTWEKTDKAEALKKAAEIVAE
FT                   YDF"
FT   gene            41472..42236
FT                   /locus_tag="FSU_0039"
FT   CDS_pept        41472..42236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0039"
FT                   /product="conserved hypothetical protein TIGR00486"
FT                   /note="identified by similarity to GB:AAM77721.1; match to
FT                   protein family HMM PF01784; match to protein family HMM
FT                   TIGR00486"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26930"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB8"
FT                   /protein_id="ADL26930.1"
FT                   /translation="MDLPFMTAWLDDLLDPKSFNDYCVNGLCVEANDKVTRIVTGVSLR
FT                   DQLIDAAIEEKADCIIVHHPNGFWKGESQLPVGKFAERLRKLMNNGISVFGFHLPLDGH
FT                   REIGNNAVIAKLLGLNPVHEFVHVGMRAIGVIAEWNTPATREEFVDCLDAAFVHGVQNK
FT                   FFHGPEEIKRVAICSGSCSASDIKEALEMNCDAYVTGSIKEDIPIFCQENGVNLASCGH
FT                   HRTEIFGVSALAEKIQAELSIPSRFIDLDNPI"
FT   gene            42412..43332
FT                   /locus_tag="FSU_0040"
FT   CDS_pept        42412..43332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0040"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24718"
FT                   /db_xref="GOA:C9RNB9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNB9"
FT                   /protein_id="ADL24718.1"
FT                   /translation="MNFVKASIRFQKSSRALTVKVPSFVLRGSLFVRIVVVVGFILFLV
FT                   QVLSTSVYDGVLNHAFSSRQKLNKELSQIQNTVDYISSTSMDFFKAEKMLHAKLGLPLP
FT                   DEASRKLSTGGHIEPNVQLLRKSSPVFERTAKMHEDVWRIFGQIQNNEESFNSLTKYID
FT                   QSRSVLRYIPSISPTNGRYASAFGPRIHPVTGEIGKMHQGIDISNDRWTPIYAPADGVV
FT                   EISQLSSSFGNFVVLNHGNGLKTRYGHMQMSAVTPGEFVHRYQILGYMGNTGRSVGPHL
FT                   HYEVWKNGVPVNPLPYILPNDYEVD"
FT   gene            43383..44591
FT                   /locus_tag="FSU_0041"
FT   CDS_pept        43383..44591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26789"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNC0"
FT                   /protein_id="ADL26789.1"
FT                   /translation="MNNYGVVPAMCLALFSWAFACPVFTEFYPDPKDVSDQEGEYVEIR
FT                   MDDFRAESLYVQFESKSVMAFVWPEAERFVLVHDSAQCLAREAAQDAPQAGVACGSLGK
FT                   ISLPNSRESVWKLWAGSCMDSVTVMQPKPGKVIQRVGLTDNWEFVEASKAVLESQEASD
FT                   SLLEGVMAGLSPLRVTEVHHCPEEPMPEWVELYNSSEYPLPLEVFRFCDRGGALGKAGD
FT                   SIQPYQAVLVSKDTSTLRAALNIPDIRMIQVSLGFLNNTEGTLRLCFRDETIDSVYWNK
FT                   GTVSCPSGFNPLTMRREFTPGYLPKNVRNVSLAAKVPVEYKLSSRVVSKKGAPLRVIVE
FT                   SEYNVALSLLDSAGRRVWKTIVSAMSNEWVKVPAQEYLGIGAAFVSLSVGEYEDVVGIL
FT                   VRP"
FT   gene            44563..45354
FT                   /locus_tag="FSU_0042"
FT   CDS_pept        44563..45354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25846"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNC1"
FT                   /protein_id="ADL25846.1"
FT                   /translation="MWSVFLFARNVFCACLSARLCSGLILLLGLLMVPRALAIEGHASF
FT                   ASLLAGGLSPVGLGGYHSTPARYAVPSYGVSYYWMDDVEESSWNLSLEFGNGAYRVGAF
FT                   IAYESMDSLYRNLYSETSLAKTWPHFALGMSYGLNMEWIPGDALWTRHRFKWAGIFKWH
FT                   EVHFAGMLSGFMDEGVSPAVGVHWLSDEAVSAFAESDFDYLYVGASFRWKMVELCSSYR
FT                   FPDFAVALQISFSGAHYGVSYARGFKHNSIGWNGVHLRKII"
FT   gene            45364..46020
FT                   /locus_tag="FSU_0043"
FT   CDS_pept        45364..46020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0043"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25267"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNC2"
FT                   /protein_id="ADL25267.1"
FT                   /translation="MKRIVLLLLALSVFCVAKPADESTDAQALSEEESLRDSTITVYIH
FT                   PLNFMVPYSHFWGGLNVPNGITDYPQFYLTLEWKLMEKISLVTAPHYVRVDRTEDDNDG
FT                   YKIYDIGLQESFRLYGVGGKRWRYFQAGMIVDHLNIDTEKHGDFNGWLWGFMLNGGVKK
FT                   VLNDGEGFFGRFAVSLDAGFGYVWTSKFEADRKNAFFKMDKGLVIDINAAIGFQI"
FT   gene            complement(46140..46220)
FT                   /locus_tag="FSU_0044"
FT   tRNA            complement(46140..46220)
FT                   /locus_tag="FSU_0044"
FT                   /product="tRNA-Asp"
FT   gene            complement(46241..46320)
FT                   /locus_tag="FSU_0045"
FT   tRNA            complement(46241..46320)
FT                   /locus_tag="FSU_0045"
FT                   /product="tRNA-Val"
FT   gene            complement(46704..46784)
FT                   /locus_tag="FSU_0046"
FT   tRNA            complement(46704..46784)
FT                   /locus_tag="FSU_0046"
FT                   /product="tRNA-Asp"
FT   gene            complement(46955..49231)
FT                   /pseudo
FT                   /locus_tag="FSU_0047"
FT                   /note="HDIG domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01966; match to
FT                   protein family HMM TIGR00277"
FT   gene            complement(49243..50235)
FT                   /locus_tag="FSU_0048"
FT   CDS_pept        complement(49243..50235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0048"
FT                   /product="phoH family protein"
FT                   /note="identified by similarity to SP:P46343; match to
FT                   protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26323"
FT                   /db_xref="GOA:D9S4C1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4C1"
FT                   /protein_id="ADL26323.1"
FT                   /translation="MVSRFSNLLQMKSSIRHYSLSDNLKRVISGERETVFRLLESRFCV
FT                   EIRTRLPGLDLIPQEGADLSGLLAVLDQLKIAARNGEILDATQLERMLGPKEASEASYT
FT                   ELIPDSPVFRNRFGISVSAKTPAQAELVKAVEKNDIIFAKGPAGTGKTFLAVTLAVASL
FT                   ERGEAERICLVRPAVEAGESLGYLPGDLKEKIAPYLRPIHDSLSELLPAEKLKRYEETG
FT                   AIEVAPLAYMRGRTLKRAFIILDEAQNTTIAQMKMFLTRLGPHSKAIITGDTSQIDLAK
FT                   GQTSGLEHAMKILQGIRGIAEVEFSATDVLRHHLVKDILLAYEQNEQKK"
FT   gene            complement(50195..50551)
FT                   /locus_tag="FSU_0049"
FT   CDS_pept        complement(50195..50551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0049"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25144"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNC6"
FT                   /protein_id="ADL25144.1"
FT                   /translation="MSLKKWKLVLASVSVALFTACAGSSNSGSSDTGYTGSNESTSESS
FT                   SYTGYSENQAEAAKPAAPAKKEPPKEVINEKTLKKTQDEAVAANEDNHKLRKEIFEART
FT                   KLGLPIQQPSTDEE"
FT   gene            50634..52009
FT                   /pseudo
FT                   /locus_tag="FSU_0050"
FT                   /note="putative xaa-pro aminopeptidase, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P15034"
FT   gene            52060..55485
FT                   /locus_tag="FSU_0051"
FT   CDS_pept        52060..55485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0051"
FT                   /product="acyltransferase/AMP-binding enzyme"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF01553; match to protein
FT                   family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26947"
FT                   /db_xref="GOA:C9RNC8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNC8"
FT                   /protein_id="ADL26947.1"
FT                   /translation="MWKVKGSIRFFLSILATAFVQAGVFIYAQKILSGSFFAKDGIIWQ
FT                   NFMLQIFFLAPYVLMVFFAGFFTNKFSKNKVMAWSSLMMTLFVIAQSVLVTVDFPRIAF
FT                   WLSIGLSCGFAIHSAAKYAILKEMFGVRNLSYANAFLQIFSISGIIAASWLAIVGVNLI
FT                   NLDQLVSYEAVRRITEKSVVIPWILTAVSVLGTVANFMIPRVKFEDLNVSVDKVKRHLS
FT                   LGFRVPTLRASIIALSMFWALAQVFVLIYQDVSGSSTVNMMQDYMSFAIVGLMVGTIVA
FT                   AHFSKDFIESGFVPLGMFGASICMFLVPFLVHPVALVLLYSLTGFFGGLILVPVNALLQ
FT                   YNTRPNNSGSVIALANLIQAVVLVAFLFVFTMMVRNTDVRPQNYFIGLAVISVGVFVWS
FT                   ISNLPQAMLRTLLRFVFSRYRIRVLNVQNIPNEGPILLVGNHHSFIDWAMVQMASPRPL
FT                   CIASNKDHFDKWYLRAVLKRLGMIRIDNRNPKVAMDKIHAALLAGKAVVIFPSGEVSKS
FT                   PHVEPFTIDYSSAVDGTKAQVIPFYIQGLWGSNYSYSSSNMFGASAERSVTVAFGEALP
FT                   ANTPPNEIRAIIRRISIDAWNYAVSFVHPIADSWIRTYKKYVKNGPAIYSPDGAHFSGY
FT                   KLMGAVMAFRGYLKKTLGKNEQNVGIMLPPSPAGVIVNLALWVIGKTNVNLNYTSSVEN
FT                   VKFCCNRAECSTVITSRQFVQKLKGRGNDYSQIASDKVRLLYAEDIMKEIPKAKIAAFL
FT                   VLCILMPSWLIRLVFVKHRNMDDNAVIVFSSGSEGTPKGVELTQRNLMGNIQQLACILN
FT                   VSRGDVMLSELPLFHSFGLTVTTLLNLTEGCPIVAVADPTDVKTMSRVCAEFQVTFLVA
FT                   TPTFLRAFTVSRYVHPLMFKSVRIIIAGAEALRPELATAFRLKFGKEIYEGYGCTETAP
FT                   VASVNTENTLFDDYTTLQVNNKPGTVGPALPGTQFLIVDPETNEPLPTGEAGMILIGGC
FT                   QVMKGYLKDEDRTKSVIVQKDGIRYYRTGDKGYLDEDGFLTIVDRYSRFAKLGGEMISL
FT                   GAVEKKIQDTPVLQGCDYVVTAIPDATKGEKIVLLYQGEKDPKDVLSELRASGMPPLML
FT                   PSAAFNVDVMPKLGSGKADFVTAKKMAKELVEKK"
FT   gene            55604..56521
FT                   /locus_tag="FSU_0052"
FT   CDS_pept        55604..56521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27232"
FT                   /db_xref="GOA:C9RNC9"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNC9"
FT                   /protein_id="ADL27232.1"
FT                   /translation="MKSLTPVRTARLVASLIAILGMFFFAAERVLAKVCVMAKDGVQMG
FT                   LNRYSNSFTGRFAAENFSDDKKLLDVLRQANELFPIAEKVSLALFIICLILFIVAAFGI
FT                   AFPKQFCHVLVAMKLLKWQDGIVLQDMKLSGTPSEGPSVSDKLKELCGKIAAAAKKVQP
FT                   KYWIFIGCSLVFVLVLVFGVRGCSAPSVFGGSQAVTDDLNGQTLYYIQAQKSFFAKTNK
FT                   VGGPKSLQMPDSLVSDYFTYRITGGKFTATLNKNVKDCPAGTRWSVSAATKGIFTLDLV
FT                   LYRSAPKDTNCVFISPDFKNLGRK"
FT   gene            56624..58957
FT                   /locus_tag="FSU_0053"
FT   CDS_pept        56624..58957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25827"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND0"
FT                   /protein_id="ADL25827.1"
FT                   /translation="MGGGMKFTQIVCAMAVASFADVTWVPQCEDNGFTLIRSSEHFEVC
FT                   KKPKTDDGAANNVSISTSDAEGVLQSLEKVYSFYIDSLGWMLPFPKSSDKKLKSNIYVF
FT                   ETLPSLYGGQDYVKALNGEYGPGMWIGVASLKDYWGTSHEFAHGLQGVAGWLGNNSHSG
FT                   WMAESHANWMAHQYNPNDAHCSEYLINFPYLYYGSTRDRYCNWQFLEHLKEEFGGGNKG
FT                   AHEVNRIWMESIRDGEDGRMEQTPFSAMMMVYGWTLEQLNDQFGKFAMKNATVEYAPAK
FT                   KTLYKKSWGDYEFATRRTHDGWGDLYRRHSRVTMLNKMKCESSENSDGNVAAEKCADRY
FT                   ISPIYWAPQRWGYNLVRIYPDSAGKVTVKFRGIVQEKPTVNGYTCFGDNTDYYKGKTYK
FT                   WCNYAPDKLPDPASGWTVGLVAEGADGTPRYSEMKHGSGFNLEIETKANDKALWLAVTA
FT                   TPTEMQTILWDQFYYSIYRYPYMIEVVNGEPEGYTKDFWKPAGFNGTTASGYAQHSNGG
FT                   GWVSSKAKVAATAYVGPDAVVNGGTVSGNARIEDFAVVNGGTISGNAVVRGRALVTAGS
FT                   IGDDAVLEDDAWLVSGTISGKAKVGALSIIVNSTVTDNAQVYGVMWAVSGKKLSGTAQL
FT                   RGDLENNFDKEITKGVFYGMVNTDMLTNAKFGASLTTPPTDATASIEKAKWYAIADDST
FT                   QTDPGPTGIVSRVAALQLSGVNENFDVFDLNGKHLGFAKVTPSEWNALGHKSLQKTLSA
FT                   SGFNAGMYIVRAKRSHRLVRVNVR"
FT   gene            59055..60080
FT                   /locus_tag="FSU_0054"
FT   CDS_pept        59055..60080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0054"
FT                   /product="putative acetylxylan esterase"
FT                   /note="identified by similarity to GB:AAC14690.1; match to
FT                   protein family HMM PF03629"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26826"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND1"
FT                   /protein_id="ADL26826.1"
FT                   /translation="MVKKFLFSLAVLGVASFAQDPNLHIYLAYGQSNMSGQATITDTDR
FT                   QTNPRFLVLRAGNHSNQKVGEFYPAAPPMGHSGSKVGIVDFFGRKMIKELPDSITVAVA
FT                   NVAIGGQSIDLFDKDRNAAYVQNAKNKNDTWWIQYLNEYGGDVHKRIVEMGKIAKQKGV
FT                   IKGFLFHQGEADYQMKDWPERVKKVYDQFIEELELDPEKTPILLGELAPTGDLGWRNDA
FT                   VKEAADLIPNGYVISAQGCPAIKEPNYTLHFTRDGYQTLGERYAEKMLELLKAQEPAPD
FT                   TSKKDSVATDSTSSIHNLSVVRVVESHMPRLFYDVREHSLFVRFKKNGVEYRYHLTGRK
FT                   Q"
FT   gene            60143..62512
FT                   /locus_tag="FSU_0055"
FT   CDS_pept        60143..62512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0055"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND2"
FT                   /protein_id="ADL25532.1"
FT                   /translation="MNSIRFFKLYLLAVLAVFLVACSDDDDGAEFMFDREISEVSVLYE
FT                   CDSDTASEPCFKIRYRYPYRLDDYAGLCLWFDTTIVNDTSKAVSDKQIRLAHDTTNEET
FT                   YFHEYKKSGRYYDTIDVSKMVAPYIKDGYDSLQVAMFSEYTDGGDPGAVQRAVLRFKDN
FT                   EPPSVVVPEDSVWSKGVMLSWDRPIDQTNLQGVGNGKILGYNIVIYAIDRPDEDIRDLK
FT                   VSLQTPAGLDYTGGKYYKRSAQIVRNTDSVYIQEIKSSDKDKNYLRLVVLDGGAYDSKN
FT                   PSNNHFRMFIEGLRTRSNTEDYEYKVGFSSWDIVGNRSGSQGDTKVSPKDWRGFMTTDS
FT                   IAPLMSRKIFTEEDSLFPGYAKLDSNNRVRIFWSRSVDPLQFKHGIEVDSELVIPRGCN
FT                   IHECYRAVTSYTVEYYNKLDKSWNLYQDNENIAGTRYIKGKDGSFSVDALDTASFVGYT
FT                   IRRVAPGDTLILRILSVDSSGYKSKVLQDSILVSPGTLASELQCPEGYVAVSTSDTTSF
FT                   CMERFEHRDAKGNFMTNVLHSEAMAACEAVSASGFEVSLCRERDWELVCLSGGSLSYGV
FT                   IEEEDSQASDYLFSVCNVSTNDSASAANIAKRDPHCMNPMGVHDLPGQYQEWVRGRSDD
FT                   TIAILKGSSYKVFQGIDRESIAYCTNRAFPFYTRPGYTQDTVYLYREGTQVDTVYAADT
FT                   TRILHKILTKNDFKDTLQFYDVVDANGKVIGKDYSLYSEYKKGGNAWLDSIANGLKYKP
FT                   TSKEPVFLTGEMISYRHASSFYKSTAIGFRCCAYKK"
FT   gene            62606..63394
FT                   /gene="suhB"
FT                   /locus_tag="FSU_0056"
FT   CDS_pept        62606..63394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="FSU_0056"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="identified by similarity to SP:P22783; match to
FT                   protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26450"
FT                   /db_xref="GOA:C9RND3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND3"
FT                   /protein_id="ADL26450.1"
FT                   /translation="MSDLNEFLSVAKELALKAGDLCLELQNNLGDVRYKTVKDVVTIAD
FT                   VSSEKLIVEGLRAAFPTHSIRTEEAGVIEGSDPRYRWIIDPVDGTVNFSRGIPLWGISI
FT                   ALHFEGKPLVAVVNLPKLGELYTAAKGMGAFMNGKQIHVSRESNPTHAIVSNGDFNVGD
FT                   AAKINAQNSHNFAREAETFERVKCLGSAVIEGCFTACGRIDCFVMTMSYPWDIAAIALL
FT                   VEEAGGKSTHIDGSPMQFVDAEQVIFTNGLLHETLVKTLA"
FT   gene            complement(63615..65156)
FT                   /locus_tag="FSU_0058"
FT   CDS_pept        complement(63615..65156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0058"
FT                   /product="carboxyl transferase domain protein"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24589"
FT                   /db_xref="GOA:D9S4C9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4C9"
FT                   /protein_id="ADL24589.1"
FT                   /translation="MWDKSYLEKLSERNAKAQAGGGAARVEKQHSQGKLTARERLEILF
FT                   DKGTFKEIGAMRLSQSIELPESKRIYGDGVVTGYGKINGRPVYACSQDFTVSGGSLGSA
FT                   HAKKICHVMDLALDSMVPFISINDGGGARIEEGVSSLDGYSGIFARNTWASGVIPQISV
FT                   ILGPCAGGACYSPAITDFIFMTEKTSQMFITGPAVVKAVTAEVVTPDQLGGAGVHSSKS
FT                   GVAHFVYKDDKECLEGVRNLLKYLPQSNTDKSVAQAGTIVDKSADIEEIIPDNFKRAYD
FT                   VRDVLNCFADKDSFLEIQPEFAKNVVIGFIRLDGNVIGVVANQPKYLAGSLDVDASDKA
FT                   ARFVRFCDSFNIPILTLEDVPGYMPGTKQEHNGIIRHGAKLLFAYAEATVPRVTLILRK
FT                   AYGGAYIAMNSKNLGADCVFALPIAQIAVMGAEGAVDILRRKEIAASAEPAKLREQYIA
FT                   QYEEKYLNPYIAAGNGFIDEVIEPKSVRDRLVSAFENLKNKKKAVLWKKHGNIPL"
FT   gene            complement(65178..66026)
FT                   /gene="fabD"
FT                   /locus_tag="FSU_0059"
FT   CDS_pept        complement(65178..66026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="FSU_0059"
FT                   /product="[acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by similarity to SP:P25715; match to
FT                   protein family HMM PF00698; match to protein family HMM
FT                   TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25868"
FT                   /db_xref="GOA:C9RND5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND5"
FT                   /protein_id="ADL25868.1"
FT                   /translation="MISYVFPGQGSQFPGMGKDLFESNADVKSMFLKANEILGFNITDV
FT                   MFNGTAEDLKQTKVTQPAVFLLSVAMAKVQGGKPDMAAGHSLGEFSALTATGAITFEAG
FT                   LKLVAKRAEAMQKACELRPGTMAAVLGGSDELVEEACAQVKDAAVVPANFNSPGQVVIS
FT                   GEKAGIDQVAAYLTGKVKRVVPLQVGGAFHSPLMESARAELAKAIEETEFSTPVCPVYQ
FT                   NVDAKPHTDPNEIKANLLTQLTSPVRWTQTVKNMIADGATEFKELGPGEVLTNLIKRIQ
FT                   K"
FT   gene            66269..66514
FT                   /locus_tag="FSU_0060"
FT   CDS_pept        66269..66514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0060"
FT                   /product="putative acyl carrier protein"
FT                   /note="identified by similarity to SP:P20804"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26445"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND6"
FT                   /protein_id="ADL26445.1"
FT                   /translation="MANEEIKSKLKAFFMSDLGVDGDVLNYDTPLFGEEIGLDSVDSLE
FT                   IISFVDDNFGVSMTGVAKENFQSIDTIAAFIEKNKA"
FT   gene            66536..68944
FT                   /locus_tag="FSU_0061"
FT   CDS_pept        66536..68944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0061"
FT                   /product="beta-ketoacyl synthase family protein"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25996"
FT                   /db_xref="GOA:D9S4D2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4D2"
FT                   /protein_id="ADL25996.1"
FT                   /translation="MFGISMTSNNRRCVVSGLGVICAVGNNVEETWKNALNSVSGIHKT
FT                   TSLDTKNCYADLAAEVNCDTLDDIECPDEKDRASKLCIKAMKEALNDAGLGDFADSSRV
FT                   SVIIGSCVGGVLSIEQYHRHGKNVNEIPKMPIAAIASQVAEACHAGGIVTNVGNACAAG
FT                   TISIALACDLIRAGKADVVIAGGSDSFASVPYSGFLSLHALDENGCSPFNHCNGITLGE
FT                   GAGIVIVESLEHAEKRNAKRYCEVLGAGVTSDAHHITAPREDGVCLLEAMDRAVKNSGI
FT                   KKSDIGYLNAHGTGTGKNDNAEINAFHKFFDEENPTLSVSSTKVMTGHCLGAAGAIEAV
FT                   FSIKALTTNTVLPTLHYTAEDSEALKAKVGTMDYVQNTPRAKELECVMSNNVAFGGTNA
FT                   SIVFSKKPGDVQSQVAKDKKIAVTGIGIVSPIGNSKEIYLDAVKNGKLPESASICSTVT
FT                   NDDYKELGIKMAFYRKLDNLGQLQTVSGMRALKDANFTVTEDNAKQIGIIVGTSEGGLG
FT                   ATYDFEELIAEAGNAGGSAFKFPHTVYNAAGGYLSILSGIKGYGVTITTGPLSGLDSIG
FT                   YSMNVIHDGQEEAMMATGTDENLPIITELCQKMNVAADKVVEPYSNSNGFVVGDGSVSI
FT                   IMETEDYAKSRGAKVYCYALGYGNGRKNVKFGHISGSDEALDLAIKDALNDAGVSIDEI
FT                   DAVCGFANGFKKIDDIEKGAYARVFGDKLASLPLFQVKERVGEGRAASATLAAAEAALM
FT                   LGGELAEENAYFIANGEVSKKKVATAGFKKILVTSFATGGSYSAVVLGK"
FT   gene            68966..69697
FT                   /locus_tag="FSU_0062"
FT   CDS_pept        68966..69697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0062"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="identified by similarity to SP:P51831; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25625"
FT                   /db_xref="GOA:C9RND8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RND8"
FT                   /protein_id="ADL25625.1"
FT                   /translation="MKVAIVTGSSKGIGKACALRLARDGYTVVVNYSSSDEAALQTLEQ
FT                   IKAEGGDGMVYKANVAVLAEVKQMVRDVFKAYGRIDVLVNNAGIVRDEYLLMMNPDTLD
FT                   KCFDLNVKGYFYCAQQVAVKMYKQKSGVIINMSSVSSKFALAGQAVYSATKGAVNSFTQ
FT                   TLAKELGGYGIRVNAVAPGFVATEMIEAIPEETRKGYLEKVPLKRFASADEVANVVSAL
FT                   ASDQFAYVTGQVIVLDGGLSL"
FT   gene            69694..70140
FT                   /gene="fabZ"
FT                   /locus_tag="FSU_0063"
FT   CDS_pept        69694..70140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="FSU_0063"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by similarity to SP:P21774; match to
FT                   protein family HMM PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25449"
FT                   /db_xref="GOA:D9S4D4"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4D4"
FT                   /protein_id="ADL25449.1"
FT                   /translation="MMNIYQISEKIAQRPPFQMIEKVTELVPNESATGIKNVSVNEPYF
FT                   MGHFPGTPIMPGVLICEACAQLCSLVIEKPAEDLEKNLYVLLKIDGFKFVKPVIPGDQL
FT                   EISVNKTKGGGVIVGFDCVVKVNGNVHAKGSLTFTSIPKESLGK"
FT   gene            70171..70908
FT                   /locus_tag="FSU_0064"
FT   CDS_pept        70171..70908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0064"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24612"
FT                   /db_xref="GOA:D9S4D5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4D5"
FT                   /protein_id="ADL24612.1"
FT                   /translation="MPGSPYIQLMIEKAKNIIAGLFWKFVLFLVVYGVRTYLLVVYRPK
FT                   MTFLGSVKSTDLKEPMIIIANHTSMLDPLMVQSLFFHKRSIVVAKDQVEDPHFSWALKR
FT                   FKNVIPCDRFNLDTEWALLAKKELEKGNSVIIFPEGKCRYDGLLNEFKTGFAFLARSTG
FT                   YPVLSLGIDGIYKMGHRTQILVDEPEKIERVKGIPSSKHLAERSEYFRQKVWELKQRAL
FT                   GQTGAILPVATETPAEVLPEESK"
FT   gene            70908..71756
FT                   /locus_tag="FSU_0065"
FT   CDS_pept        70908..71756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0065"
FT                   /product="patatin-like phospholipase family protein"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26673"
FT                   /db_xref="GOA:C9RNS5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNS5"
FT                   /protein_id="ADL26673.1"
FT                   /translation="MKIGLALEGGSRQTIFSAGVLDAWLDEGVYFPYISGVSAGCHAAM
FT                   NFVTRQRGRFRYIIQPTKIQQGRDKAHRIFDGIQKECYALHYNAAYGDMPFDFHLFFGS
FT                   GVECEFGLTCLETGRSEFFQEYMSEKRLLDIVNASSALPMLFPIAQIDGKHYADGCVTS
FT                   PIPYQRAFEKGCDKVVVVSTHYPGEIVTDFRKYRVILNPMFKRKYPDFFRALMLRYKRY
FT                   EKMFAEMEKLEKSGKLLIFRPEKEVCDLFATDRNELDESYNMGLEYAKRRMGDLKAFME
FT                   I"
FT   gene            72101..73450
FT                   /gene="gdhA"
FT                   /locus_tag="FSU_0066"
FT   CDS_pept        72101..73450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="FSU_0066"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="identified by similarity to SP:P00370; match to
FT                   protein family HMM PF00208; match to protein family HMM
FT                   PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26970"
FT                   /db_xref="GOA:C9RNS6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNS6"
FT                   /protein_id="ADL26970.1"
FT                   /translation="MAIKNAYLQKVYEKVVARDPDQALFHQAVREFLESLDPVLEQDKS
FT                   WETNGVIDRLVEPERVITFRVPWLDDKGNVQVNRGYRVQFNSAIGPYKGGIRLRNEVTL
FT                   SMLKFLGFEQIFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELCKHVGADT
FT                   DVPAGDQGTGAREIGYMFGQYKRIRNEFVGVLTGKGLSYGGSLARTEATGYGLCYFTRE
FT                   MLKDLANDSFEGKTVVISGSGNVAQFACQKATQLGAKVVTVSDSNGYIYDPNGINLDVV
FT                   LDLKNNKRARISEYAKLVPGSEYHEGSKGVWTVKCDIALPCATQNELDLEGAKALIANG
FT                   VKAVAEGANMPSTPEAIEAFQKAGVLFGPAKAANAGGVATSGLEMSQNSERLSWTFEEV
FT                   DKKLEGIMKSIYAAASSAAVKYGQKGNLVMGANIAGFLKVADAMKWQGAV"
FT   gene            74049..76052
FT                   /locus_tag="FSU_0067"
FT   CDS_pept        74049..76052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0067"
FT                   /product="sensory box/GGDEF domain/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26517"
FT                   /db_xref="GOA:C9RNS7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNS7"
FT                   /protein_id="ADL26517.1"
FT                   /translation="MRLFDEHVVLRFALLLACFLFAESIPDILNFTEHVYNFIPYFLAI
FT                   VFLAYVALFYKFPMDGRKIRNDVEIPEPKVVEPIRDLRKDLLEKDEMFQMMIDVSSDGF
FT                   WTFDVASGKVYWSNRIAKLLATDSASLEDSFEPLKKRVIESDWNAFREQLNAALQTSGT
FT                   FSCTLTLLDASKKNMKLVISGRVQSNNLGRPIRVIGSLTEALDRKSVEREHYNYVYQDA
FT                   LTGVYNRKYFLEKLKTDVDIAAKRPDYVFAVALLDIDSFGAINASYSIKIGDNVLRTIA
FT                   DRLKSIARPDDCVARIGPDVFAVILHNIQSRDPNDDLIPLVRNIHNKVKSPISLEGKDL
FT                   YISVSMSIVVNQDVDCVEDILANANASLRDMKKGINHGGIQFFSGGIREKAMKLYKLEF
FT                   EIRRAIQAQEFVLMYQPIVDIQAGNKIVGFEALVRWNQSERGIISPAEFIPIAEETGLI
FT                   VPMGALILRMACKQTKQWVDMGYKDIQVAVNFSAKQFSMDSMVDDVRRVLTETNLNPRN
FT                   LKLEITEYTAMCEADKTIEIMRALSNMGIQISIDDFGTGYSSLSYLKRYPVHTLKMDKY
FT                   FVDHVADNEEDASFARMVIGIAKSLNLDLIAEGVETKEQLDFLYREGCHLIQGFYFSRP
FT                   LNTDMALEYMKEHYNVPTQGSSFETEPEAVKA"
FT   gene            complement(76049..76882)
FT                   /locus_tag="FSU_0068"
FT   CDS_pept        complement(76049..76882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0068"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by similarity to SP:P37346; match to
FT                   protein family HMM PF01026; match to protein family HMM
FT                   TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25385"
FT                   /db_xref="GOA:C9RNS8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNS8"
FT                   /protein_id="ADL25385.1"
FT                   /translation="MFIDTHCHIDSYERHAGESFDALLERFQSASFTTERSSAKEKAVA
FT                   SKIAQPEAFIHVACDPADFDRARELSEKYPFVYSAYGIHPEYVETETAEDEARLLEFLA
FT                   HPKCVACGEFGLDYHYGAETKAAQVKLFERHLQLGIESGKPLVLHLREADDDALAVLRT
FT                   ANLHDRNVHVHCFTGTSEFVEQLLQLDANIFVGFTGIVTFNNAQNVRDAAALVPLDQML
FT                   LETDAPYMAPVPFRGKPCHSGYIPFIADKLAEIKNVTVEELYHHCRENTRTCYGI"
FT   gene            complement(77008..77475)
FT                   /locus_tag="FSU_0069"
FT   CDS_pept        complement(77008..77475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0069"
FT                   /product="transcription elongation factor, GreA/GreB
FT                   family"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26869"
FT                   /db_xref="GOA:D9S4E0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4E0"
FT                   /protein_id="ADL26869.1"
FT                   /translation="MKHLISKEGFEKFKAEWEHLKYVERPAMINQVQAAAAEGDRSENA
FT                   AYTYGRMRVREIDRRLRELDRILDGAQIVENAATKDGSIRFGATVKMIDKKTKREKIYS
FT                   IVGDKEIDPLQGRISMKSPIGEALQGKKAGDTVEVQAPRGKIVYEILEVNY"
FT   gene            77693..78892
FT                   /locus_tag="FSU_0070"
FT   CDS_pept        77693..78892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0070"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF09603;
FT                   match to protein family HMM TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24736"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNT0"
FT                   /protein_id="ADL24736.1"
FT                   /translation="MLLKNLWCGKMSLRGCVVSAAVSGLLLLAACDEDSGTSAPNDNGI
FT                   SSSEEIQSSSSSLKVESSSSVILSGDGHEESSRSSSSNLKTISSSSKQLNSSSSYKPSS
FT                   SSSLIVSSSSKQMSSSSSLISSSSSSSQKVGLSSSVILSGDSHEESSSSLSAELNCSMR
FT                   LEWGTDRSWNFPKECRFNSEIAYDSITDSRDGQIYKIVKIGNQVWMAENLNYADSATTL
FT                   SLKDRSWCYGNNPENCALAGRLYTWAAAIDSVKLATDKDNPQDCGYEKSCALPDTVYGI
FT                   CPPGWHLPKYQEWKTLFNEVGGDSIAAKMLKSQAGWRYNNYNNGSSGNGTDAFGFSALP
FT                   AGGRYYDGNFDRDGNNAHFWTSTEYDSYNAYDVLLLYEYDNVYRSLNKYEGFSIRCLKN
FT                   "
FT   gene            78993..80819
FT                   /locus_tag="FSU_0071"
FT   CDS_pept        78993..80819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0071"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06245"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26847"
FT                   /db_xref="GOA:C9RNT1"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNT1"
FT                   /protein_id="ADL26847.1"
FT                   /translation="MVKLRRNESKYKRLSRIYYNRMFPRRQDAMRVAWSVAAGVFIGIW
FT                   PTIGVAIILTVAFCALFRLPKVPGIVSSFVANPLTQFGFFYPTGYMLGCKIVHPEAIKF
FT                   DFLEEFQGLSFKNFTTVIGHLWNDAADHLLAFMIGITIVAAIGGAIFFFLAYFIVSYRK
FT                   KKWIEAKTGYIHNLIAEDEVLIKEAHKGKKPMMHIYPFKALRPVNPAEAETISALPYDV
FT                   MNRAEAKAMAEGLPHSYLRVTRAELELPDSVDAYDPKVYAHARENLDKMIEDGVIAFDQ
FT                   KPCLYVYRQTMNGREQYGLVCCVPAADYFNGTIKKHELTRADKEEDRLRHVLATNANTG
FT                   PVFLTYRDNGQFDIFGAVTKRKPVYDFVSKGDGFGHTVWIIDDDAEIEAIRKSFESVPV
FT                   SYIADGHHRSAAGARAASYRAEQNPKNTGDEEYNRYLAILFPSTQLKILDYNRVLKDLN
FT                   GRTPEQLMEEMKLVFDIEELPSMQSPAKQNQVNFYMGGKWYACTFKDKFLKNLGPVDSL
FT                   DVALLQKLILKPLFDIDDPRTSKRIDFVGGIRGLGELVKRVDSGECACAFAMYPTTLDQ
FT                   LMSIADAGEIMPPKSTWFEPKLRDGLLVHTLD"
FT   gene            complement(81106..82023)
FT                   /locus_tag="FSU_0073"
FT   CDS_pept        complement(81106..82023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0073"
FT                   /product="peptidase domain protein"
FT                   /note="identified by similarity to SP:P28628"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24794"
FT                   /db_xref="GOA:D9S4E3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4E3"
FT                   /protein_id="ADL24794.1"
FT                   /translation="MFFLVFILGIVLTIMVGVRTYIFEPVRLQDNSLYPKFKKNGVMWM
FT                   CKLPSCTEKIVDGDFVWGVMRNQDNMVRKVLGVPGDSITITNNGKVYTPHRNFKWKGED
FT                   AFIETRSIYVPRKGDTLRFDQLNDVEQDYLIALMHEQNEKIYIKSSLWQGNREMPLERI
FT                   GSTKLGNRLVSLQEIDYMPWQDRFLVELQIFLAEPGNTPIHIKRELYNANDSSKISFYV
FT                   VPEDCYYLVCEKSNHCADSREIGYFTKNRLIGRANKTANKIQNKIDNRIFELQNSIRSL
FT                   LKKTQKKKTEKPKKDSKKKSATKT"
FT   gene            complement(82095..83915)
FT                   /gene="lepA"
FT                   /locus_tag="FSU_0074"
FT   CDS_pept        complement(82095..83915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="FSU_0074"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by similarity to SP:P37949; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM PF06421; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26387"
FT                   /db_xref="GOA:C9RNT3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNT3"
FT                   /protein_id="ADL26387.1"
FT                   /translation="MPQNNNIRNFSIIAHIDHGKSTLADRMIELTKTVSKNEMMNQLLD
FT                   DMDLERERGITIKAHAIRMVYEKDGEEYILNMIDTPGHVDFTYEVSRSLAACEGAILVV
FT                   DASQGIEAQTLSNLYLAIENDLTIIPVLNKVDLPGAQPDHVAQLVGDLLGYDPDKIPRI
FT                   SAKTGLNVEQVLDKIVDEIPAPKGDSGKPLKALIFDSVYDSYRGVINYIRIVEGTLKAG
FT                   MKIRMMKTGGEYVVTEVGTFSMRRDPRPELTEGMVGYVLANVKTISDVKIGDTLTDAAN
FT                   PAEEPLPGYKDVLPMIYSGIYPIDPEDYKDLREALEKLRLNDSALCWEPETSEALGFGF
FT                   RTGFLGLLHMEIVQERLDREFNVDIITTVPNVEYHVYMSDGSMVKIESPSKLPDASRYD
FT                   YIEEPYVKAQIFTPKEYVGAMMTLCEEKRGTFETMEYIDETKVILKYDLPLAEIMFDFY
FT                   DRLKSLSRGYAGLDYTPSEYKRNNLVKLDILLNGDPVDAFSVIIHRDKANTYANAICVK
FT                   LKDLIPRQQFDVAIQGAIGGKIISRSTVKAVRKDVLAKCYGGDITRKRKLLEKQKEGKK
FT                   RMKSIGSVEVPQKAFLAVLSLSDDSTGSND"
FT   gene            84075..84599
FT                   /locus_tag="FSU_0075"
FT   CDS_pept        84075..84599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0075"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P35137; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25163"
FT                   /db_xref="GOA:C9RNT4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNT4"
FT                   /protein_id="ADL25163.1"
FT                   /translation="MLKKFIICSALCLAANAFAAGKVFNKDYTGTTQILAEITTHEGKI
FT                   VVDLNFKAAPNTVANFVELANSGFYNGLLFHRVIPGFMIQGGDPNGDGTGGPGYTIDDE
FT                   ANDLKHETGVISMANRGPNTGGSQFFITHLPQPHLDGKHTVFGKVIEGHDVVCRIDPND
FT                   PILNIKIVEKK"
FT   gene            84602..85651
FT                   /locus_tag="FSU_0076"
FT   CDS_pept        84602..85651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24672"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4E6"
FT                   /protein_id="ADL24672.1"
FT                   /translation="MSSKKTTSKAPAKASTSEKKSAKPAPAKKPAAKVAPAPAKKAASA
FT                   KAPAKPAVAAKKPAAKAAPAPAKKAAPVKAAPAKPAPAKKPAAKKEEPAKKETTKVVKA
FT                   APAPAKKTAPEKKVEPAVEAKAVAKKTPEKEVEKKVVKEPVKEAEKAPEKAPEKVVEKL
FT                   PKKLKSWKNLNRKKSTVKSDYPYAVLLEGGKKPCKFIMFVEIDEQEERANKKKVTSEMK
FT                   NLEKKPTSAIRHKISLAEETQEELTERILKELEEQNAAFTREAATQICTRCNKNLVSPE
FT                   FWVDKHLGYCEECAAILHLGQSKEARKVEYQLGAMGGDSLDEVEDDDIEGPDAADLKEA
FT                   EEELADFDD"
FT   gene            complement(85795..86448)
FT                   /pseudo
FT                   /gene="lexA"
FT                   /locus_tag="FSU_0077"
FT                   /note="lexA repressor; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by similarity to SP:P31080; match to protein family HMM
FT                   PF00717; match to protein family HMM PF01726; match to
FT                   protein family HMM TIGR00498"
FT   gene            86629..86707
FT                   /locus_tag="FSU_0078"
FT   tRNA            86629..86707
FT                   /locus_tag="FSU_0078"
FT                   /product="tRNA-Pro"
FT   gene            complement(87189..87875)
FT                   /locus_tag="FSU_0079"
FT   CDS_pept        complement(87189..87875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26903"
FT                   /db_xref="GOA:D9S4E7"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4E7"
FT                   /protein_id="ADL26903.1"
FT                   /translation="MSRAAKRRRKLMMMESQMMENQPLPPSKIKVTISTKKLSPRNKIL
FT                   IILFVLEVCFTAIFFLLRAKTHSFDLGYIIDETFLNKLAERELYRTLLRISLAFFISFG
FT                   LGIILHIFKVLPPRKDNKEPSTKNFITEFILLLILAIGVSISEVIELPARFTKKPILKK
FT                   EILINKDTWTTKSGMHYDLIFSSKSSITVSKRTYLAMDIGTEFYTVYQGSFLIDFFPMD
FT                   KYFLRK"
FT   gene            complement(87935..90247)
FT                   /locus_tag="FSU_0080"
FT   CDS_pept        complement(87935..90247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25003"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4E8"
FT                   /protein_id="ADL25003.1"
FT                   /translation="MGLVFSRDEIIMKKLLVWSLAIAGTCFYGCADDNSAAFDSIAPEI
FT                   GEEESSTEESSSSVESEESSSSAKQEAPASGSADSNANSSADTNSSADTSAEAPESSSS
FT                   PAPLSSSAVAPASSSTPAQIPALSSSAIAISSSTISTSFSSSSGLAEYDDNHKAKATFL
FT                   PKAGFYRSLTIEPLTPQKGGEIRCTFDGSFPTVSSEQITVAKQITENSVVRCSEFVNGM
FT                   AADTTTQTYFINESVSMPVVALTVNHHDMFDSTDGLYATGNLTGGGMGGGMWDFGGGAN
FT                   VTDNNNPKCTEPCKQANFWKDTELPVHVEYFEKGSSTTEKTWEIDAGISIIGNYSRYKP
FT                   KKSVAIKMDNDNYGDKTLKYSLFKTRPEAKKFKSFNLRNNGNRFWTDYVGDAMMTSLME
FT                   GTEVDYQRSRQVVVFYNGEYFGIHDMRERLNRSYVETNYGIDSKSINMIKITGSSYEAS
FT                   GTNGASTEDYKQLVNSISSANFAGENNAQYEQIKSKINVNSFAQYMFAEMYYHNGDWPN
FT                   NNVRAWGGNGHPFKFVAFDTDHGFGFTPGISGFDEENENMFTWVLGAKQTSNQGGNNGG
FT                   MWGGFGGGFGGGFGGTSVDSRAPGGMLKKLLENPDFKRLFINNACILLNSYLAYEKVQS
FT                   TVQSMMATIPSSEQQRDEQRWPRNQSNFKWDPTGNTLIAFAKNRGEKLKQEMVERFDLE
FT                   DEVTVTIGASGNGSVQVDGMKLPSNNYQCKFFTNNELQLTAVASAGAVFTGWSDGSTEN
FT                   PHKVTPTAGTTITAQFR"
FT   gene            complement(90412..91188)
FT                   /locus_tag="FSU_0081"
FT   CDS_pept        complement(90412..91188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0081"
FT                   /product="putative 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /note="identified by similarity to SP:P17993; match to
FT                   protein family HMM PF08241; match to protein family HMM
FT                   PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24999"
FT                   /db_xref="GOA:D9S4E9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4E9"
FT                   /protein_id="ADL24999.1"
FT                   /translation="MMYLNAGHFEYFECPHCKCLQINSVPENLSEYYGPNYYSYNKPAD
FT                   TVTRAKTQYNKRVLDVGCGAGALLCSMAATSGIESLIGCDPFIEKDISYENGVQIFKKT
FT                   VHEMTGEFDVIMLNDSFEHMTDPHETMDILKRLLANGGTIKMTLPIYPNIAFEKYKENW
FT                   YQLDAPRHIFLHSINSLKLLANQHGFKIVQMIFDSNNSAILRSYLYTKGITFWKQDPKE
FT                   IFKYFTKSEIIDIDKKMAEANKKGYGDHATVFFMHK"
FT   gene            complement(91245..91766)
FT                   /locus_tag="FSU_0082"
FT   CDS_pept        complement(91245..91766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0082"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24765"
FT                   /db_xref="GOA:C9RNU1"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNU1"
FT                   /protein_id="ADL24765.1"
FT                   /translation="MAFSEEYLKDYEKKIRELPVEELYDILSQIRDHGFQADDSPERIR
FT                   IIEKRIIELTGDKDSILPMPQYSQKLNEKYLNKTTLGSFTFKIGGLVLIFVGIGFSDNT
FT                   SNQYTPFNFITCGLGLLVFVLGCLFDGQIRLYVRDLTAVRTREDHPRDFWFIISILGLI
FT                   GVGLIIWGLL"
FT   gene            complement(91840..92769)
FT                   /locus_tag="FSU_0083"
FT   CDS_pept        complement(91840..92769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC08719.1; match to
FT                   protein family HMM PF04168"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24852"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNU2"
FT                   /protein_id="ADL24852.1"
FT                   /translation="MLSRVANSIYWLARYIERAENVARSIDVNLQLQLDLPGEERPWEP
FT                   VIQIAGNADDFFKKYAHVSIENALMFLTFDKENPNSIISCVGAARENARCVRERISSEL
FT                   WIAINQFYLKLNDPEMPKEALAGPHAFYNSVKEFSQLTAGIIQGTMNHDVAWNFTHLGT
FT                   LLERADQTSRILDVKYYILLPDVSMVGMALDTVQWNAVLKSVGAYEMFHRRNSNVTPHN
FT                   VAEFLLLSEDFPRSLRYCLEKAEQCLKNIAYPVKSKAESIRLLGKLRSDIAFTTIEEII
FT                   DQGLHEQIEKVQIRLNELGNQIWKDFFC"
FT   gene            complement(92794..94287)
FT                   /locus_tag="FSU_0084"
FT   CDS_pept        complement(92794..94287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD76589.1; match to
FT                   protein family HMM PF04169; match to protein family HMM
FT                   PF04174"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25280"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNU3"
FT                   /protein_id="ADL25280.1"
FT                   /translation="MRFGNYDTEGFYDELCLPDGTPRPAAEPLFTKINELPEGELQRRQ
FT                   IIAESAFYDNGITFAVYGNKDGKDKIIPFDVIPRIVSAADWKHLEAGLKQRTEALNCFL
FT                   TDIYNDRKILRDKVVPESLINTCTAYRAQMEGFVPPKGIWAHITGTDLVRDTDGTFYVL
FT                   EDNMRCPSGVSYVLQNRQILKRTFPQVFSNCSIRPVDEYCTRLRHALEYLADSTASPKV
FT                   VVLTPGIYNSAYYEHSYLAQQMGVDLVTGDDLVVQDKKVYARTTRGLKQVHVIYRRVDD
FT                   EFLDPKVFRPDSCLGVPGLIEAYKAGNVALANAPGCGVADDKAIYTYVPQIIKYYLGEE
FT                   AIIPNVPTFVCENPKHMQHVLDHIENMVVKAASESGGYGMLVGPKSTKEECEAFKSKII
FT                   ANPRNYIAQPMISLSRVPCFVDGGFEGRHVDLRPYIVQGRETYILPGGLTRVALRKGSI
FT                   VVNSSQGGGCKDTWVIAENEKAPELGQAKLWMEQQQQQQ"
FT   gene            complement(94320..95201)
FT                   /locus_tag="FSU_0085"
FT   CDS_pept        complement(94320..95201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0085"
FT                   /product="transglutaminase domain protein"
FT                   /note="identified by match to protein family HMM PF01841;
FT                   match to protein family HMM PF08379"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25218"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNU4"
FT                   /protein_id="ADL25218.1"
FT                   /translation="MPIYQVDHETVYDYRLPVLYSNHLAHMLPRTVSRQNWISHSIEVE
FT                   PNPTIRQERIDIFGNKVLAFSIEQEHTHFRFKTTGIVDVQGEEPPKQGETMKWEDVAKL
FT                   LERPTSDETLDAAMYAYASPFAKFDESVRNYALESFEQGRPIFDAAYELMTRIYTDCKY
FT                   TPGATRIGAQPQEILRGRKGVCQDFAHLMIGCLRSLHLPCRYVSGYLRTHPCEGQPKLV
FT                   GADATHAWVSTYIPGHGWVELDPTNNVLGGNEHIILAWGRDFGDVSPLKGVITGGGEHT
FT                   LKVSVNVDLRDE"
FT   gene            complement(95203..97605)
FT                   /locus_tag="FSU_0086"
FT   CDS_pept        complement(95203..97605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E83031; match to
FT                   protein family HMM PF04168; match to protein family HMM
FT                   PF04169; match to protein family HMM PF04174"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26167"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNU5"
FT                   /protein_id="ADL26167.1"
FT                   /translation="MECVETEDTFIRSISALSKVEFEHRCRRLHNVLDENDLSSSMGGN
FT                   HKGTDPIPLVITAEEWKTLEAGVAQRAKLFNALAKDIYGEQSLWKKGKLPAALLFANPD
FT                   FLQVVWKVHPVGDVFVNLTSTDVVRLKDGTFVAVSDHLQVPDGLGRALENRIGVSRAFP
FT                   ELFRSMQTERLAGFFKKLMDGLDAMHKNIGGEGETSKVVLLASSPDNPRRAEDAVIARY
FT                   LGIPLVENDDLAIRNMQVYMKTLMGLKKIGTIFRRVEDGMCDPLELRIDSGEGAVGLIS
FT                   SVRAGNVAIANFLGTGVLETPVFKPFLPEICRELLGEELLLRDVETLWLGNATDAERVL
FT                   AEPEKWIFKKAFRDEGSFKEAEPKTYATMTTTAQLALLQAVENAPEQWVAERSMEVSVV
FT                   YAYRGEFTPAVSLMRFFAVNTANGTSVMPGGLGILDKGLGEKDIWVLSENPVANFSLLA
FT                   PASQAITPSRAGGDLPSRAAENLFRLGRALSSSNMMARIARGIAVRLSDESWMDMPELP
FT                   WILKAGLTDETQSRLAQDPENALRYFILRKDNKNGIQCVLTEIRELGMQLRDRISEDLW
FT                   LYLNGFGIAEVPAGTGAAALLPYLKEVLSDSAAVAGLAADSMTRGHEWRFLELGREIEC
FT                   AIRTLQLVKSLLYTAPTDEMTNLRLLQAVLEIGDGLMTYHRRYGGRLQVVPVIDLLLSD
FT                   ESNPRSVAYQVAKLRKAAKHLPGNDQSEATFSPLDRELMRVLAELRLANIEQLAETVDN
FT                   KRENLIKLVKTQINSIERIAEIVNRLYLSHAPRAGVFHATTTDVSEV"
FT   gene            97861..99501
FT                   /pseudo
FT                   /gene="alsS"
FT                   /locus_tag="FSU_0087"
FT                   /note="acetolactate synthase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by similarity to SP:Q04789; match to protein
FT                   family HMM PF00205; match to protein family HMM PF02775;
FT                   match to protein family HMM PF02776"
FT   gene            complement(99953..101824)
FT                   /gene="aspS"
FT                   /locus_tag="FSU_0089"
FT   CDS_pept        complement(99953..101824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="FSU_0089"
FT                   /product="aspartate--tRNA ligase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by similarity to SP:P36419; match to
FT                   protein family HMM PF00152; match to protein family HMM
FT                   PF01336; match to protein family HMM PF02938; match to
FT                   protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26089"
FT                   /db_xref="GOA:D9S4F5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4F5"
FT                   /protein_id="ADL26089.1"
FT                   /translation="MRGAFLPHSYKKCYISRRKIIFKDTTMKRTHNCGQLRKEDVGQTV
FT                   TLAGWVDRRRDHGGVIFVDLRDKYGKTQIVFNPDYNADVLKTAEQLRNEYVIYVTGKVY
FT                   AREEGNTNEKLATGEIEVKADKLEILNAALTSPLAINDPNEECKENDDLRLQYRYLDLR
FT                   RPWIQKKLLLKSRFLKAVYDFFYSNGFENIETPCLCKSTPEGARDYLVPSRVNPGKFYA
FT                   LPQSPQQYKQLLMIAGMDRYFQIAKCFRDEDLRADRQPEFTQIDVEMSFVNQDEVMEMF
FT                   DKFVTEVLGKVWNFEPPRHIRRMKWAEAMLKYGSDKPDLRFDLEIHDVSEIGAKSNFGV
FT                   FKNCVAAGGKIRGIAAKGCVDFTRKQIDELTAYVAKYGSKGLVWMRVKENDEVETQVGK
FT                   FFTTEQLNELRDAVGAKCGDMMFFIAGPEKIAATAMGQLRLEVARIKGLRDPKKREFVW
FT                   ITEFPMFEYSDTEGRYMAMHHPFTNPLPEHLDMMLGGNLKDCNAEAYDLVLNGVEIGGG
FT                   SIRIHNPEVQEKVFRLLGLSEEQVKTKFGFFVDAFKYGAPPHGGLAFGLDRVVATMEGE
FT                   ESIRDYIAFPKNTSASSPMDQCPSEVDLQQLQDIHISVQMPKGADKK"
FT   gene            complement(102368..102565)
FT                   /locus_tag="FSU_0090"
FT   CDS_pept        complement(102368..102565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25247"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4F6"
FT                   /protein_id="ADL25247.1"
FT                   /translation="MENRSKKWKTLYKIGNKIVFYILQKEFTCAKKKAKQKRFKRPRNA
FT                   VKSSIRTQQDLSFYPSSTSS"
FT   gene            102736..103338
FT                   /gene="atpE"
FT                   /locus_tag="FSU_0091"
FT   CDS_pept        102736..103338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="FSU_0091"
FT                   /product="V-type sodium ATPase, E subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26508"
FT                   /db_xref="GOA:C9RNV0"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV0"
FT                   /protein_id="ADL26508.1"
FT                   /translation="MAEDLQALMERIQKDAVEKAELAAADIISKAKDKAAEIVRAAEDE
FT                   AKAKLENADKEAQAFTERSERTLEQSARDLLLSVGKNLEKMILDLLSLQIDKSLDESTV
FT                   KNMLLTVAKSYTSDIEINFSEADAKALTSFVMGEFAKQLKAGVKVESDKGVKFGFRVKL
FT                   DGGKVSHEFTEQAMAESLSALLRPQLAKIVNKAAQGK"
FT   gene            103348..103884
FT                   /locus_tag="FSU_0092"
FT   CDS_pept        103348..103884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS11897.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25279"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV1"
FT                   /protein_id="ADL25279.1"
FT                   /translation="MSSPAYLMASLPMLELGDVPPLSMAEFRGRCEGVLDAPELEALDA
FT                   LLAGEESDDEFVREYQSRETQMRNVSGRLRAQAWGPEVRFAERSFSGYDVTFAKMIQDA
FT                   FMKSNPLEKEQDIDRARFWLVDSLAGVGEGTIKHVYAYAIKLRICERWARLNDIAGDKA
FT                   VINIINENDPAYRQE"
FT   gene            103902..105659
FT                   /gene="atpA"
FT                   /locus_tag="FSU_0093"
FT   CDS_pept        103902..105659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="FSU_0093"
FT                   /product="V-type ATPase, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:O32466; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF02874"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27270"
FT                   /db_xref="GOA:C9RNV2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV2"
FT                   /protein_id="ADL27270.1"
FT                   /translation="MASIGKITGVNGNLIRVKFESAVSQNEVAYAKLISKNEAGKTEII
FT                   PLKSEVIRIRGDYAELQVFEDTTGLKAGDEVEFTGELLSVELGPGLLTQVFDGLQNPLP
FT                   KLADECGFFLQRGKYLKALPRDKKWAFTPVAKAGDVVVAGDTLGTVPEGVFSHRIMVPF
FT                   KLLGKWTVDYITTAGDRVVEDVVAKLKNDKGETVDVTMVQTWPVKMPIKAFEERLRPSK
FT                   PLTMQQRIIDTFFPVMQGGTFCTPGPFGAGKTVLQQLMSRYADVDIVILAACGERAGEV
FT                   VETLREFPELIDPRTGKSLMERTLIICNTSSMPVAAREASVYTGVTLAEYYRQMGLNVL
FT                   LLADSTSRWAQALREMSGRLEEIPGEEAFPAYLESVIASFYERGGVVRLKDGSTGSVTI
FT                   CGSVSPAGGNFEEPVTQATLKVVGAFLGLSRERSDQRRFPAIHPLDSWSKYEGIIDSKK
FT                   VAQARSILANGVDVNNMMKVVGEEGTSIEDFIVYLKSEYLDAVYLQQDAYNEIDAACSA
FT                   ERQKYVFDKIYTILMTPMTFTEKDVARTFFLKLTQATKDWNRVAFDSQEFKDLESSIFA
FT                   SVKEVSANA"
FT   gene            105652..106953
FT                   /gene="atpB"
FT                   /locus_tag="FSU_0094"
FT   CDS_pept        105652..106953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="FSU_0094"
FT                   /product="V-type ATPase, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:O32467; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF02874"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25543"
FT                   /db_xref="GOA:C9RNV3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV3"
FT                   /protein_id="ADL25543.1"
FT                   /translation="MHNVAYHRIERIAGSVITLRAEGVANQELAQVTSSFGTSLARVIR
FT                   IDGDLVDLQVFAGARGISTDSEVRFLGEPMKVPYSEALLGRVFNGAGKPRDNGPEVDGE
FT                   RITIGGPSVNPAKRIIPKTMVRTGIPMIDVFNTLVVSQKLPIFSIAGEPYNELLARIAL
FT                   QAEVDVIILGGMGLKHDDYLYLKDYLEKNGALSRTVMFMHTASDPIVECLLVPDASLAV
FT                   AEKFATEGKNVLVLLTDMTNFADAMKEIAITMEQIPSNRGYPGDLYSQLASRYEKAVDF
FT                   SDAGSITILAVTTMPGDDVTHPVPDNTGYITEGQFYLRKGRIEPFGSLSRLKQQVNGKT
FT                   RSDHRTIMNTMIQLYASYKETLEKQSMGFNMSNWDQKLLKYGVRFEKEMMDLSVNIPLE
FT                   KALDLGWEILADCFTPEETGIPTKMINQYWPKKW"
FT   gene            106955..107587
FT                   /gene="atpD"
FT                   /locus_tag="FSU_0095"
FT   CDS_pept        106955..107587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="FSU_0095"
FT                   /product="V-type ATPase, D subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF01813;
FT                   match to protein family HMM TIGR00309"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24888"
FT                   /db_xref="GOA:C9RNV4"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV4"
FT                   /protein_id="ADL24888.1"
FT                   /translation="MAKVKLTKNALKAERDALKRFQRYLPTLLLKKQQLQMEMRTLQEK
FT                   VMAKREEEDKLRKSMASWISLFADPIEWKNYLSVKSVEQGEGNIAGVKIPTFSGVEFNV
FT                   NIPDFFTTPVWLDDGIRSLQGLISLRLERRVLEKQYELLSKELRTTSQRVNLFEKVKIP
FT                   ESKDNIRKINIFLGDQQTSGVARSKLAKGKATAKALALDAQSKEVAA"
FT   gene            107584..109515
FT                   /gene="atpI"
FT                   /locus_tag="FSU_0096"
FT   CDS_pept        107584..109515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="FSU_0096"
FT                   /product="V-type ATPase, I subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF01496"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26079"
FT                   /db_xref="GOA:C9RNV5"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV5"
FT                   /protein_id="ADL26079.1"
FT                   /translation="MITPMKKVTILTLASHKEETLKALREMEIIHLTPLQNAVGASVNG
FT                   AKGAVARVQKAMEVVPDKLRKGVTPAAKGASGVTLVEEIQTLISDKKNAEIQLEQAKEE
FT                   LEKLHAFGNLDPRTVKELVAKGIFVRLYLVDLSKDPFEVEGDNAYKHVFGKDENGTYIA
FT                   VFTKGDAPASVKGAFTELAMPLKSLEEYRMIEEESNTTISAVDERFAQLASVKDDLEDR
FT                   LLEVTDRYNLVEASASMLQNKGLAALQGFCPEPRVAEISAAAKANGWGIRVEDPTDEDN
FT                   IPTLLGYNKLSRPMQCLYDIIGISPGYNEVDVSSVFLCFFSLFFAMIVGDMAYGLLFLG
FT                   LAVFARSKMPKASSAGFHFVYLMSWATIIWGAINANFLGLTPELAGWSYYLDIANYNFI
FT                   PEGVRNVLYWIRSSAPTDPTRFEAYRQFCETFTFLPASFVPKAAGASQMQHIQLFCFCI
FT                   AVVHLSIAHAWNVVVRFKRKSSTFMAQVGWLMGAWVMFFLACNMVLGIDMPKFVIPMFI
FT                   VEVVLLVLFTVPPSRLKQDFISIPMLVLDIVNSFTDVISYIRLFAVGMSGAAIAEAFNG
FT                   MLSPLFGSAVGVAGAALVLLGVHGLNIALAVMGVAVHAVRLNTLEFSNGLGLEWSGFAF
FT                   SPFAKQKN"
FT   gene            109570..110010
FT                   /gene="atpK_1"
FT                   /locus_tag="FSU_0097"
FT   CDS_pept        109570..110010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK_1"
FT                   /locus_tag="FSU_0097"
FT                   /product="V-type ATPase, K subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25943"
FT                   /db_xref="GOA:D9S4G3"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4G3"
FT                   /protein_id="ADL25943.1"
FT                   /translation="MVTLAKMGAAAALGIAAMGSALGCGTAGMSAITMWKKAYAQGKSA
FT                   LFTLLVFVGAPISQTIYGMLLMNFILSKAAEQGFTNWGGCLGAGIFGGLGMMASAWYQG
FT                   KSAAVACDALGETGKGMVNYLMVLGIVETVALFVLVFSMMVL"
FT   gene            110029..110484
FT                   /gene="atpK_2"
FT                   /locus_tag="FSU_0098"
FT   CDS_pept        110029..110484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK_2"
FT                   /locus_tag="FSU_0098"
FT                   /product="V-type ATPase, K subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25007"
FT                   /db_xref="GOA:C9RNV7"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNV7"
FT                   /protein_id="ADL25007.1"
FT                   /translation="MDQSQLLTLAKLGAVAALGLAAVGSALGCGTAGMAAIGAWKKAYL
FT                   KGKNALFTLLIFVGAPIAQTIYGMLLMMYILNKSQAAPGNWAAYLGVGIFGGIGMMASA
FT                   WYVGKSAADACNALGETGKGLVNYLMVLGVGETVALFVMVFSMMLVS"
FT   gene            110620..111642
FT                   /locus_tag="FSU_0099"
FT   CDS_pept        110620..111642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO76741.1; match to
FT                   protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27146"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4G5"
FT                   /protein_id="ADL27146.1"
FT                   /translation="MQNDIIKISPSIHEFLLTHGYTENFTVTPIAGAGSGRRYFRIASD
FT                   ERKSVLQVSAEVNEDFKHFVEYSKTFREYGLPVPRVYCVDENACQVLQEDLGKRSLLDE
FT                   AFPNGTKVLSGSARILYPEVIDALIQWQNASHQLFSHHTEIWLRRFDFAALKWESDYFT
FT                   ENYLKLHKGITEIPESVRNFYSLVAVSVEAQTNVLMHRDFQSQNIMIRPNSEVAFVDFQ
FT                   GARRGSMFYDIASLLWDPYVSLPLPMIKDFFEYWRSQYRGTRIYTKDDAWEGFVHASLQ
FT                   RLMQALGAYCFLSKVKKIEKFEQYIEPGKAQLRVLFGEFKQIAKATDPEVFKFMDWALQ
FT                   "
FT   gene            111627..112064
FT                   /locus_tag="FSU_0100"
FT   CDS_pept        111627..112064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0100"
FT                   /product="putative PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25624"
FT                   /db_xref="GOA:D9S4G6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4G6"
FT                   /protein_id="ADL25624.1"
FT                   /translation="MGAAVMALIYTRIYAQPVEFNRALGYAYDALVKGPYPFDAMSTWK
FT                   GLSERVAQGIYMGQGLLLPHTRVSGLQEPLMAFVVAREGITGIKTRNDEKAQFMCVLLS
FT                   PAESAMAHTVTIANVAKRLLDPEWKEKVLVATDEEELKKMF"
FT   gene            complement(112104..113534)
FT                   /locus_tag="FSU_0101"
FT   CDS_pept        complement(112104..113534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0101"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25894"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW0"
FT                   /protein_id="ADL25894.1"
FT                   /translation="MQSWHKTSSILSIIFGTALACSAHPVDMPHHITFADSAHTKELNI
FT                   NVQLLDSLAITNLSKAKTHYDNSMSVRLFASGKFTDAFLFDTRVKVNTDYTNRYINFNY
FT                   YNPDEGLPYNKQSEHKRTWDLFAANVSYNLEPVNLLAGFDFLEWGPARRNHVILRGERN
FT                   FYRPWQDSSSRIPDAAPTPYFGYQFTLGPIEYTQYAAKLYEKKNFGKYFHAHRLKLNLP
FT                   KEITLGISETSLYGTTTEAAGTNPNPDSDSTGREFEWAYVLPFIPYVFQEHLQGDQDNI
FT                   SLAFDLSVKTLPNWEFYAELLWDDMKSPTSMFDDSWWGNKWATTLGVARDNFEIGPVNL
FT                   NWIFEYTRIEPWVYTHHKGNAYTYASYAQSLGSDLGPNSQEVHTEVTATYNFIKATLFF
FT                   GAVAKDTAFGGNIRDLHTPESAMDKKFLNEETTLRYKELGFTLSLTPWEWFSFRTSYTR
FT                   FFGDFKGYRAYAVGSVQW"
FT   gene            complement(113534..114253)
FT                   /locus_tag="FSU_0102"
FT   CDS_pept        complement(113534..114253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0102"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25026"
FT                   /db_xref="GOA:C9RNW1"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW1"
FT                   /protein_id="ADL25026.1"
FT                   /translation="MIACFEKQNLKKTIIAGVLLLVATFFVTVGVAEISFPETIFTFTD
FT                   QEWLLDIWPKAYRYNIHVGVGAIVLACALIFPAIKIQKDFAIRALETLCRIGIGGMFIF
FT                   ASIFKIQDPHQFATLVAQYQFFSALHLDFVNNFFALVYPQFEFWFGLAMIVSPFVRESA
FT                   FAIFWMFVSFIIALAWALWNDLGITCGCFELEGAQDKAEAWTSLIRDLILIWPTLWLAF
FT                   RKNKSIIGIWKKDKEVK"
FT   gene            complement(114263..114466)
FT                   /locus_tag="FSU_0103"
FT   CDS_pept        complement(114263..114466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25759"
FT                   /db_xref="GOA:D9S4G9"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4G9"
FT                   /protein_id="ADL25759.1"
FT                   /translation="MNNMKERIQKIYQDALVYLKSLNWIVLLGIAAFSIALAIINNIRV
FT                   DDAKSVDWIGTQDVLEKPADIL"
FT   gene            complement(114521..116602)
FT                   /gene="metS"
FT                   /locus_tag="FSU_0104"
FT   CDS_pept        complement(114521..116602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="FSU_0104"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by similarity to SP:P23395; match to
FT                   protein family HMM PF01588; match to protein family HMM
FT                   PF09334; match to protein family HMM TIGR00398"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27391"
FT                   /db_xref="GOA:D9S4H0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4H0"
FT                   /protein_id="ADL27391.1"
FT                   /translation="MCDMKNFYVTTPIYYVNDAPHIGHSYTTVLADILTRFHKIIGYQT
FT                   FFLTGTDEHGQKVQRAAAKRNVTPQEHVDEYYHRFEDLWKKMNIQNDFFIRTTMPEHKA
FT                   YVQECLQKLWDKGEIYSKEYEGWYSVGEERFFSEDELDENKCDPISHRPVEWLKEKNYF
FT                   FKMSAYQQKLIDYLESHKDWIVPDYRWNEIRGFLRQPLNDLCISRPKIRLSWGIPLPFD
FT                   PDYVTYVWFDALLNYVSASTAFHKTYADGTPIWPASYHLIGKDILTTHSVYWPTMLMAL
FT                   DIPLPQHILAHGWWLVNGGEKMSKSAGNVVNPMDYMEKYGIDAFRYFLAREMVVGQDAN
FT                   FTHEGFVRRINSDLANDLGNVLNRVHRLVLTNFGGVLPAPNALDDAANEVITIANRVRT
FT                   NVMEWVPQVKLSQVVEEIMTLVRSINRYLEIKAPWKLAKDESKKDELATVLYISAEAVR
FT                   LSLSMLWPVIPGKSEEGLAMIGSKFTDQNDLVWGILKGGEKFGEGKPLFPRIEEEVKKA
FT                   EPQQAKPKQNKPLMAADVPAAMDLRVAQIKEVADHPDASSLYVLKVDAGEGELRTICSG
FT                   LKSSYQANELQDRKILLFANLKPSALRGIMSQGMLFAGDLEPETHKCRLVSVPENAKPG
FT                   DRALFKGVTPSEPRELKVKDFEKIALTAKGGAVFCDALALEVNGKPVTCDVADGAGIH"
FT   gene            complement(116619..117722)
FT                   /locus_tag="FSU_0105"
FT   CDS_pept        complement(116619..117722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP77410.1; match to
FT                   protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24715"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW3"
FT                   /protein_id="ADL24715.1"
FT                   /translation="MLSSPHTSIIARDRDHLEQLIKEAIEKDGPNCDLNFIDVSNITDM
FT                   SGLFSRFSFFNNEFHKFNGDISKWDVSNVKRMDGMFFESVFNGDISKWNVSNVQDMHSM
FT                   FIESLFNGDISNWNVSNVKDMHSMFAESQFNGDISKWNVSNVEYMYSMFCNSPFNGDIS
FT                   KWNVSKVKNMNSMFAGSKFNGDISNWDVSHEKDMNGMFECSEFKGDISKWETERLLDLH
FT                   GMFQDSQFEKTGKAKNWLNKIYPLMLENATDFDGNVIALNREHLLNLIDAAMWLHGPNC
FT                   DLNFINTSNVTMMHELFRDSPFNGDISKWDVSNVKDMSEMFSGSHFTGNICNWNVSKVE
FT                   CMYEMFYDSALEKNGKIPKWYKETLDF"
FT   gene            complement(117726..118370)
FT                   /locus_tag="FSU_0106"
FT   CDS_pept        complement(117726..118370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25342"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW4"
FT                   /protein_id="ADL25342.1"
FT                   /translation="MNEENNIKQCIEDFLKKNLNTEYIYNEFSLQFELGIFLRNNGFNV
FT                   YFEKNVMAEFGKEYSKDFIKKEMDLYVIGKDNEKYAIELKYPTNGAYPKRMFQFLADIQ
FT                   FMESVKKNLSFTKTFCLALINTDRKGGSFMVIGKKNTNDELKPIYSLFRSSENSYNNSD
FT                   QFFAQQPIHGKINNPINSKKSTEPPFVKIEGSYNIKWNKANENFWYYLLEI"
FT   gene            complement(118405..120348)
FT                   /locus_tag="FSU_0107"
FT   CDS_pept        complement(118405..120348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03382;
FT                   match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25220"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW5"
FT                   /protein_id="ADL25220.1"
FT                   /translation="MATKKTEEKVVAKDKEHLEKLIKAAIKKNGVKCDLNFIDVSKVQN
FT                   MSRMFALSKFNGDISQWDVSNVTDMSYMFDGSSFNGDISKWDVSNVTNMSNMFGYSQFN
FT                   GDISKWNVSNVEYMYSMFCNSPFNGDISKWDVSNVTNMSYMFECSQFNGDISNWNVSNV
FT                   TNMSYMFECSQFNGDISNWNVSNVTNMSQMFAGSQFNGDISNWNVSNVTNMSYMFECSQ
FT                   FNGDISNWNVSNVTDMSFMFEAGKNFMFGRSQFNGNISNWDVSNVTNMSFMFGRSQFNG
FT                   DISNWDVSKVTNMQGMFAESIFNGDISNWNVSNVTDMDYMFARSQFNGDISKWDVSKVK
FT                   NKKVIFSDSLLEKSDNLPKGVSKSKNASQKKPSTKKPENLFMLNTITMSDAQIKKFNSI
FT                   YNEKNIPEIFGKKGAALNKILSGKTTFKTAKTPPIEVYKDMAEKGLEFNIHWEGTEFTE
FT                   LESWGVGNGNAKGGNFWYCIDFNETRAKFLEDYDQDWNPQSSEFVKHMDEYGNNCEIKK
FT                   FQVVVHGDSQQKIFALPVKKLLEPNKSTEKGLVIFKIPYYLEGNYDSAGRSCKDFSDNL
FT                   RCTSKDSKKELYLLDKKGQKIKSILDFDHSEPDKNGDVYYPVPASDFEKKSKNKTLTQE
FT                   AIAKWKKLLGMK"
FT   gene            120569..121090
FT                   /locus_tag="FSU_0108"
FT   CDS_pept        120569..121090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0108"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by similarity to SP:O30013; match to
FT                   protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26540"
FT                   /db_xref="GOA:C9RNW6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW6"
FT                   /protein_id="ADL26540.1"
FT                   /translation="MSFIDLARNRFSCRAFSEQEVEPEKLMQVLEAGRIAPTAVNGQPV
FT                   FIKVLHSPEALKKIRGITRMAYNAPVVLMVCYDDNKVYTPTTYMDNFKSGIMDSSIIAT
FT                   SMMMQATDLGLATLWARGFNAAHIEHEFGFEPNIKLACLLDIGYADPQNGVPSPRHDVR
FT                   KPMNEFAEKL"
FT   gene            121123..122706
FT                   /locus_tag="FSU_0109"
FT   CDS_pept        121123..122706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0109"
FT                   /product="5'-nucleotidase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24847"
FT                   /db_xref="GOA:C9RNW7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW7"
FT                   /protein_id="ADL24847.1"
FT                   /translation="MNKLKYLLPLVVFGVFSCSGKQPQVEGRSNALASPRSIVVVYEND
FT                   VHCQMDGYAKFAGLRDAIADTADVLTVSSGDFLQGGAMGSISRGGYVVALMNAVGYDVV
FT                   TLGNHEFDYKIPRLMELSDSMNAAIVCVNLVQKGTSTPLFKPYVLRQVGSKKIAFVGVL
FT                   TPQTLVGESYAFTDDSLKTLYDIPAEKIFNLVQSAVDDARKAGADYVILLSHLGLVPPV
FT                   SSVEVVQKTTGIDAVLDGHSHSVVNEEFVLNSNGDSVLLSQTGTKFQNVGVLDITRNGK
FT                   FHSRLIPMDSVVAVNQKVAAAHDSLRSLTAADLQKVVSNTKFELTINSDDGKRLVRKGE
FT                   TNLGDLAADAMRFSVGAQIGIENGGSVRVTIPAGDVKYQDVLNVMPFGNGMCLIRATGR
FT                   QIKDALAQGASKLPEESGGFLHVSGLRYTAVVDTKNDGDAAQVRIENVQVETENGFVAI
FT                   DENALYTVGLSSYVAYEGGEITAFRESEIVLDKVMTDSDAMVKFLKSLGDEIPETYRKS
FT                   QGRIQVKYVR"
FT   gene            122780..124222
FT                   /gene="purB"
FT                   /locus_tag="FSU_0110"
FT   CDS_pept        122780..124222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="FSU_0110"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25475"
FT                   /db_xref="GOA:C9RNW8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNW8"
FT                   /protein_id="ADL25475.1"
FT                   /translation="MRDQFESPLIKRYASKEMSFIFSPQYKFQTWRKLWIYLAESEMEL
FT                   GLPITQEQVDELKSHEKDINFEVAEEEEKRRRHDVMSHVYAYGVQCPKAKGIIHLGATS
FT                   AFVGDNTDLIQMQQAMILVRKRLCRVMDKLSKFAMEYKDMAQLGATHFQAAQLTTVGKR
FT                   ACLWLQDMLIDLEELNFLIEVLPFRGVKGTTGTQASFMDLFNGDEEKIMELDRRVTAKA
FT                   GFKRVLTITGQTYTRKWDNRVNQVLSSIAQSLHKFATDMRLMQGVKEVEEPFEKTQIGS
FT                   SAMAYKRNPMRSERICSLARFVMAQVNSTAFTQATQWFERTLDDSANKRLAIPEAFLAM
FT                   DAMLIIAENVTNGLVVYPKVIEKRIMAELPFMATENIIMEGVKNGGDRQELHEEIRVMS
FT                   MEAGKVVKEQGKDNDLLERVLKNEKFQKLGITEAKLKEILDLRKFVGRAPGQVVKFVTE
FT                   EVRPAIEAIPAWDSIDAGELKV"
FT   gene            124491..125012
FT                   /pseudo
FT                   /locus_tag="FSU_0112"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            125198..126124
FT                   /locus_tag="FSU_0114"
FT   CDS_pept        125198..126124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27225"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022359"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4H7"
FT                   /protein_id="ADL27225.1"
FT                   /translation="MILFTFEKSDFFCDFSNKMVYFTIMEKIDLSQWTMFSNRHNSENY
FT                   NSPDGKWMLKLGFPGFCSTKEELLREQDICRKVVSLGIPTPHVGDIVEQDGRLGLIYER
FT                   IVGKRSISKCVGENPEHLEEYIKVFAEHCKKLHSTSCIPGTFQDAEEKYSRLIEESKMF
FT                   PENVKEFARNLIKETPKVSRCVHGDMQTGNLIVNDNGAYFIDLGEFACGNPLFDLGCYF
FT                   YFCHYLPDDYLLAAHYMNAAMMHKCWDVFAKYYFGADTPEKLAAVDARVKPYVLFPILD
FT                   FEHLMAEDANLKYLEMNFQVARKDLGL"
FT   gene            complement(126131..127426)
FT                   /locus_tag="FSU_0115"
FT   CDS_pept        complement(126131..127426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0115"
FT                   /product="putative glutamate-cysteine ligase"
FT                   /note="identified by match to protein family HMM PF04107"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27198"
FT                   /db_xref="GOA:C9RNX1"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX1"
FT                   /protein_id="ADL27198.1"
FT                   /translation="MSNFKIWERFGVEMEFMIVDRDTLNVLPRADVPLGKDKDGNQLSD
FT                   IEYDDIGLSNELVSHVLEFKCAHPKSTFDGLGKRFFHEIRRANKKLEKINAMLLPSACH
FT                   PFMDPAEMQLWPYDCLDIYQTYDRIFNCKGHGWANLQSTHLNLSFDGDEEFGELHAAIR
FT                   LLLPLIPAIAASSPYLDGKYTGYRDARIEVYRHNQDKVPEITGQVIPEQAYSYDEYNRM
FT                   IFDKVKKAIAPYDTEHLLNHFFLNSRGAIARFDRGAIEIRLVDIQECPNADIAIVELEI
FT                   ATLKAIVNGKFAASRENASEAPSAANSVPHTLKEYREFLRNFDTTRLAELLTKTTKDAE
FT                   NAQIDWQEYLSVFGMDSAVTAGDIWKHIYSVVKNDLTEVSQSFMGKMLERGTLSSALYK
FT                   ALGDAPAHEAFVTEYKKLADCLAHNRLYGISE"
FT   gene            complement(127436..128989)
FT                   /locus_tag="FSU_0116"
FT   CDS_pept        complement(127436..128989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0116"
FT                   /product="putative ribosomal protein S6 modification
FT                   protein"
FT                   /note="identified by similarity to SP:P17116; match to
FT                   protein family HMM PF08443"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26369"
FT                   /db_xref="GOA:D9S4H9"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4H9"
FT                   /protein_id="ADL26369.1"
FT                   /translation="MARTTQLRDEDATRADIMKKIIVVNTPKNWKFHIPEAEIVSAKDY
FT                   LTNPEFTTQKNVRVFNLCKDYSYQSKGYYVSLLAEARGHKVIPNVKNIRDFKAPAVVKI
FT                   ISDEIDELIQKSLHKLTGTEFVLSIYFGQNVSAQYLELSQALYRVFQAPLLRAKFVFKQ
FT                   KWFIQSIRPISVDEIPETHKEMVDQFAIEYFQKDRYVSPKTEDYVYDLGILTNPDEVEP
FT                   PSNKEAIQLFIEAAQDTGFRVEMITKTDYHRVGEFDAIFIRETTNVNHHTYAFARRAQS
FT                   EGIAVIDDPDSILRCSNKVYLQELMTVGKIPAPKTIIAHSENRHTLAKEIGFPMVIKTP
FT                   DSSFSMGVKKANNKEELEKILDTMFEHSDLLIAQEFTPTEFDWRIGILDGKPLFACKYY
FT                   MAKDHWQIYNWDSKDKNAVCGKWDCLPIESVPHGIVKTALRVASLIGNGLYGVDLKEIN
FT                   GHPVVIEVNDNPSIDHGIEDQVGKKKIYLAIMRSLRHRIEDRQNAAQQKVLQHERDMFL
FT                   "
FT   gene            129087..132485
FT                   /gene="mfd"
FT                   /locus_tag="FSU_0117"
FT   CDS_pept        129087..132485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="FSU_0117"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26249"
FT                   /db_xref="GOA:C9RNX3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX3"
FT                   /protein_id="ADL26249.1"
FT                   /translation="MLTISEFLQENSFPAISLFENADNEAIHVNGASVPLASMMVANRF
FT                   LKSPQNILVIAKDYRSAEVWVENLESMVGEEFVRFFPSLGLKPYEIKVPFEGVLEERLK
FT                   FFRDVSHTEKPFVVVCPLDAFLMKLPEPGEIMRQVRTLRVGDQLEPSSLRPWFLDHGFV
FT                   EQPMVSGVGEFSIRGCIVDVNCLLYPHPIRIEFYGDEIESIRAFDIFSQRSLEQMTHIE
FT                   FFPMGEFTVPESVMAGEECSVESLWWHRPHHQRLVASLLDYMPRASLVFEELSLLSETA
FT                   SKMYGAFRGAYDEARVTDAGVAAPADIWFKIGELSRLFVGRASLDMTRVKVDDGNWHEM
FT                   HMRPQDFTSNGTDAVAKEIEEFYDKGGRVYVMAQTLGGVNRLREIFDGLPIEDYFIGNL
FT                   SEGFWLEDDNVAFLTESRILNRHANKARKHKIAGSVTNALMVESLNRGDLVAHEDHGIG
FT                   RYLGLVRVEVNGGMVDCALLEYDGGDRLKFPVSDLQKIERLDRPEDIETKLDRLGSKTW
FT                   ENIKKRVKQKVIQIARDLVELYAKRELVEGFGFPPDGNMQKEFEDSFEYDPTPDQLRAT
FT                   ADIKRDMESHRPMDRLICGDVGFGKTEVAMRAAFKCVSSNKQVAILVPTTILAAQHYEN
FT                   FCERFAAYPVKIALMNRYKSAKEKKEIFKEIAAGTVNIVIGTHALLSNKSEFKDLGLLI
FT                   IDEEQKFGVKQKEKLRQLRLAVDTLSMSATPIPRSLHLSMTGVRDISLINTPPINRLPV
FT                   ETKLMQRDDEVLKNAILDELARGGQVFVVNDRVQTIYKLTEDIEAMAPEAKVAVAHGQM
FT                   EDHELERVMDAFLSRKFDILVSTSIIESGLDVPNANTIIIMNAHHFGISQLYQMRGRVG
FT                   RSSVLAKAFLVIPQRGEISQESMRRLKALEQFTDLGSGYQLAMRDLEIRGAGNLLGQEQ
FT                   HGFIAEVGFETYVRLVREAVEMLRGGALEKPIQPRVEIGVDAYLPEDYVEDGLTRISLY
FT                   QRIARITTQADVQNIESELQDRFGPVPTPAKMLLLVTELGLLAGRLRIQGLALRKGVIV
FT                   ATFAETPSPDPRVLGEISSLCTCNMRYLGMSPLQAVFEVGRGTPVEMAKKTLEVFRAFA
FT                   NIQVQAATVRSADPLLKALGVGEPN"
FT   gene            complement(132450..133178)
FT                   /locus_tag="FSU_0118"
FT   CDS_pept        complement(132450..133178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0118"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27072"
FT                   /db_xref="GOA:C9RNX4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX4"
FT                   /protein_id="ADL27072.1"
FT                   /translation="MFDFHIHLARLPQKKQLAQLLLDRNYDFIAVSCEPWEWEEVSQLK
FT                   KEFSTEIKPFKVTYGIHPMIATQATRETLDQLRTRLEEDPLAMVGEAGIDKRYPGYNDG
FT                   PQDQIFLAQAGLALELKRDLQIHCVGDYMHVLKLLEEAGFKAAQGQDTPSRETPRPIFH
FT                   RFGGDANFVKKALPFGALFSLHEDSFRKKSTAAAIKLIPESNVFFETDADESFLEPAEL
FT                   LEELEGRLESVRLAYAKSLE"
FT   gene            133319..133516
FT                   /locus_tag="FSU_0119"
FT   CDS_pept        133319..133516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0119"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26578"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX5"
FT                   /protein_id="ADL26578.1"
FT                   /translation="MRDLLEKALNKGLTVCFTSENGFDVIRISSGNEVVASCSLGSNSF
FT                   RASVEESLQALLLDLERKGF"
FT   gene            complement(133619..135199)
FT                   /locus_tag="FSU_0120"
FT   CDS_pept        complement(133619..135199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0120"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25812"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX6"
FT                   /protein_id="ADL25812.1"
FT                   /translation="MKLLRTLAVAATLALVACGDENAVALNEPPVSSQEDSSSSSDVIE
FT                   TSSCSETVVTSSSSQTPSTEISNGSIITDGQVIDLRDGRTYKTTVIGNQVWMAENLKLD
FT                   VTQYVDDGAYKDEYNFYDALWSGVRSREISDTSEHFYPWDIAIDTAGIFGSSAKGCDHE
FT                   TPCDLTGMVRGICPEGFHVPNPTEIEQLTRAIGGKCGTSKKLKAKQSGWIFDNGTDEFG
FT                   FAAIPTGYNVVYWGDGMNGFTFDYELNPQGKFLTTVDTLTWNIAIDADYAISYREEYEV
FT                   VDFTEEYHWYMCSLRCLRDEPAGVDWVDPPEPTSPALPEFEYGEFTDERDGQTYKTVVI
FT                   NGKTWMDQNLNYVFDVVDTNAACRLNEENDDDEEYEDECKKSSDYSCKHPLIGSPVSCK
FT                   NKYSIDDTYCKEHEATCKNYGKFYTWNQALIACPSGWHLPDNNEIEDFMESINPYTVYE
FT                   GECLLKHTRFKKIEDPDLNKLLYKDFGMDYFQMQFWTSTIANFNDDYANTSGYACHKTD
FT                   LQNVRCVKD"
FT   gene            135440..137026
FT                   /locus_tag="FSU_0121"
FT   CDS_pept        135440..137026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0121"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26227"
FT                   /db_xref="GOA:D9S4I4"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4I4"
FT                   /protein_id="ADL26227.1"
FT                   /translation="MEACGERESVRKSLFEVEGAKDVLHVLRIAFVVTILLTVVDEFSF
FT                   KDDAINSLEVHFDTASERSYEIFRHVHECNFAKEREEVRDNRSADLERHVVCNLGVVVV
FT                   NLVENVAAVAELDVKEFKAREVVEVEHQAEVTLVQVSGLADKGEGDVHVFASEETEFEL
FT                   VFRILCGEESVFVTIDVATEVVTILVRVVPTTYSEAEPILALVSPCFVKREVIFSTANS
FT                   VVFAISLQITRIEGDSKFALKVVGFGEDGEVGLTTPLFEVVRVLVVFGCPENLACFEFK
FT                   VCVDVEVNFVDSEDGVFNHLLFLAACSSGRFCSGYFSRSFDCGRNFNSRSGGNNRCRSF
FT                   CDWSCRGLDFGDRGGFSLRCFWGRSECRNNRFCRSLCFYGCSGVGLDCFCLCFNSLGCI
FT                   LSLDFGCRSLFCYSGFCFGFDVCDSCLCCFRSFGCFLGLCIGGNLCGFSGLSCVCLGLF
FT                   NLSFLLCCYGFGLGNSGFCFYCWFFGGCLNIFCTRCCKYRCCKQTGCKKHFLHYMYSLG
FT                   VRLCLKSLFKC"
FT   gene            137106..138176
FT                   /locus_tag="FSU_0122"
FT   CDS_pept        137106..138176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26781"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX8"
FT                   /protein_id="ADL26781.1"
FT                   /translation="MKKILLVVLAVLTSSSFAQMKLDVYKKINGDIDEKRPLGYLMSSD
FT                   AIKELPIPKDRIEHESFVDVQEKVRGKNGKYQTVTKKQRVVTYEEVEPKAPPRYVPVNC
FT                   KFGDVWVKRSELDRFMQEYADLSGEYVSETGRVVLKSSPSNASRFNIIVQNGKDDNVAE
FT                   IEMGNLEKKNINGHARFVYKEEGCAVGVDVFNRVVRVAQRGCEDYNAGEYTLAGNYPTF
FT                   KGNNRIVETFNLDSYSFSYPKYLWCASGYDTCEPLKDEHGIVNITWSKDGHGTIERKAG
FT                   NTVHTYRAMERVIPHKRDFYNGEKPIAIKTKRTDMSGEWMNWYFYPRAGRFKMMRSGQR
FT                   HDAAYMEIYEPVKEDD"
FT   gene            138169..138618
FT                   /locus_tag="FSU_0123"
FT   CDS_pept        138169..138618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25295"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNX9"
FT                   /protein_id="ADL25295.1"
FT                   /translation="MIKSIEQSRILFLDSGPLVRLLQMHPDYYPIVSGVLDGVYENNVQ
FT                   VLVSSVTLFEICKKAYGANDGVLARQYREFFEKSANVRLCEVNADVSLKAAELFAAAAR
FT                   TNHKLTEAESLRLATAFVNGADCILSECANFRDATDALVVTLDEL"
FT   gene            138766..140223
FT                   /gene="gatB"
FT                   /locus_tag="FSU_0124"
FT   CDS_pept        138766..140223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="FSU_0124"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by similarity to PIR:T51583; match to
FT                   protein family HMM PF01162; match to protein family HMM
FT                   PF02637; match to protein family HMM PF02934; match to
FT                   protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24985"
FT                   /db_xref="GOA:C9RNY0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY0"
FT                   /protein_id="ADL24985.1"
FT                   /translation="MSNYCPVIGLEIHCQLATKTKMFCGCEIEVNTSPNKHVCPVCLGM
FT                   PGAMPVPNKKAVEYAIRLGLALNCEIDLNAMWTRKNYFYPDLPKGYQITQTGGLPVYDH
FT                   PICKNGWLEIVKADGTKKRVGITRIHMEEDAGKLIHDMSPSQSHFDANRCGTPLCEIVT
FT                   EPDIRSPEEAVLVLKKIKQTLEYTRVSNANMENGNMRCDGNISLRASEDAPFGIRAEIK
FT                   NLNSFTNLEKALYCEMNLQASTLDAGKEVEQCTKRYDPNADKTIVIRSKEDAHDYKYFP
FT                   EPDMVRLVTDPAFVEEIRRTLPELPDARRERFMKDFGVSEYDAQVLTEDRDVSEWYDTA
FT                   AKNCKNGKVLANWVITELLAKMKDLEGGLSALKIKPEQLCALVNLIADNTINGKIAKTV
FT                   FAEMFETGKDPEVIVKEKGLVQVTDTAAIEAVVREVCAANAAQFAEFKAGKVALKGFLV
FT                   GMTMRKSGGKANPGLVNQILDKLAKEG"
FT   gene            140244..140636
FT                   /locus_tag="FSU_0125"
FT   CDS_pept        140244..140636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26691"
FT                   /db_xref="GOA:C9RNY1"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY1"
FT                   /protein_id="ADL26691.1"
FT                   /translation="MPYRRETREKERDTRSLNRLVSLSNQSKRLVFAFLVSLFLAFPTS
FT                   AFAKMDRSDSSYVSTLNMTEEQKEKVYGVDSSTLAKGPTLQELNEENPTYVKREYDHKQ
FT                   QVVVGSVVMFCVALAMVLMNNYNPKR"
FT   gene            140680..141414
FT                   /pseudo
FT                   /locus_tag="FSU_0126"
FT                   /note="putative IMP cyclohydrolase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by similarity to SP:Q8TZ52"
FT   gene            complement(141492..142883)
FT                   /locus_tag="FSU_0127"
FT   CDS_pept        complement(141492..142883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0127"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24785"
FT                   /db_xref="GOA:C9RNY3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY3"
FT                   /protein_id="ADL24785.1"
FT                   /translation="MRDEIKQAILQQELKDGEMLPSVRKLMKTFGVSSGTIQGVLKQLS
FT                   EEGLIYSIRGKGFFWGKAPDANDLAQMLSKTVHRETVLERLEREFSTDWEKGFLDPNRN
FT                   LPLAKELSDRYNVSQTILRKFLIHKVNQGILVRRGRLYAFASPLKTKTVKNFSEILFVT
FT                   RCNSWGGFTAESERELDFLRLVYQTAGEQHFKLILLGINEESGKLIDRSGKVCRLTDYP
FT                   NAIGAVLSTLLVQNPHALLQLFYGVKYPVSVWWEHPLQNIPPRFLSKNNWAFFNSTFGE
FT                   IPGQQLGKYLLQKGIKKVCYFSPYHNSSWSKDRLTGLMNSGLEVIAFTDDEFASPWDYK
FT                   EIARQRVSRFSVESYARNLVKKKLLQFAKNVPEDCNCWVCVNDEVAGIFYEMSDDGDCT
FT                   LPGDKTDPNVLGFDNSAESYLLRIASYDFNTSALIKQIFYYIENPDGFGNKKRLHQILG
FT                   QVIEK"
FT   gene            complement(142887..144218)
FT                   /gene="gid"
FT                   /locus_tag="FSU_0128"
FT   CDS_pept        complement(142887..144218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gid"
FT                   /locus_tag="FSU_0128"
FT                   /product="gid protein"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00137"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26276"
FT                   /db_xref="GOA:C9RNY4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY4"
FT                   /protein_id="ADL26276.1"
FT                   /translation="MNERVRVIGGGLAGCEAALQLASRGFQVDLYEMRPNRQTPAHRDG
FT                   HLAQLVCSNSFKALGITSAHGLLKAELTLLGSYLLDCAREAAVPAGDSLTVNRDIFSEL
FT                   VEKKIAEFPNITLHREEVTSLEGDCPTLVAAGPLASDALADDIFKRLGSNRLHFFDAIA
FT                   PVVETDSIDFDHAFYMNRWEKGETADFINCPLDKETYTEFVNKLCEAEATEPRPFEKRE
FT                   LFEGCLPVEEMARRGYETLRHGPMRPIGLGLGNNGHLWYAVIQLRAENKQKTLFNMVGF
FT                   QTRLKWGTQKEIFTMVPALRNAKFARLGCMHRNTFIESPKFLDKTLRLRPELDCAKDIP
FT                   PTWFAGQITGSEGYTEAVATGWYAAWNMAQTILHGHADPLPDESCIGSLMNRLVEENED
FT                   FQPMNFNFGLLPHHEGLKKKNKKEILAERAERAVREWIAARNMA"
FT   gene            complement(144220..144675)
FT                   /locus_tag="FSU_0129"
FT   CDS_pept        complement(144220..144675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24916"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY5"
FT                   /protein_id="ADL24916.1"
FT                   /translation="MIPVSQKESNQREKDLYYAVLSFLKSVRKAGKTTAKEWSDYRSKL
FT                   SGIAPSPEMSKATDMWTMDNLDQFQPDKTQLPPLNDMESVAKVSPEFLSQLLEALYYGM
FT                   LNLTQANLISDEIQDADPECVSTASLEELLVKLWIGNAKSYRKIVVN"
FT   gene            complement(144693..145745)
FT                   /locus_tag="FSU_0130"
FT   CDS_pept        complement(144693..145745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0130"
FT                   /product="putative phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /note="identified by similarity to SP:P15639; match to
FT                   protein family HMM PF01808"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26542"
FT                   /db_xref="GOA:C9RNY6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY6"
FT                   /protein_id="ADL26542.1"
FT                   /translation="MSEELVLKFVDPQPMRYGENSHQSAVFYRDPTCTEANLASAKQLW
FT                   GKELSYNNIVDADAALEMAREFSDGNAVVIVKHMNPCGLATGETLREALEAAWAGDPVS
FT                   AFGSVIAVTRKVDLKTAEFLKGKFVEILLAPAFDDDALKFLKNKSKDIRLLEVGEIKKA
FT                   TACKVYKHVIGGMLVQDRDIGTWEKFECVTKAQFPKNKEDLARFTWLVTKHTKSNAIVM
FT                   CYEYKPGYFQVMGLGPGQPNRIDSNLRLCQPRVRDNVARLPEAKEFFDENGKLINEAGL
FT                   KALEKKVFGEVVMGSDAFFPFPDNVEAAHDAGVRYIVQPGGSKKDDLSIESADKFGIAM
FT                   VFTGMRHFRH"
FT   gene            complement(145821..146729)
FT                   /locus_tag="FSU_0131"
FT   CDS_pept        complement(145821..146729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25620"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY7"
FT                   /protein_id="ADL25620.1"
FT                   /translation="MKKILLFVLLSVVYSSAIKCTDALYKLSPAMNYLNHDYILVQRNY
FT                   LHIFREDTTYREVYFHWDGTTTNHKLDWYENTRYILESKIEDPPYSQKGKALDDGEDIN
FT                   YSENNSAGHLVYNAFNTQEDKDAKKPAPYYSSDIAFTGDTLIQVQHRLTDDKTFIKKFF
FT                   QKNDSLFFWSTSFYGASQDTISRLDSSAFIYTNDSENEGICIEYKYNKDSLKFVLNIDP
FT                   DIEETKSFIQHGDSIIYTVTYSSGSQNGYVYLPIEMVLEKGPTTTIKKKNILPQTTARK
FT                   HRYYDLKGRINLKQIPYRVLF"
FT   gene            complement(146847..147668)
FT                   /locus_tag="FSU_0132"
FT   CDS_pept        complement(146847..147668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0132"
FT                   /product="NifU-like protein"
FT                   /note="identified by match to protein family HMM PF01106;
FT                   match to protein family HMM PF01592"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24680"
FT                   /db_xref="GOA:C9RNY8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY8"
FT                   /protein_id="ADL24680.1"
FT                   /translation="MNEEQSAKFSQKLQDIAKAPKYRGAIFQIEADEKGLALVDVKEAS
FT                   LKVYLMIDPECDKILETRFFTYGGPLFTALADSFCRKIQMATVDDACKITAESLEEELR
FT                   DTPDVRAIPEDAVEIKQMNTLISKILLIYPEKKATAIIVREKMERIKYRTQTAEGRAEA
FT                   DAEWNALTKVQKIEKIEAWLHQTVRGTLQGDGGDVQILDLTDDNRLQIRYQGACAGCGS
FT                   AMGGTLFYIEDELKNNVYYNLIVEPEDPLANLPQNPDVPGLDDNNPPASLF"
FT   gene            complement(147876..149126)
FT                   /gene="glgC"
FT                   /locus_tag="FSU_0133"
FT   CDS_pept        complement(147876..149126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="FSU_0133"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="identified by similarity to SP:P00584; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR02091"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26328"
FT                   /db_xref="GOA:C9RNY9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNY9"
FT                   /protein_id="ADL26328.1"
FT                   /translation="MSWSYSREHQKNILCMIMAGGQGSRLQPLTRDRAKPAVHFGGTYR
FT                   IIDFVLNNFINSGIFKIKVLTQFKSDSLNKHISAAWSLNASLDQYVDLVPAQMRTGDEW
FT                   YRGTADAIFQNINLITDERPDLVAIFGGDHIYKMDINQMIDFHLSRAALLTIAAIPVPV
FT                   EEAREFGIIEIDADNRMIGFEEKPKEPKQMPNRPGWCLASMGNYLFTSKFLVRELLKGA
FT                   NDGATDFGKHIIPRLYKEYPVYVYDFNTNIVRGEKASTKGYWRDVGTLDAFFEANMDLC
FT                   SENPPFDLYNNYWPIRTYNWNQPPARFFAGDNESHQGAAVDSIVSAGCIIGGGTVVKSI
FT                   LSPGVTIQKDALVEESILFPNVTIGPGAKVRRAIVEKGLHIPAGFQIGYDLERDKQLFH
FT                   VTESGIVVLAKDTIIKA"
FT   gene            complement(149280..151835)
FT                   /pseudo
FT                   /locus_tag="FSU_0134"
FT                   /note="glycosyl hydrolase, family 9; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by similarity to SP:P28622; match to protein
FT                   family HMM PF00759"
FT   gene            complement(152051..152695)
FT                   /pseudo
FT                   /locus_tag="FSU_0135"
FT                   /note="pyruvate-flavodoxin oxidoreductase, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by similarity to SP:P52647"
FT   gene            153000..154478
FT                   /locus_tag="FSU_0136"
FT   CDS_pept        153000..154478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0136"
FT                   /product="putative type II DNA modification
FT                   methyltransferase"
FT                   /note="Possibly an isoschizomer of M.SeqORFC57P found in
FT                   Streptococcus equi .; identified by similarity to
FT                   SP:P33563; match to protein family HMM PF07669"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26757"
FT                   /db_xref="GOA:C9RNZ1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNZ1"
FT                   /protein_id="ADL26757.1"
FT                   /translation="MLETICQKTNEFIAQMPKSLRKEYGQFFTSAETACFMASLFDLSG
FT                   LNKSVSILDAGAGSGILAISIAERILKQDSSIKVEVVCYENDPHVLPLLKSNLDLVKKK
FT                   YKNFSFKVIEDNYIISQRDSFNGNLFAQECKKYDLVIGNPPYKKISKDAPEALAMPVVC
FT                   HGAPNLYFLFASMGIFNLKENGQMVYITPRSWTSGAYFENFRKYLIGNTSLERIHLFES
FT                   RTDVFDKESVLQETMIFKLKKQKKHPSKVVISTTNGNGDFSRISHFDAPYDTVVSPLTN
FT                   YVYLPANKDNLEVLKKIGSFENTLPSLGMKMKTGLVVDFRVPELLESEKSESNVPLFYS
FT                   RHIKEGRVSFPAGIEHEFVSNEKQSLLQKNRNYLFVKRFTSKEERRRLQSGIYLKRKFP
FT                   GYQFISTQNKINFIDGEEELSECTVYGLYVLFNSTIYDSYYRILNGSTQVNSTEVNSMP
FT                   IPNLLQIQEMGRMLIKSKDFSEKNCDEILQEACA"
FT   gene            154475..155389
FT                   /locus_tag="FSU_0137"
FT   CDS_pept        154475..155389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0137"
FT                   /product="putative type II restriction endonuclease"
FT                   /note="Possibly an isoschizomer of SeqORFC57P found in
FT                   Streptococcus equi.; identified by similarity to SP:P00640;
FT                   match to protein family HMM PF06616"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26510"
FT                   /db_xref="GOA:C9RNZ2"
FT                   /db_xref="InterPro:IPR009528"
FT                   /db_xref="InterPro:IPR041454"
FT                   /db_xref="InterPro:IPR041962"
FT                   /db_xref="InterPro:IPR041963"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNZ2"
FT                   /protein_id="ADL26510.1"
FT                   /translation="MSNVDKIRNILIALGVPEKQQNDLCCYVLLVMAKIYPKSKWECAQ
FT                   NEWIRIHDMMSYINMFYRETPYAENTRETVRKNALHHFRTAAFVEDNGLATNSPNYRYR
FT                   LTAEFLTVLKNKGSEESVKGFLKKHESLKSIYSSKKDKQKQALSVNGLQLTLSPGKHNK
FT                   LQKAIVEDFAPRFAPNAKCLYVGDTTEKDLVKDVETLKKLGFAITLHDKMPDVVFYDEK
FT                   KDWLYFVEAVTSVGPMDPKRLVELGNLTKNVKAGKIFVTAFLDFGTYKKFAADLAWDTE
FT                   VWIADMPEHMIHLNGDKFLGPRG"
FT   gene            complement(155446..156198)
FT                   /locus_tag="FSU_0138"
FT   CDS_pept        complement(155446..156198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27320"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4J8"
FT                   /protein_id="ADL27320.1"
FT                   /translation="MPLVFCCICHSLTFNDYIFVYMDTNEILKKLDNLLGLEQKFKESH
FT                   PNWSYSDILEFRKANGWPIVNELQTPLGVLTVLDETGTKIPFLISYSYWFLYRENEERK
FT                   RFKNVLDNVTAMLMISLDANDLKERKIYRVHLSGEEIKIEDSDEYAECYTKVKDNMILA
FT                   LQQPIVNDFDHWDKDSLVNFNFEDENWKESRRYITIYDDHGFYFILKDKTIPVEFDIAW
FT                   MNMEGIGTYDCEDVLSYYLIFPQWMYYY"
FT   gene            complement(156238..159807)
FT                   /gene="nifJ"
FT                   /locus_tag="FSU_0139"
FT   CDS_pept        complement(156238..159807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifJ"
FT                   /locus_tag="FSU_0139"
FT                   /product="pyruvate synthase"
FT                   /EC_number="1.2.7.1"
FT                   /note="identified by similarity to SP:P52647; match to
FT                   protein family HMM PF00037; match to protein family HMM
FT                   PF01558; match to protein family HMM PF01855; match to
FT                   protein family HMM TIGR02176"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26858"
FT                   /db_xref="GOA:C9RNZ4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNZ4"
FT                   /protein_id="ADL26858.1"
FT                   /translation="MAKKMIACDGNEATANVAFAVSEVAAIYPITPSSPMAEHADNWSA
FT                   AGKKNIWGQVPRVFEMQSEGGAAGTVHGALQAGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   TPTVFHVTARALAMQGLSIFGDHSDVMACRQTGFAMLASSCVQECQDLALVAHASTLES
FT                   RVPFMHFFDGFRTSHEVMKIEALEDGVIRNVIDEKYVKACRERCLTPDRPTMRGTAQNP
FT                   DVYFQGRETVNPFYAKVPEIVQKYMDKVASYTGRQYHIVDYVGAPDAERVIISMGSSTC
FT                   TIGDTVKYLNGKGEKVGLVNIRLYRPFPMEAVVAALPKTVKKIAVLDRCKEPGSAGEPL
FT                   FQDALTAISEAVMAGKMAMPKMIGGRYGLSSKEFTPAMVKAIFDELSKAEPKARFTVGI
FT                   NDDVCHTSLTIDPNFKLESDFFQAMFFGLGSDGTVGANKNSIKIIGNETDNYAQGYFVY
FT                   DSKKSGSMTTSHLRFGKSIIDAPYLIGENEADFVACHHTPHLESIDMLKYAKVGATFLV
FT                   NTPHSADTVWDTFPRPVQEAIIKKHLKVFVIDAYAVAAKTGMGRRINTVMQTCFFSKLG
FT                   NVLDAETAIKYIKKYAEKTYAKKGMEVVQKNWDAIDASLANLFEVKVPAAVTSTKEFRA
FT                   PIHGNAPKFVNEVTAEIIKGNGELLPVSKMPCDGVFPTGTTKYEKRDLALNIPSWNPDA
FT                   CVQCGKCAMVCPHAAIRMKVVDESAVKNAPEGFKFTPAKGFKLEGSEKPVFAISVSSYD
FT                   CTGCGVCTQACIGKDKTDATKKAINMVPQEPIKVQQGKCWDFFVDLPEFDRTKVNKNLV
FT                   KQAMLLEPLFEFSGSCAGCGETAYVRLVSQLFGDRMVVANATGCSSIYGGNLPTTPWAK
FT                   NKEGRGPAWANSLFEDNAEFGLGMRLAITKHAKQALSLLEAVNVPAELKEKLTTQKQDD
FT                   EAGIKAQRENVAALKAALAGATDDASVSLRDEFADYLVKKSVWIFGGDGWAYDIGYGGL
FT                   DHVMATGENVNICVLDTEVYSNTGGQASKATNRGAVALFAAAGKRAGKKDLGLIAMSYK
FT                   NVYVGRIALGANDAQALKVLQEAEAHNGPSLIICYCPCINHGFDLNSQLQHQKMAVDSG
FT                   YWTLLRYNPALAAEGKAPLVLDSKKPTIPVAEYIYTENRYKQLTRNNPEVARKLADDLQ
FT                   KEVDARYAFYDAMSKDTEGLISL"
FT   gene            complement(159949..160632)
FT                   /pseudo
FT                   /locus_tag="FSU_0140"
FT                   /note="N-formylglutamate amidohydrolase-like protein; this
FT                   gene contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(160632..161393)
FT                   /locus_tag="FSU_0141"
FT   CDS_pept        complement(160632..161393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0141"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24876"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4X4"
FT                   /protein_id="ADL24876.1"
FT                   /translation="MYICVRIDDLMIKPPRLITRHSMDLKILPQPDDVTCGPTSLHAVY
FT                   SYLGYNIPLKKLISEIEFLEEGGTLGVFLGIDALKRGFKATIYSYNLKIFDPTWSKLKM
FT                   PELREKLVALHKAKHAPKLKKAIDAYIRFIDLGGTVATADLRASMFESYFKRGIPVLCG
FT                   LSATYLYRSPREYTNEKDQSVFDDIHGEPMGHFVVLYGLDEKKQFMVADPDCTNPMANG
FT                   PYYKVDKFRLIHSILLGVMTYDGNILVVEKK"
FT   gene            161476..161607
FT                   /locus_tag="FSU_0142"
FT   CDS_pept        161476..161607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26000"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4X5"
FT                   /protein_id="ADL26000.1"
FT                   /translation="MTPTASAASLGHVRQQAVARDSRFARYCEGIALADAISCYEIF"
FT   gene            161651..162247
FT                   /locus_tag="FSU_0143"
FT   CDS_pept        161651..162247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0143"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF09603;
FT                   match to protein family HMM TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24789"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNZ7"
FT                   /protein_id="ADL24789.1"
FT                   /translation="MRDFLGAFVSVFFAIAFWACSDSSVGAADEDSRAGIFVDARDSQS
FT                   YKTIEIGGQVWMAQNLNYFDASDSLYKRTSCYNDSAEYCEKQGRLYAWNVAMVACPEGW
FT                   KIPSKSDFDSLIEAVGGFDFAADSLMALEFISEIGGGYHFLEYYNYFDEYAYFWTTDEV
FT                   RANYARTVMLEKDCSSVSYDETYEEFALSVRCVRK"
FT   gene            162250..162846
FT                   /locus_tag="FSU_0144"
FT   CDS_pept        162250..162846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25379"
FT                   /db_xref="GOA:C9RNZ8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNZ8"
FT                   /protein_id="ADL25379.1"
FT                   /translation="MRFWLFTCPDDFAAEHDDIEEMFRRGLTRLILDKRGRGGNARATF
FT                   NDYDRWLLGLPMELRDRIWVRGTPDMAEELDVRGCVCDAKSFMGEVPESWKRINCVALC
FT                   KNAEEAEKLPEWVAGALVGPIMQPLSAIEPVETLGTSLSINAKASLILWGGVDTDTIDD
FT                   FKKLSSAGVASLGGVWNYADPVNAFIKLNRLVNSI"
FT   gene            complement(162922..164736)
FT                   /locus_tag="FSU_0145"
FT   CDS_pept        complement(162922..164736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0145"
FT                   /product="arabinosidase-like protein"
FT                   /note="identified by similarity to GB:AAB03089.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26015"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C9RNZ9"
FT                   /protein_id="ADL26015.1"
FT                   /translation="MKNRLGWTKVLFTSAFLASTVQADEIVDITPFYRAVDSVALGNII
FT                   NDLYNDLTLPDTIKLGGESFAITWESSDTLFLTHDGHINGRFVGENKEVTLTATVQDYL
FT                   SDKKQVVKNKVSIHGFEPYSNYLFAYFPANDNENIYYALSNDGYNFTPMNNGKRVVAAD
FT                   SVSIKKGLRDPHVLRAPDGWFYMVNTDMKSAEGWASNRGMVLMKSRDLINWKHSTVHFP
FT                   DKYKGKNFANVTRVWAPETIWDANYVNKDGSKGRPLVYYSLLTNDGTIPYDKVFFNYAN
FT                   EDFTDLEGDPIHFFDRGKSTIDMDIVYNPIDKLYHAFYKNEGDGGICKVQARTLTSENG
FT                   TKGPTWYNRSGALQQTTEAVEGAGVFKLINQNSWVLMYDCYVNGHYQFTSSSDLNTFKF
FT                   VQNTKTSGAFTPRHGTILPITAQETAALMKVFPTPDFEPKVIEIPDSIGVCDGKKVVGP
FT                   CSPTKIIPYVKVGDDGWKETTDLNVAKGATVQLGPHPWDGKIWSWEGPDGFKSTTRENT
FT                   LKNLDGTKSGYYTVTYTNETGCKSVAKIKIVVDDPDHPYEEQPPVSIGNRGTRESRKDL
FT                   RLNRNPIYFDLLGNRLSGKPRNGMFVVK"
FT   gene            164907..165992
FT                   /locus_tag="FSU_0146"
FT   CDS_pept        164907..165992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0146"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25199"
FT                   /db_xref="GOA:D9S4X9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4X9"
FT                   /protein_id="ADL25199.1"
FT                   /translation="MDRTRLKILVVDDTKTNIDVLEGILSNDYDVCVALNGKKAIELTE
FT                   KIRPDLILLDVMMPEMDGYETLRIMREKNILQGIPVIFLTAKADSKSEQIGLDLGAVDY
FT                   ITKPFNPALVTLRIKNQLQLKLQRDHLHDLVDEKTADLRRTLKVMLTSLGSLAEYRDPE
FT                   TGEHIKRTQIIVQRLAEELRKNSKFTETITPEYIENLATAAPLHDIGKVGIHDRILRKP
FT                   GTLTQDEREIMMQHPQMGYDVLQEATKELHDSPMVRIAAEMALGHHEHWNGDGYPNHKK
FT                   HDDIPIGARIMAVADVYDALVSKRPYKEPYPHEVAVKEIVKGRGTQFDPDVVDAFLAIA
FT                   DQLPEIYERFKDTSSSEECKD"
FT   gene            165989..169978
FT                   /locus_tag="FSU_0147"
FT   CDS_pept        165989..169978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0147"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26460"
FT                   /db_xref="GOA:C9RP01"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP01"
FT                   /protein_id="ADL26460.1"
FT                   /translation="MTPSPINEKKRHLSWRISLVYTIPMLVFTIVLVVVFSNFLKSTLI
FT                   TSSYSSSESKFQDKTVQDLELFFEKFEKQFKPLPQILQHTKESEIKKALKKQQQSSSYI
FT                   VDVYYGNRNGKYISASDFKLDEGKKEFRTKTWYLEASRRKGLAITGPEINEKAKKRVLT
FT                   YSYPLWDKSRNFMGAVAEDIDLQKVRQLMGDFAKAEGGITMLVGSENDSLFTYFPYETS
FT                   LHKIVVDTVAGLLHLVQDDIQFDNLSLENVTRFEKTDVENRKLIFLVMPLKNAPFYAVH
FT                   VIQKNKVVAKVQENLNAIILVVSLIVAALIFLTWLIVRFLFKFFIQKDLNESVSSSTMF
FT                   ETLLGSDNFRIILTNDTFDILHASAYIAEFFNNGNDIRGEILWKFFHSEQFKKFVYKVS
FT                   KGGEMHASERQIIIPVRSCTGEDAWWKVIFQFLVEDDGSIRYLFLISDETSGIQKDTIL
FT                   DTIMLSAGNSILVIFDKNRKVKYMSKQLTDYLVVDWKDVMGQPLENMPKCGMPEDVVVA
FT                   LKKTFDEQGVWKDTFMLQTLNTHTDTWFRGEACTLKVQESVVGYMLSMIDISEVVAARE
FT                   IAEHATQAKSEFLANMSHEIRTPMNAIIGMAHLIQETKLDERQLGFIERISHAATSLLG
FT                   IINNILDFSKIEANKQDLEITQLVLQDIIGEVAALAEVRIAGRPIELIVDIDPEIPEVL
FT                   MGDPLRLSQIFTNLINNATKFTESGSITLQIKQEQVIGNNIKLSFSVIDTGIGMTTDQL
FT                   HHLFNAFTQADGSITRKYGGTGLGLVISKSLVELMGGELQVESEYGKGSKFFFTITLAM
FT                   APQSTVPKWKSVSTFRNKNVLLVDDCERLRSVLRHYLTKLRCVVEEAASVDEALDLIQA
FT                   HEEAGETPYDLFIVDYQMPLMNGFDFVQGLPANMRKIPKILMHPIHFDEHNYHLATEIG
FT                   FNSCVAKPLQISSLLSAMQEAVDEKLTYQKAPKPEKNKIFFKEAKILLVEDNEMNQELA
FT                   VSLLNSVGLATMVAPNGKKALELLKINAFDLVLMDIQMPVMNGLDATRAIRNRSDEYFK
FT                   NVPIIAMSAKAFQKDRDDCLKAGMNSYIAKPIDPMMLYAELAKYLPVADKMPIAPSENE
FT                   PATTPSNADDSIVAMFQKVRNFDAAAGLYHANDNKNLYFKIIQGFVRDYSGEAVNLKKA
FT                   FESADFDESTRIVHTIKGLCGTIGSYHVQTLGVMLENSLLKKELNHSEFHAFESALEDL
FT                   MDDLKIVMQNIASEQSNASVIIKHVDPEAISKLTHAVEELKPAVESCSLTACKRILDTL
FT                   DKIMFSQEQETILQKLHNQIDDYDFTAAEASLKSLEETLKEPSLP"
FT   gene            complement(169956..170195)
FT                   /locus_tag="FSU_0148"
FT   CDS_pept        complement(169956..170195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0148"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:BAC72544.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27210"
FT                   /db_xref="GOA:C9RP02"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP02"
FT                   /protein_id="ADL27210.1"
FT                   /translation="MTHCPHCGAELKQGATFCPHCGSDKNTSWKEGAEYSDLETPDYEE
FT                   IVENEFGEKKKKTSPLTIVAVVIIVLAFMAAMVL"
FT   gene            170300..171208
FT                   /locus_tag="FSU_0149"
FT   CDS_pept        170300..171208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26403"
FT                   /db_xref="GOA:D9S4Y2"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Y2"
FT                   /protein_id="ADL26403.1"
FT                   /translation="MASRLISLHVILTTEGRKNPVKVFSFYILLYMNRFLSVLLLLFLT
FT                   SCSTKLAVVDEGSMQAYMPTPNKGLGFFIDKDTVVNRVQMGIRTYDKETMNLSGLSNEA
FT                   NFLENGSPKYEYAADIRYRLIRFPITLTVENFEKINSYLFKFGAGLDPYPYVDVAFAHL
FT                   QRFFEFGIAVNVGIAYEKESLKGSYIKKENTFVGNLGDVNDGSWEHEWKITGALEGYLN
FT                   VFPLKNLALTYSFTYFYPRLFDNVDGHSVSFDFPPILMNYLGASYLFAEHYQVSAGTIL
FT                   YLDSRLKQKFWHVETSIGYLF"
FT   gene            complement(171371..172369)
FT                   /gene="fbaA"
FT                   /locus_tag="FSU_0150"
FT   CDS_pept        complement(171371..172369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="FSU_0150"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26526"
FT                   /db_xref="GOA:C9RP04"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP04"
FT                   /protein_id="ADL26526.1"
FT                   /translation="MAVSYKELGLVNTKEMFAKAVKGGYAIPAFNFNTMEQMQAIVQAA
FT                   VETKSPVIMQVSKGARNYANGTILRYMAQGAVEYAKELGCANPQIVLHLDHGDSFELCK
FT                   DCIDNGFSSVMIDGSALPYEDNIALTKKVVEYAHAHDVTVEAELGVLAGVEDEVASEVS
FT                   HYTKPEEVIDFATRTGCDSLAISIGTSHGAYKFKPEQCTRNAQGKLVPPPLAFDVLHAI
FT                   EQKLPGFPIVLHGSSSVPQDEVDTINAHGGKLPDAVGIPEEQLREASRSAVCKINIDSD
FT                   SRLAMTAAIRKYFDEHPEHFDPRQYLKPARENMKKMYMHKIVDVLGSNDKL"
FT   gene            complement(172550..173197)
FT                   /locus_tag="FSU_0151"
FT   CDS_pept        complement(172550..173197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0151"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25767"
FT                   /db_xref="GOA:D9S4Y4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Y4"
FT                   /protein_id="ADL25767.1"
FT                   /translation="MENCKKYAEIAKLQGETQAIQNHIAENWEKRAATNRTIEAIQEQI
FT                   GEARSGKVSDLEAEKQAIKAQKDKLEASKNEAMDKLNALQSQMIQVTKDARGIILSMSD
FT                   ILFDVGRATLKTDLMTSLAKIAGILSVYQQFDVSIEGNTDNTGSEEFNMTLSQQRAENV
FT                   MKFLVEQGIAETRLTAKGLGMTMPIADNSTKEGRQKNRRVDLVITDRTQKVK"
FT   gene            173301..173864
FT                   /locus_tag="FSU_0152"
FT   CDS_pept        173301..173864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27251"
FT                   /db_xref="GOA:D9S4Y5"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Y5"
FT                   /protein_id="ADL27251.1"
FT                   /translation="MDGKLVLALSRASRHWSTGVTVGASAAKLMEAARAPRVKILIVFI
FT                   FAAPYFLVSFSRMLWYRTLRSSSARRDSSSFLSSFLAFSFSDLAMASRISSSLCSASAW
FT                   ASSIFPSSFRALAATSLEYEFDVMLASSLFSLTSERVASACPRERLIPLWLPEQPVRAA
FT                   RASVKEHANILAFIGASPMIDIPR"
FT   gene            173848..173940
FT                   /locus_tag="FSU_0153"
FT   CDS_pept        173848..173940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26322"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Y6"
FT                   /protein_id="ADL26322.1"
FT                   /translation="MIFRAKITFWFIKKFLHPQKNFFYLLMYME"
FT   gene            174130..175098
FT                   /locus_tag="FSU_0154"
FT   CDS_pept        174130..175098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25430"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Y7"
FT                   /protein_id="ADL25430.1"
FT                   /translation="MDSAVYLYNKYSDLSKHIEVYYSTGVPTAEASSNGDLRFGKDRNY
FT                   MYVGTAMHEMAHTMGMGTTSEYKAMIDGGVFKGEKAQKLIKEIDGPDAVLKGDSQHFWP
FT                   YGINYKSEVHSEQDLINHVKIVNAMYQDIFKEAFYMQGRVKSLSEKKCMGITSSNTLEL
FT                   MDCADTATFVKIYSMGDKPVTYRFQLGNRVIDIPNESTAAGIKASTYGYNGGAHQKYQL
FT                   EDAGVNTPNAFLLRNYKSGLYLQAVGKDVVQNPMPSRSDDFIWKIEEQRADSADKPVSI
FT                   SKRRVPNKNLEESMPERLFDALGRAAGKIRRGVTSKLLKSK"
FT   gene            complement(175539..175626)
FT                   /locus_tag="FSU_0156"
FT   tRNA            complement(175539..175626)
FT                   /locus_tag="FSU_0156"
FT                   /product="tRNA-Ser"
FT   gene            complement(175762..177456)
FT                   /locus_tag="FSU_0157"
FT   CDS_pept        complement(175762..177456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0157"
FT                   /product="peptidase, M3 family"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM TIGR02289"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24709"
FT                   /db_xref="GOA:C9RP09"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011976"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP09"
FT                   /protein_id="ADL24709.1"
FT                   /translation="MKKRNFVPENLNPDDEKEISKLYRALLQRDIPVNVEKLRQWILDW
FT                   SELESVLGEVSSRRYVAMTCDTRDEKAAKAYSDFVENIQPLMIEYDDKLNRKLMAHPSK
FT                   DALKGEFGEWLKGVQVSLDLFSPDNIPLETEENKAIQAYQKITGGMSVEFDGEVKTMQQ
FT                   LAAYMEKTDRDLRERAWKAMWNRRLQDKEALDKSYDKLFEIRKQIAKNANCKDFIDYIF
FT                   LAKHRFDYTPADCEAFHESIEKFVLPLQKEMYKRRAKKMGLERLRPWDLDVDPLSRPPL
FT                   KPYQSGDELIEKVDSIFESIHSQAGKWAREMQAKKLIDPDSRLGKAPGGYQIGFDESRL
FT                   PFIFMNSANTDRDIYTLLHESGHSFHQFALANQPIFAYRDVPAEFAEVASMSMELIGMS
FT                   NLKPFYGDDHEAIVRSTEGELADVIWLFPWVASIDSFQHRLYNFPEHTAEDRSDIWSEI
FT                   MDRYDAGVDYSGLEAVRRNLWQKQLHLFECPFYYIEYGIAQIGALQVWANFKKDPQKAI
FT                   DDLFKAESLGSSRPIPELFATANIKFDFTPKTLEPLMQVVWDELSKL"
FT   gene            complement(177463..178140)
FT                   /locus_tag="FSU_0158"
FT   CDS_pept        complement(177463..178140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0158"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26309"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP10"
FT                   /protein_id="ADL26309.1"
FT                   /translation="MKTKFSRFALSFAVAGAFALVATTFTGCSFIKKLQAAKVLIETKM
FT                   EYKDLTFDNVDVYDDVMELVNNGMDGFLPNPKAVMLVKDLSQNIINKNLGNANFDVYLN
FT                   ANNTGKDTLWINKLQIEIKFDTLVTVPLTLKDTIRLAPGDNDLHFNAAFPLDANVFKIN
FT                   QITYYGIAGFIDVSLTEGGEPVSQDFEIKRDVKPEDVEKLQNLVRDRLFDLLVNKWLGK
FT                   IIK"
FT   gene            complement(178198..180630)
FT                   /pseudo
FT                   /locus_tag="FSU_0159"
FT                   /note="sensor histidine kinase/response regulator; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00072; match to protein family HMM PF00512; match to
FT                   protein family HMM PF02518"
FT   gene            180989..181585
FT                   /locus_tag="FSU_0161"
FT   CDS_pept        180989..181585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0161"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26029"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP12"
FT                   /protein_id="ADL26029.1"
FT                   /translation="MNRYDLVLLGLILEHERSGYDIITEIRDRELDRWAKISTSTVYNR
FT                   LITLEKNECIVGHSERDGNRPERMVFNITDKGREVLRKEVLKHLTGFNDDPRTLGFAFL
FT                   YGAENKEVIRTLEVHERRLVQEIENLEKMIAEEPRPTLYPEGPFLNCMSRDHILVELKY
FT                   VRAAIGILRDPVRSKKLGGYFYINFGNRDFEKFDE"
FT   gene            181827..184355
FT                   /locus_tag="FSU_0162"
FT   CDS_pept        181827..184355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0162"
FT                   /product="putative cellobiose/cellodextrin phosphorylase"
FT                   /note="identified by similarity to GB:AAB95491.2;
FT                   similarity to GB:AAC45511.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25479"
FT                   /db_xref="GOA:C9RP13"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP13"
FT                   /protein_id="ADL25479.1"
FT                   /translation="MATKTVKKSAAKKAPAKKTAKVAAPKYGYFDDAAKEYVLTTPATP
FT                   IKWCNYVGTLNFGGIVDTTGGTLVCKGDPALNRITKYIAQMPCSDFKASTIYIRIKDGK
FT                   NYKIFSPFYVPTLVKLDKWECHVGLSYMRWIAEVYGLRVQVTIFVPTGSNTLLQDIQVT
FT                   NIAGGSKEVDIIPVYEFSHFEAEKQLTNADWVPQTMTLKGHWEKDGHVVLEQYAYMKRD
FT                   YAVNYVTADCKVGSFDGDRRVFLGQNEMGSWANPLSLQNKELANSECDRGDNIAALMIH
FT                   AGKIAAKKTFRTCTQLGQEQSLKVAAKAIKKYRDLKNVDKAFEELAKFWENYLSTIQVK
FT                   TPDASFNTMVNVHNPRQCHTTKNWSRYLSLYQLGYGTSRGIGYRDSTQDLMGVMSHMPE
FT                   EALVLTKNLISVQRPEGNAMHQYAPLALAEDTGNEANAGDSREKAGVLDANGNPAYADW
FT                   YGDDHLWIVLTVATYLKETGKMDLLNEEIPFYVAGKKHAERPTGTVLEHLKRALKFTRE
FT                   HLGQHNLPLLGFADWNDCMNLPLGAESTFNTALYAKALLEMMGIEEALGDKEAVEMYKG
FT                   WYEDVKKAFNDSAWDGKWWTRWFDKDGNGYGVSSAKYGKIYCNGQSWPVIAGIAFGDRA
FT                   VQGMDSLNKLLNTKYGVKSSTPGYRGFEPAVGGISTYPPGAKENGGIFLHTNPWVMIAE
FT                   TILGRGDNAFQYYNQINPASKNGILDVFESEPYCYPQNILGDEHKQFGMGRNAWLSGTS
FT                   TWTYQAATQFILGIRASFNGLVVDPCIPSAWAGFEATRKFRGATYQITVKNPDHVCKGV
FT                   AKMVVDGQEIDSNVAPIFTKGIHKVEVTLG"
FT   gene            184453..185142
FT                   /locus_tag="FSU_0163"
FT   CDS_pept        184453..185142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0163"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26734"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Z2"
FT                   /protein_id="ADL26734.1"
FT                   /translation="MNKLFILKCMKINLLKLFLWAFALLLLVGCSMRPLSASAFMEAYQ
FT                   SVNDSSKTVVGVSITGMRGVTSNSEEPKMDSIGNHVYGVKDEGVIDISVPVYHFIDHFA
FT                   IGGGFQYFTPFVSLGVAFDHFGVMGWGTVAAGGISVMEQISPTEELHLGLFQFASRTSS
FT                   YAGCKAVDGNCGEAFGVAIYYFEFGGGSYFMYKTGFKWHLGAEFRYSYDIDYKANRFAF
FT                   TLNLLGL"
FT   gene            complement(185155..186447)
FT                   /locus_tag="FSU_0164"
FT   CDS_pept        complement(185155..186447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25164"
FT                   /db_xref="GOA:C9RP15"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP15"
FT                   /protein_id="ADL25164.1"
FT                   /translation="MMNSIDWSVGWCYVCTVLLLLLIATILLLLDYWKRQRLYTLFAGN
FT                   LGEFIVVLSDKFEFISSMPQFMSDPLFDNLSKDRLFRDILPPKDWARLKLYFDDIDKHP
FT                   EMPFMFSYKRDDGSMLWFEMRCQHQRLSMDESRYICLIKNISNTVENQHRLDEAETKLK
FT                   SLLRNTGDFLWKFDFESRQLFLQTPMMDDDYRDVPRSGGIANIETLMPEDDFKLLERVM
FT                   NECMMKAGGQAAYDDKGHLLDEQSQLNRLANEDARFGTLKIRCWNSEKNLVWYDFRGHL
FT                   APDDEDRIVMIGSARRVETSPEIPFLMKSGVEESLINSLFNFPNIGIFWVDRNFTILGC
FT                   NNAFATDSGFAKTDEVVNQSLKDVISVKYLPYYDSMIKDVFDNGSAKSWKGKFADSDWI
FT                   TTINVVPMLKSLLKSGYTVSRVLCVYMRISG"
FT   gene            complement(186606..188300)
FT                   /gene="proS"
FT                   /locus_tag="FSU_0165"
FT   CDS_pept        complement(186606..188300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="FSU_0165"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by similarity to SP:P16659; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF03129; match to protein family HMM PF04073; match to
FT                   protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27085"
FT                   /db_xref="GOA:C9RP16"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP16"
FT                   /protein_id="ADL27085.1"
FT                   /translation="MKLSKYFYVTLRETPSDATMPSHIFLMRGGYIKPVSTGIYSMMPI
FT                   GYRVIQKIVNIIREEMNKIGGIEVDLPVVQTAELWSESGRYQAIGEELLRFKDRNNHNM
FT                   VLAMTHEEAMTDLVRYVLNSYKQLPVMLYQFKTKYRDEARARGGLIRVREFLMKDAYSF
FT                   HTSQEDLDRHYQEEYDAYLRIYRRVGIEPVVVQSDTGIMGGKVAHEFMLDTPNGEDYLI
FT                   LCKKCGYQANREIAKFQRVPFKGDENAALEKVATPNSESIEEITKFLNVPAESTAKCVF
FT                   FDFEGKLITVVVPGNLDVSEIKLHNLLKAKELYPAEDSLIKSCGMVPGFASPINSHDTR
FT                   IIVDEAIADSFDLVTGANEEGFHFKHCNPKRDFPKFEVADIAEASEVCKCPCCGELLTE
FT                   TRGIEMGNIFKLGTKFSESMGAKFLTAEKTTAPAIMGCYGIGVGRLMASVVENSHDDFG
FT                   PIWPKSIAPFQVEIVPIGKEAELMELAEKFEKELEAAGIDVLVDDRDERPGVKFKDADL
FT                   WGSPVRIAIGKKGLANGEVEWKFRNEKQFTMVKVEDVIAKAKEYFAE"
FT   gene            188344..189477
FT                   /locus_tag="FSU_0166"
FT   CDS_pept        188344..189477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0166"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27353"
FT                   /db_xref="GOA:D9S4Z5"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:D9S4Z5"
FT                   /protein_id="ADL27353.1"
FT                   /translation="MYFSVMEFLNHLREKAAVKKIEKFIPAIAFLGGFSWDSMTIGHKV
FT                   YGRDLILLSFYYLIALVSIFFIATKSVVNEDDKTEIESSFFSRILNHEWPSSWIDRLTW
FT                   AVQFCFGNLYSALVICYFKSSGSIASFTIVLFLVALLIGNEFLKQKYEKFGVSLAFFCL
FT                   LGTMFFNFLIPHLAHEMGAFWFFLSTIISAGICYLLWFKSERHKRTLVAPISISVVLSV
FT                   AYIVNWIPPVPLIVKQQVVCKNFDNETYSCDADRLNFWQRNGFSKATIHKDEGDEVYFM
FT                   SSVYGPAELKAPVEFRWYYEEPSTGKFKLTDKISSSRMVIRGGRDAGYRSYSKKKNIPT
FT                   GDYRVETAYKDGAVIGSTSFKVLEGMPKNGFVRDSLR"
FT   gene            189552..190871
FT                   /locus_tag="FSU_0167"
FT   CDS_pept        189552..190871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0167"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   domain protein/thiol-disulfide oxidoreductase domain
FT                   protein"
FT                   /note="identified by similarity to SP:P35160; similarity to
FT                   SP:P45523; match to protein family HMM PF00578; match to
FT                   protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26408"
FT                   /db_xref="GOA:C9RP18"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP18"
FT                   /protein_id="ADL26408.1"
FT                   /translation="MKLKKIALGAAALALVACGEAQKPIAKAAAITPDSADEQKFAYML
FT                   GAQFGLQNFSNLPWQTGYGIDEDATVQAFRDAIASLNDTTAKLQLPQDTLAAVSRRIQQ
FT                   SMRERYFKTQPDSTAKDLTDEQRRALVDSLRKALPVEAAPAVKNEKVTLQANASEQQKF
FT                   SYVVGAQFGNQFFSIGNQFQTQFDGDYFVLGLRDAGKRVRDTTFTMTLPDDTLKAVGDR
FT                   FMEKSKLINEERMKKAKAEEEKLKAEVASLRGDTLANGMPAKMNFKVKASGITVKSEDL
FT                   SDFAGKPLLMFYFSATCGHCAHAAPQILEIAKEFAQKGLTTVSIASGGNNKPGIRRFID
FT                   DAKFDETISVVWDESRQFGELYSDGYVPKVYLVNPNGTYKQYAAFEKEKEDLKKEIAEL
FT                   LNGKNVEWKIEVKKPEADSAKAPEVKQDAKKDTKSAKAKK"
FT   gene            191037..192938
FT                   /gene="gidA"
FT                   /locus_tag="FSU_0168"
FT   CDS_pept        191037..192938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="FSU_0168"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by similarity to SP:P25812; match to
FT                   protein family HMM PF01134; match to protein family HMM
FT                   TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26935"
FT                   /db_xref="GOA:C9RP19"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP19"
FT                   /protein_id="ADL26935.1"
FT                   /translation="MIIAEFDVVVVGGGHAGIEATHAAWKIGVKTAMLTMDLNAIGRMS
FT                   CNPAVGGVAKGQIVRDIDALGGLMGLLTDKAGIQFRMLNMSKGPAVWGPRAQCDMKYYS
FT                   EVARETMESLPGLTLIQGELASFERMNDGRLELILLNGDRYITRAIVVTSGTFLASKMF
FT                   TGLETSIGGRVGEPSADKLSECLAKNGIRLRRLKTGTPSRLDPDSIDFNECDVQHGDEH
FT                   PWPMSDRHFDGATPDKFWGDQINKFIRNDCVCWITRTNIKTHDILRSGFKDSPMFSGRI
FT                   HGKGPRYCPSIEDKINRFGDRDGHQLFLEPEQADIGRVYINGFSSSLPADIQLAAIHTI
FT                   PGLTRAKVLQIGYAVEYDSVDATQLYPTFECKNVPGLYFAGQVCGTSGYEEAAGQGLMA
FT                   GINAALKVKGEEPFILGRSESYLGVMVDDLVNILLDEPYRMFTSRAEYRLFLRSDNAEM
FT                   RLKEKARKIGMISDRDWEDWTRRRDLMASLKTQFTETSATPEEANTILEAGGQALASER
FT                   TRWINVLRRPGIDPETFFKVAAPDANITRRDQWYMYAEELYAGFFDRQEREIDDQKKME
FT                   KVKLSPDFDYMSITAISIESRQRLNAHKPLTLGQASRVPGVRPADITVLAHWLDSRT"
FT   gene            193071..193379
FT                   /locus_tag="FSU_0169"
FT   CDS_pept        193071..193379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0169"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAE19861.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25377"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP20"
FT                   /protein_id="ADL25377.1"
FT                   /translation="MAEEAEVKSTEEVKPQETKSQEKSQVKKAPSKKKRPFNGKRKGGA
FT                   PAAAKKPAVFSDSLEDRFPNLAAKLKKSIEDGIKQKIKDAQNDPKVKAASKKFAKDK"
FT   misc_binding    193494..193598
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 66.72"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            193588..193794
FT                   /gene="thiS_1"
FT                   /locus_tag="FSU_0170"
FT   CDS_pept        193588..193794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS_1"
FT                   /locus_tag="FSU_0170"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25347"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP21"
FT                   /protein_id="ADL25347.1"
FT                   /translation="MNSNPVKINGENVAAAGMTIAEYLASANYDTKRIAVERNLEIVPK
FT                   SKYAEVVLEAGDVVEVVNFVGGG"
FT   gene            193794..194438
FT                   /locus_tag="FSU_0171"
FT   CDS_pept        193794..194438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0171"
FT                   /product="putative adenylyltransferase ThiF"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM TIGR02354"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27023"
FT                   /db_xref="GOA:C9RP22"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP22"
FT                   /protein_id="ADL27023.1"
FT                   /translation="MESVRIPSREEFRRALVQKQGEEIVQKLEQATVAICGVGGLGSNV
FT                   AINLARAGIKKLILVDFDRVDVTNLQRQQYKASQVGEPKAFALVENLKEIAPYTEFEAY
FT                   DEKITEENIDKFVANADVVCEAFDNPEAKSMLVNAVLEKYPQKYLVAASGMAGTDDANS
FT                   IKTRKISKHFYLCGDGKSDVTQGLALLAPRVQICAAHEALTIIRIIAGLEV"
FT   gene            194449..195225
FT                   /gene="thiG"
FT                   /locus_tag="FSU_0172"
FT   CDS_pept        194449..195225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="FSU_0172"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by similarity to SP:P30139; match to
FT                   protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27062"
FT                   /db_xref="GOA:D9S501"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D9S501"
FT                   /protein_id="ADL27062.1"
FT                   /translation="MQMNSDKLVIGGHEFDSRFILGSGKYSLKLIEAAVKDAGAQIVTL
FT                   AVRRANTKEHENILDYIPKNVTLLPNTSGARNAEEAVRIARLSRELGCGDFVKIEIMRD
FT                   TKYLLPDNAETIKATETLAKEGFVVMPYMYPDLNVARDLVNAGAAAVMPLASPIGSNKG
FT                   LCTRDFIQILIDEIELPIIVDAGIGKPSEACAAMEMGAAAIMANTALATAGDITQMASA
FT                   FKLAIEAGRKAYLAGLGRVLSRGASASDPLTGFLRD"
FT   gene            195356..196489
FT                   /gene="thiH"
FT                   /locus_tag="FSU_0173"
FT   CDS_pept        195356..196489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="FSU_0173"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="identified by similarity to SP:P30140; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   PF06968; match to protein family HMM TIGR02351"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26235"
FT                   /db_xref="GOA:D9S502"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D9S502"
FT                   /protein_id="ADL26235.1"
FT                   /translation="MEVIQSDIRDKVLAAFDSYDASKYTARDVQFALQHDTCSIEDFKA
FT                   LLSPAAAPFLEQMAAKAKIETGRHFGNNVYLFTPLYIANYCENYCVYCGFNCYNHIKRM
FT                   QLNMEQIEHEMKVIADSGMEEVLLLTGESRAKSSVEYIGEACKLARKYFKLVGVEVYPV
FT                   NVDEYKYLHECGVDYVTVFQETYDRKRYEQLHLLGHKRVFPYRFDSQERALMGGMRGCG
FT                   FSALLGLSDFRRDALASALHVYYLQKKYPHAEMSLSCPRLRPIVNNEKISPLDVHEKEL
FT                   CQVLCAYRIFLPFVGITVSSRESKEFRNGIVKIAATKISAGVSTGIGDHESKYSGHDDG
FT                   EGGDEQFEINDGRSIDKMYADMSSEGMQPVLNDYLYV"
FT   gene            complement(196618..197409)
FT                   /locus_tag="FSU_0174"
FT   CDS_pept        complement(196618..197409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0174"
FT                   /product="pilin domain protein"
FT                   /note="identified by similarity to GB:AAA53563.1; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24740"
FT                   /db_xref="GOA:C9RP25"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP25"
FT                   /protein_id="ADL24740.1"
FT                   /translation="MKPMNSKRGITLMELMVVIAIMGILSTVAMPKFFGTAEKAREKID
FT                   LMKLYDLRNALNLALIEDIGAMDVYDPVTGVNRAQMSKDLNAGLSSNIGATLFVIELHS
FT                   NLSINVQGSHGSANDKIGNQNINICKMIGDGGTFYSALRDANFDGVADIIEARLKGVNN
FT                   YKNGGDTYSSKPYIGSDGKTTYYRTAPIRKLFQSQALNVGTIKDNKRYSLSLRWTDPDD
FT                   PYSIEVYLLENGHQWNDAYKSDYGTCFSTYGRRGCSYKKKK"
FT   gene            197588..198220
FT                   /gene="thiE"
FT                   /locus_tag="FSU_0175"
FT   CDS_pept        197588..198220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="FSU_0175"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26055"
FT                   /db_xref="GOA:C9RP26"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP26"
FT                   /protein_id="ADL26055.1"
FT                   /translation="MKKLDTTLYFITDSTSVPADRFLPTVEAACKGGATLIQLREKNRS
FT                   TREYMELAAAAHEVTKRYNIPLIIDDRVDVALAIGAEGVHVGQTDMPVKIARQLMGADK
FT                   IIGATTKTVPQALEAYEQGADYLGVGAIYPTTTKVVTILTSVDTLKAIVKAVPINVNAI
FT                   GGLNKDNIDVLKGSGISGICAVSAIMKAADPEKATRELKDAFLNLNK"
FT   gene            198260..199060
FT                   /locus_tag="FSU_0176"
FT   CDS_pept        198260..199060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0176"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25496"
FT                   /db_xref="GOA:D9S505"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D9S505"
FT                   /protein_id="ADL25496.1"
FT                   /translation="MSFVVDVGNSHTVLGIYKGDKVVDHWRLTTRKETTSDEVMNRVGG
FT                   LIHLSKIKLESVTHVGLSTVVPSLERPWVKALQTLLKRPVQVVSSSNCLNCPIAYPNPS
FT                   TLGADRLCNVIALKERGYTDAIVIDMGTATTFDVMKDGGFAGGIIIPGISASLDVLTQK
FT                   AARLLPVSIEWPKHLIANNTDDAIRAGLLFGFMAELETLVAKIKQEMAKKNVPVFATGG
FT                   WGRTIASHTKIIDTYDPYLTLDGIRLVALRGDSAAEVIDRDVEE"
FT   gene            199079..200569
FT                   /locus_tag="FSU_0177"
FT   CDS_pept        199079..200569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24931"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP28"
FT                   /protein_id="ADL24931.1"
FT                   /translation="MKSFIAGLVLAAVAFAETGFSPVISSERTRNLRGLDYAPMLFEFH
FT                   RQTVGEGRHFFTYPRRDTTFQKDFYENNRNAMVVFESDSSSSHKFAIAVSPILGIDYKS
FT                   SSALGDTIWPAIDGGLFIRGFADSLDFDLDARIYSEGHAAKKPKSYDHEVFDVQSKDRG
FT                   DGGIDYVSFARYRAHLALNYSWARLQLARDVLHWGPGYYNNLSLNQFALPYNMLSLDFT
FT                   FGPLRIYSVYADLRVNSWSYSKDNLNDRNFYGHRYELAFDRLTLGISELQILYNENKPW
FT                   LFVPIAPLFIEKGNYSERVNNGALAVDFNVQLFKLARVYGEFFLDDMESPYAVYQNRYS
FT                   NNRWAAMLGLQVARDTEVKGKLLQLGTIAEIARVEPFTYCHYDTAQAQIAHLGLPLGNP
FT                   NGPNSLTIDWTLYGRLFWNASSKFFFSLHNQWLWKGIDYGSDIDDPYKTRRKKFIDKAP
FT                   LQYTISPSFSYSGVHTSFELELIFGENRGAFVRTTFHW"
FT   gene            200642..200929
FT                   /locus_tag="FSU_0178"
FT   CDS_pept        200642..200929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0178"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25757"
FT                   /db_xref="GOA:D9S507"
FT                   /db_xref="UniProtKB/TrEMBL:D9S507"
FT                   /protein_id="ADL25757.1"
FT                   /translation="MSKMLGLFSNFRIRKRVLALADGFIVVVAGLFANFFLPLFANSID
FT                   RADQFAIFFLSVILCFSSLLFFGAYNKLWRVPFPLHVPKCFYFDYKYGTP"
FT   gene            200841..202463
FT                   /locus_tag="FSU_0179"
FT   CDS_pept        200841..202463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0179"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by similarity to SP:P39853; match to
FT                   protein family HMM PF01370; match to protein family HMM
FT                   PF02719; match to protein family HMM PF04321; match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24954"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S508"
FT                   /protein_id="ADL24954.1"
FT                   /translation="MVLTTSFGVCLFRYMFRNAFISIINTGHREAMKKRTMIIGAGNAT
FT                   KLLLDEIRNSAKDAEKGVATSNASKINPVCLIDDDRYKIGKPFEGVLVAGTTSDIPKIA
FT                   KQENIEQILFSIPSCPPKDRQVIMDLCGKTGLPVKVLPFVGTLLDTSNVGTGETNFATQ
FT                   IRDIKVEDLLGRDPIKFDNKDIRAYIENKVCMVTGGGGSIGSELVRQIAKYNPKQIIIV
FT                   DIYENNAYDIQQELVMEYGKSLNLVTLIASVRDYFRMNQIFKTYQPEVIFHAAAHKHVP
FT                   LMENNPMEAIKNNVIGTFNVATLAMFNNVKKFVMISTDKAVNPTNVMGASKRCCEMIVR
FT                   FMSMQKESNTEFVVTRFGNVLGSNGSVIPLFKRQIEQGKPVTVTHPEIIRYFMTIPEAV
FT                   SLVLEAASIAQGGEIFVLDMGMPVKIVTLAENLIRMYGKVPYKDVPIKFTGLRPGEKIK
FT                   EELLMNEEGLKKTKNKLIFIGKQIDIDTSKFINELWKLKSAASENNDEIAINALHEIVP
FT                   TFTTPEKFNSTILKKSEPVEQKN"
FT   gene            202497..204476
FT                   /locus_tag="FSU_0180"
FT   CDS_pept        202497..204476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0180"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM PF02412"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24630"
FT                   /db_xref="GOA:C9RP29"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP29"
FT                   /protein_id="ADL24630.1"
FT                   /translation="MKKIIALSLLSSSLAFSQVGMLGGSEGLHEVNAKTLGQWQINLGA
FT                   SGNITFGSWGLSRGGIYEVNGKRYSFNDADASLSGNLFVAVGVLDFIDVGASLPLYYEH
FT                   ANSQWGGKANMWTTSRGDLNLFTKIGLPFASVGVFDMALMLDLYVPTGEPNAGVRPRHA
FT                   WYLNGSSYTHPFTADRWAFGAGLALSFDFNKIGAPISWNLAASYVALASYSRTQTLVYN
FT                   TGVNWNAASWLTPFLEFSAEMRLQKVGRYKVDPLVDPMLLTPGVRFHFPHNIDFALGVD
FT                   FALRFFQSGASHRADIEYGKNHTIYYEGERGVKATYGYVGSPLFAGSALVSVKFDAAGK
FT                   SEDSDGDGIPDNEDKCARTEKGVKVDAEGCPVEDAAKIARDRAIADSLARVDSDKDGIA
FT                   DVNDRCPNTVAGISVDSLGCMLDFDKDGVADNLDQCPNTPSGVPVNSTGCAMDFDKDGV
FT                   ADYLDKCPNTPAGVEVGSNGCLLDTDKDGIADFKDKCPGTPSGHVVDSLGCLPDFDKDG
FT                   VPDVLDKCPNTLPGVRVDQNGCPLNKKEDLDQLKKGINFKTASARLTKSSYGTLDDIAE
FT                   LMIKIPEANLEVQGHTDNKGSEKRNKKLSEDRAAAVVKYLVKKGVAKDRLRAAGYGSEK
FT                   PIADNTDAAGRAQNRRVELVPFSK"
FT   gene            204651..206807
FT                   /locus_tag="FSU_0181"
FT   CDS_pept        204651..206807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0181"
FT                   /product="putative tyrosine-protein kinase"
FT                   /note="identified by similarity to SP:P38134; match to
FT                   protein family HMM PF02706; match to protein family HMM
FT                   TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25542"
FT                   /db_xref="GOA:C9RP30"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP30"
FT                   /protein_id="ADL25542.1"
FT                   /translation="MSEKEEQKVISQPTAIQVPQNANTITLLEALEILWDKKFILALFL
FT                   IVGGAVGYCVANWLRPQYTSDVLLQIDVKGGKSGKAIGDMGALLDVASPADAEIELLKS
FT                   RMILSYVVDVEHLCFQATPIGAADRFLHHEGRMDLDSLYIPQIARAEKWMARVTGDDTY
FT                   EVISPEEQVILEGKVGEMHRAAYAGDTFDIQVSRMLAQPEQMFILSQISDLGAMGALKA
FT                   SLKVAEKGKQTGIIEASYNHRYPDRAAAILNTIAKTYLRQNVEMRSAEAAKTLEFLEKQ
FT                   LPGVKAKLDSVEKILADYRYSIGSVDMTGETHAHLNKESEIQRQILDLEQQKQAAMRLF
FT                   KEEHPSVQTLIRQQNRLRAELAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNNI
FT                   QQLRVVRAGEVGNVRIVDFAQINGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMHNG
FT                   VRSVTEIERETNTSVLAKVPQNPDTGLNLKFRKTRKTHVQTDPDDPLSESIRSILTAID
FT                   FSFNMNKEHQVIMVSGIMPGVGKSFISTNLAATFAMVGKKTLFIDADMRKATCRFTKVG
FT                   LVDVLMGKVAFDNAKITSPNLPNLDILESGKFTLSAFELLRGDMLKKLIDEIRPQYDAI
FT                   IIDTPPTNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLHTLERYCDKPKAFVLNHC
FT                   EHRHGYGYGYGYGYYGSKSKKHKN"
FT   gene            207016..209040
FT                   /locus_tag="FSU_0182"
FT   CDS_pept        207016..209040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0182"
FT                   /product="glycosyl hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26934"
FT                   /db_xref="GOA:C9RP31"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR039514"
FT                   /db_xref="InterPro:IPR039743"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP31"
FT                   /protein_id="ADL26934.1"
FT                   /translation="MKSKLIFVATAVAFACGATYAQTKVVVDPGKKYQLFEGWGTSLCW
FT                   WAELAGGWDKANYTKLLGAVADPDTGLGYNIFRYNIGGGDQPGHNHLTKGDGGAAVPGF
FT                   KPTEKGDYDWTADPNQRNIAFALAKMAKDPIFEAFSNSPPWWMTNSGCVSGGVNGADNL
FT                   KSDYFDDFADYLSEVAKHFKEEWGITFRTIEPFNEPSAGWWKANGDQEGCGFKNKQSEM
FT                   IVELGKALKAKGLFPETSVSAADESNIGDALARFNSYSAEARSYMFQVNTHSYSGYDSR
FT                   AKLYNAAFAADKRVWQSESGPLHRSGSLDITLWMADVILHDLRDMHASAWVDWQLSDPA
FT                   ENWRTIAVDHKKQTFSYAPRFYMHAAFSRAIRPGSRFIDSDNSNTLAAIREDSSLVLVV
FT                   LNTGASDAKYTFDLSKFTTIGNKAKVHRFTLPAALKADSDIDVTNNAITVTAGAQSIVT
FT                   MVIENATGGSCEASTIIPYAKIHNGGWNETTEVKVNPGDSLVIGPHPYDGGRWTWKGPN
FT                   DFYYLGREVRFKNMQWQSSGVYTGTYVNPYGCESTVDIKVIVDDPEHPYVEPEKPDSGK
FT                   VNISPRVVQGAGKISVTRSGGDLLVNAGNAARNVAQSGMSSLSVNAPLQLTIHDLQGVL
FT                   LMRRSIDGSAVVPVAHLAKTPYIVRIKSAGKTVYQKKFK"
FT   gene            complement(209089..209676)
FT                   /locus_tag="FSU_0183"
FT   CDS_pept        complement(209089..209676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0183"
FT                   /product="putative iron-sulfur flavoprotein"
FT                   /note="identified by similarity to GB:AAC45465.1; match to
FT                   protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27121"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP32"
FT                   /protein_id="ADL27121.1"
FT                   /translation="MKYVILNASPRPNSNISQMLGIVRNELLACGDRVLYVDVCKLQFR
FT                   PCIGCMKCRSTHDCVMPDDDAKQVLHLVQDCDALIVGSPCYWGNMTGQLKMLFDRWVYG
FT                   MMDHSESGYPIPLLKDKKAVIITTCSTPWPFNILFKQSAGTVRALKEVLCWSGFKIAGV
FT                   LQKGGTLKNKELSSREIAKCRSFANKLHHKHS"
FT   gene            complement(209888..211030)
FT                   /gene="dnaJ"
FT                   /locus_tag="FSU_0184"
FT   CDS_pept        complement(209888..211030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="FSU_0184"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by similarity to SP:P30725; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF00684; match to protein family HMM PF01556; match to
FT                   protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25509"
FT                   /db_xref="GOA:C9RP33"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP33"
FT                   /protein_id="ADL25509.1"
FT                   /translation="MAEKRDYYEVLGVGKDASADEIKHAYKKLAIKYHPDKNPGDKEAE
FT                   EKFKEAAEAYDVLSNPEKRKNYDQFGFNAPGGGFGGGGFGGAGFDINDIFSQFGDIFGG
FT                   GFGFGGGGRRSSRKAGPPRGNDLQIKVALSYKEIFEGCTKKVRLKRYTPCTECNGKGGT
FT                   NVKTCDTCHGTGRVRRVSGGFFQMVSESVCPTCSGMGEVIANPCSHCHGEGRVQETEEI
FT                   SIKIPAGVSEGQYLNLRGEGNCGPRGGACGDLLVVIAEKPDDFFSREGDDLHCEVKVPV
FT                   HKLVLGGTQRIPTISGDEIQIKIAAGTQAGSVLRLRDQGLWPLKKQGDRGSLYVQIGVD
FT                   IPKDISREEKELYQKLAELRKDKETAQEESFLEKMKNLFK"
FT   gene            complement(211142..213043)
FT                   /gene="dnaK"
FT                   /locus_tag="FSU_0185"
FT   CDS_pept        complement(211142..213043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="FSU_0185"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by similarity to GB:BAA35087.1; match to
FT                   protein family HMM PF00012; match to protein family HMM
FT                   TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25273"
FT                   /db_xref="GOA:C9RP34"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP34"
FT                   /protein_id="ADL25273.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMEGGKPVVIANAEGFRTTPSIVAFGKN
FT                   GERLVGHVAKRQAITNPEKTIYSIKRFMGRTAGECSAAEKNMPYKLVGTGSDPVRVQID
FT                   DKQFAPPEISAAVLQTMKKIAEDYLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEV
FT                   LRIVNEPTAAALAYGLDSKKSEKVAVYDLGGGTFDISILEIDDGMFSVKATNGDTMLGG
FT                   DNFDEVIIDWINDEFKKENPGIDLKKDKMALQRLKDAAEKAKIDLSATTSTNINLPFIT
FT                   ADASGPKHLDLTLSRAKFDQLTAHLVERSMEPCRKAIKDSGLSLSEIDEVILVGGSTRI
FT                   PAVQEAVKKFFGKEPNKTVNPDEVVAIGAAVQGAVLSGDSAVKDVLLLDVTPLSLGIET
FT                   LGGVMTKLIDRNTTIPTKKSQVFSTAEDNQPAVTIHVLQGEREFARDNRTLGKFDLTDL
FT                   PKKPRGVPQIEVTFDIDANGIVHVSAKDKETGKEQSIKITSSSGLSEDEINKMVKDAEA
FT                   NAAKDKEQRELVDIKNQAEQMAYQAEGQLKEFGDKLPADTKSQLQAAIDDIKAKKDNGT
FT                   KEEIKAAMDKLQGMISSMAQAAGANQAQPGPQPGASEQPKNDKKGDGPEVVDAEVVD"
FT   gene            213445..214041
FT                   /locus_tag="FSU_0186"
FT   CDS_pept        213445..214041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26969"
FT                   /db_xref="GOA:C9RP35"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP35"
FT                   /protein_id="ADL26969.1"
FT                   /translation="MPEEISNQLLLFDIVKIYIINMGIKININIDNDIECDIESVVKDD
FT                   CKMPSSKRNIVILCVLIPFFLFMAGVSSPFWTDNYIVYALCLLPFYTYMVVISTFVNPE
FT                   WCLDYVSEKKSYAAQSCFVGMSIPTAISILGGFFGFTDYDALYHGTCVILAFNIPASIV
FT                   FTFLFGYECSRLYEVKKVQKKIFSICSIRTHRDKS"
FT   gene            214088..214345
FT                   /locus_tag="FSU_0187"
FT   CDS_pept        214088..214345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0187"
FT                   /product="prevent-host-death family protein"
FT                   /note="identified by match to protein family HMM PF02604;
FT                   match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25092"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP36"
FT                   /protein_id="ADL25092.1"
FT                   /translation="MPNIRPISDLRNNFTSVAETVHKYDEPMYLTKNGVGDMVVMSIEC
FT                   YEKQMAQLELYSKLAEAISEVERGAECADAEKFLKDLMNG"
FT   gene            214338..214655
FT                   /pseudo
FT                   /locus_tag="FSU_0188"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by similarity to GB:AAL97307.1; match to protein
FT                   family HMM PF05016; match to protein family HMM TIGR02385"
FT   gene            214655..214888
FT                   /locus_tag="FSU_0189"
FT   CDS_pept        214655..214888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:S74757"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25138"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP38"
FT                   /protein_id="ADL25138.1"
FT                   /translation="MLHVIDAKYIGDYKISIEFNDGYRFVADFKSVIKSDHRPIVQQLA
FT                   DIKFFKDFTLQVHTITWPNGVDFAPEFIKSLQ"
FT   gene            215141..215473
FT                   /locus_tag="FSU_0190"
FT   CDS_pept        215141..215473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0190"
FT                   /product="relB antitoxin family protein"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26384"
FT                   /db_xref="GOA:C9RP39"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP39"
FT                   /protein_id="ADL26384.1"
FT                   /translation="MSQTTFSIRMDDNLKKDFDKLCEEFGMSMTTAINVFARAVVREKR
FT                   IPFEVSSTKAPAYAADRRVFYNASPVASRMSMVMRQLSAEAERAGAADMTLDEINAEID
FT                   AARSGR"
FT   gene            215470..215880
FT                   /locus_tag="FSU_0191"
FT   CDS_pept        215470..215880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0191"
FT                   /product="conserved hypothetical protein TIGR00305"
FT                   /note="identified by similarity to GB:BAC90550.1; match to
FT                   protein family HMM TIGR00305"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27206"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP40"
FT                   /protein_id="ADL27206.1"
FT                   /translation="MKFYAVIDTNVIVSALLKWNSVPGVVLQAVFNGFVVPVYNDEILN
FT                   EYRNVLNRPKFGFSSELISETISQIESLGVMENALETVAEAMPDPKDIVFYSIALSHGK
FT                   TAETHLVTGNVKHFPANPIVVTPRQMLDILCM"
FT   gene            complement(215975..218068)
FT                   /locus_tag="FSU_0192"
FT   CDS_pept        complement(215975..218068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0192"
FT                   /product="putative xylanase"
FT                   /note="identified by similarity to SP:P45796; match to
FT                   protein family HMM PF03422; match to protein family HMM
FT                   PF04616"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25236"
FT                   /db_xref="GOA:C9RP41"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP41"
FT                   /protein_id="ADL25236.1"
FT                   /translation="MFGKNLIVSSVLALACTGFAQKIVITTNYTADPAPYVHGDTVYLY
FT                   TTHDEDNADGFMMYDWLLHTSTDMVNWTSHGAVASLGDIKWSSKTNGAWAEQVIERDGK
FT                   WFMYVPIHGNGISVLVADSPYGPFKEPLNKALVWQREHWNDIDPTVWIDDDGQAYMYWG
FT                   NPELYMIKLNKDMISTQGSIVTYPKIKDYQEGPWVYKHGNNYYMTFASTCCAEGIGYAM
FT                   SDKITGPWTYKGDIMPHSSRSNGNHPGIIDFKGKSYVFGLNYELWRYKSEKMGQKFQHK
FT                   ERRSVGLSEMKYNADGTIQKIDYWPDNGVAQLEDFDPYKRVEAETMSWGEDVRVRKSGT
FT                   AGNTVITNLSEGKYTKISGVEFGDAGAESFSASVLNVKKASSITVRLDKVNGEIVGKAE
FT                   FSADGLVTVPLTGAVGKHDVFFVFAGDFEADYWEFEDSKTAIPQSPFCKEKLKDAEAKC
FT                   DVPAVGASVEGPANFIDFENYDVGGAGKAYYDMDTENQGKEYREDRVDIVKNGDGFAVG
FT                   YTQKGEWLEYTVNVETSGTLPFELSYATGMESASVRFFMDNEPITDTLSLSGTDDFDTY
FT                   ATYKGKTTKELTKGEHVLKVLITSDYVNLDWIAFGKVEGDIMDKRKGTTSIKPKIAAGA
FT                   FAKIAGEYKVFDLMGNMLGKVRLNAGASLIEIKNGLKTAGFGRGVYVVRNPAGKPLKLQ
FT                   VGE"
FT   gene            complement(218238..218939)
FT                   /gene="grpE"
FT                   /locus_tag="FSU_0193"
FT   CDS_pept        complement(218238..218939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="FSU_0193"
FT                   /product="GrpE protein"
FT                   /note="identified by similarity to SP:P15874; match to
FT                   protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25903"
FT                   /db_xref="GOA:C9RP42"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP42"
FT                   /protein_id="ADL25903.1"
FT                   /translation="MAENLDERRETKDESNSSSEQAKFEQDVLKAAQDAMNLEAEAQKD
FT                   ERQETKDESVSNEEAADKTADAEGKKAEEKAAEQPAAPSAEEILKQQLADANDRFVRLM
FT                   AEFENFRRRNAKEQLELIETANGKLLEKLSEVQDNFERAFASENKAKDLEAFEKGMQMI
FT                   YNQFAKVLTDAGLEQIDPTGKEFDPNLHEALMQQPSETIPEGHVVTVFQKGYKLKNKIL
FT                   KTAKVIVSSGK"
FT   gene            219150..220289
FT                   /locus_tag="FSU_0194"
FT   CDS_pept        219150..220289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27205"
FT                   /db_xref="UniProtKB/TrEMBL:D9S522"
FT                   /protein_id="ADL27205.1"
FT                   /translation="MLNRFCVGYTSLITGMRINAFVKTYFVDEYTKNCIFITTFVSPDN
FT                   ARRNFMIKKILPISAVAALALTACFSDEASPVAPTNPNSVTSQEFSSSSAVVSSSFADI
FT                   VLSSSDNGSLHSFTQNECTVKKQSDNVVVMDYTIANSERTTMKMTLVGADVEMDLTTTY
FT                   DISVPDAEIAQMCEESKVGSETMNASVVCEGRSISVKYKDSANGHTVEDVIESANELCM
FT                   LMDKYKTPSSSSTVLSSSSITPLSSSSFEIPVSTKQKPNDATCKIEVDTENDFAITIVK
FT                   PDSIILHISASHHNDILNITEMMQFDESVPQSVITELCEEAYKEEREDPTGAIITCNDR
FT                   DFTETVTVETDMNALPVFTATLVTICDQIEETGIYIEDL"
FT   gene            220321..220944
FT                   /locus_tag="FSU_0195"
FT   CDS_pept        220321..220944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0195"
FT                   /product="putative transporter"
FT                   /note="identified by similarity to SP:P21501"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25574"
FT                   /db_xref="GOA:C9RP44"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP44"
FT                   /protein_id="ADL25574.1"
FT                   /translation="MINFIKSIYSGLCIGLGGTVYLSCDNKILGSFLFGLGLFTILNFG
FT                   FNLFTGKVGYFVNNKINYWGFLGIVWLGNFIGTFVFAKLIAATRYGAALQAKANALCVI
FT                   KNGDGFASLLVLGIFCGMLMFIAADGYKTVENQVGKVLIVFLPVMVFILSGFEHCIADM
FT                   FYFSLAGDFSMTMLKALVAITIGNSIGGGLIPLMQKLNAKSAKA"
FT   gene            complement(221044..222663)
FT                   /locus_tag="FSU_0196"
FT   CDS_pept        complement(221044..222663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0196"
FT                   /product="putative mannanase"
FT                   /note="identified by similarity to SP:P51529; match to
FT                   protein family HMM PF00150; match to protein family HMM
FT                   PF02018"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26912"
FT                   /db_xref="GOA:D9S524"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9S524"
FT                   /protein_id="ADL26912.1"
FT                   /translation="MNGSSVKPGFFVQDSFLYSKDNEKVVLRGVNHMFIWTDREGKTIP
FT                   EIAKTGANCVRIVWNTRGRISDLDNIISLCIANGMIPIPEIHDTTGNWDRLSDALEFWL
FT                   REETLQMIYNHQEYLILNIGNEPGDKAQSADEFFNAYNIIVTKLRASGVRVPIMIDADE
FT                   WGQNEKNLLNVGPKLLQADSEHNLIFSIHMWWPTERHNPVATGYETVKDRIKGTLEESL
FT                   KRKIPLIVGEFAPVAAGGVREIPYKFIMSECERLNIGWLAWSWGPGNFDSPEMDMTVHG
FT                   SYNTLIGWGKEVAVDSPLGIQNTSVIPNFIQNKDFTTGSQGTGANIIENGEFNAEDPLS
FT                   GWTTDFWGGKGDVTVKDGVVHFDIKKGGKDSWNLQFKQHFALHKGVTYIFSMRAKADKP
FT                   RTLNVNIKKDCESYTPYANGRILDLSTSWQNFSWKFTMKEETDVDAVLIFDMGGVPISW
FT                   NLADVSLVHARSVADRLNRTFQRNVQKNSGYFNAPNGPWELHLYSTDGKLLEILDKGKG
FT                   GEGMRQYPKIERSGIMVIKDLG"
FT   gene            complement(222815..223675)
FT                   /locus_tag="FSU_0197"
FT   CDS_pept        complement(222815..223675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO79588.1; match to
FT                   protein family HMM TIGR03915"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25303"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP46"
FT                   /protein_id="ADL25303.1"
FT                   /translation="MSLAIHYDSTFDGFLSAVFEIYRQHLNVSCFVAERTYEAEREAAT
FT                   DLFALPFHVETSEDSANRLKRAITNAASKDVLNLLETCFRSEDANIEMNILAYLRKLFA
FT                   GLDPNYGRNPSSLEMIPLITIARSVRREMDNMYGMVRFNKAPDGMYIAEIEPKYDILEM
FT                   IVGHFRCRFPNGTWAIIDVKRGFGVYYENYRTHFVTVPDPNYISAHAPPDEFTRMWKSY
FT                   YDTMAIKERLNPRLLRRCLPVRYWKHLPERSLSNYSAKNIGNVVPPQLPSEVAKSNASA
FT                   SIRLK"
FT   gene            complement(223717..225000)
FT                   /locus_tag="FSU_0198"
FT   CDS_pept        complement(223717..225000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0198"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR03916"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25319"
FT                   /db_xref="GOA:C9RP47"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP47"
FT                   /protein_id="ADL25319.1"
FT                   /translation="MDLRDKLNILGDAAKYDVSCSSSGSKRNSPKGGMGCGHSSGICHT
FT                   WSADGRCISLLKVLFSNACKYDCAYCVNRRSNDIPRATFTPKELINLTLEFYRRNYIEG
FT                   LFLSSAVIGTPDYTMELLIKVAKELRLVHHFGGYIHLKAIPGASSRLLFEAGLYADRSS
FT                   VNIEIPSDKQLQYLAPEKNFASIYRPMNFLAERKLEYKTDKSKYSPKFLPAGQSTQMIV
FT                   GASGETDFQILTLSAGFYKQQQMKRVYFSGYVPINADKRLPVITTKPPLLREHRLYQAD
FT                   WLMRFYKFEYNEILDEKNPFLDPDLDPKVMWALRHPECFPVDLQTADYEMILRVPGIGV
FT                   RSAQLIVSGRRYSKIRLEHLKKMGVVLKRAKYFIYDSDVPRELHKLYPEMIRPLLIAGK
FT                   PKNDQLDLFDTMPAALPQPKAAQLSANS"
FT   gene            225448..226578
FT                   /gene="carA"
FT                   /locus_tag="FSU_0200"
FT   CDS_pept        225448..226578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="FSU_0200"
FT                   /product="carbamoyl-phosphate synthetase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by similarity to SP:P25993; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF00988; match to protein family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25491"
FT                   /db_xref="GOA:C9RP49"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP49"
FT                   /protein_id="ADL25491.1"
FT                   /translation="MNEKFQWKAKRERKAFIALADGAVFHGYAFGEKKDTVGEAVFNTG
FT                   MAGYKQILTDPSYAGQFVVFTTAEVGAYATNFEKSESRQVFLNGIVVNSLDWVSKELNE
FT                   ESLHDYMLAQKKAGIAGVDTRALTLHLRTHGAQKAYLHVEDTEMTEAEAIAKAKAWEGL
FT                   DGQDYASKVSDPNGYEFNNEGKYHIVALDFGIKTNILRNLAAQDMRITVMPIGTSYEKI
FT                   MEQKPDGVFLSNGPADPNSLPQVYNMVKQLLGKIPLMGICLGNQLLGLALGAKVSKLKF
FT                   GHHGCNHPVKNLLTGAVEITSQNHNYAIDEKSLPADVEVTHINLNDNTVEGIRHKKFPA
FT                   FSVQYHPESAPGPNDSMYLFKEFKKMIEDFKGGKNA"
FT   gene            226571..229834
FT                   /gene="carB_1"
FT                   /locus_tag="FSU_0201"
FT   CDS_pept        226571..229834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB_1"
FT                   /locus_tag="FSU_0201"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by similarity to SP:P38100; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF01071; match to protein family HMM PF02142; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   PF02655; match to protein family HMM PF02786; match to
FT                   protein family HMM PF02787; match to protein family HMM
FT                   PF08443; match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26109"
FT                   /db_xref="GOA:C9RP50"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP50"
FT                   /protein_id="ADL26109.1"
FT                   /translation="MPKRTDIKKIMLIGSGPIVIGQGCEFDYSGVQACKVLRREGYEVV
FT                   LVNSNPATIMTDPEMADRTYIEPLSVDILHEIIRRERPDALLPTLGGQTALNLAMELNE
FT                   RGILDRYQVELIGAKAESIQRAEDRHLFKEAMLKIGLDLPRSGSAHSMSEATAIAHTIG
FT                   SWPLIIRPGFTLGGTGGGIAHNEEEFETIVNRGLDASLNNEVLIEESLLGWKEFEMEVM
FT                   RDKKGNAVIVCSIENLDPMGVHTGDSITVAPIQSLDDRAYQAMRDDSLKVMEAIGVETG
FT                   GSNVQWAIEPKTGRRIIIEMNPRVSRSSALASKATGFPIAKIAALLAVGYTLDELRNDI
FT                   TQSTPSCFEPALDYVVVKVPRFTFEKFPKADSTLGTQMKSVGEAMAIGTNFKQAMQKAL
FT                   RSLETGFGGFGACAKCEKFKEYDDETLAKEVARPSAERIFVVYEAFRRGWDIEKLYDVT
FT                   RIDRYFLRHLEELACFEDEITAAGSLENLAKDKALFRQAKEFGFSDIQIGYLFHKTPEE
FT                   VMAVRKQIGLVPSYYSVDTCAGEFEAITPYYYSCYADNTEPVREIPGHQSKKRIMVLGG
FT                   GPNRIGQGIEFDYCCCHAAFTLRKHGFEVIMVNSNPETVSTDYDTSDKLYFEPLTLEDV
FT                   MGIYEREKCAGVIVQFGGQTPLNLAMRLKKAGANVIGTSPEDIDLAEDRDFFKQLVTKI
FT                   GIKQAESGIAHNVEEALAIVDKIGYPVLVRPSFVLGGRGMVIVYKEKYLRKFVEEAAAI
FT                   GEGKPILIDRFLEDATELDVDCISDGKHTVIGAIMEHVEPAGIHSGDSASVIPPMTLSK
FT                   EIQDKVREFAKEFAKELHVVGLMNMQLAVKDGELYMIEVNPRASRTVPFVSKSIGVPLA
FT                   SYATRCMTGESLEQIGFTEEVRVPYVSVKEAVFPFVKFPGVDITLSPEMKSTGEVMSLD
FT                   RDRGLAYLKSQLASGNKVPSQGNIFVSLKDEDKQKAVPLIRQLVNLGYELYATRGTSTM
FT                   LYNEGIKTRAVFRISRGRPNLLDLIHDKEVQWIVNTTETGAEAMVDEIQMRSKAVVSGI
FT                   PITTTIAALTSTVEGLMDKHDFGRFEVCSLQEYHRHVKK"
FT   gene            complement(230033..230797)
FT                   /locus_tag="FSU_0202"
FT   CDS_pept        complement(230033..230797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ16245.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26717"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP51"
FT                   /protein_id="ADL26717.1"
FT                   /translation="MDPEYKRGWLSLSAKETDKIMLYRFFSYNSNTLGPLICGGLYFSS
FT                   PKDFNDPFDCNFRMKPTAIEKQYGISWDSTVDEFKADVHKMGFVCLSPHWDNTLMWAHY
FT                   ADKFNGFCLGFEFNNPLCRNVDFEEPFTTFRGKAYYILDFWLHEMIYANKDEYPTGTSF
FT                   GFDEIEEEMPEAIIRYKASDWQYEHECRLSFRGGNGIHPIPGDLKEVYFGLRMDDEKKR
FT                   VLTSILGKYHPTFYNTNKSETYIKVDRILFEF"
FT   gene            complement(230837..232015)
FT                   /locus_tag="FSU_0203"
FT   CDS_pept        complement(230837..232015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0203"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24586"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RP52"
FT                   /protein_id="ADL24586.1"
FT                   /translation="MTRLIIALVTIIFLTSCGDDSSSNTNLTNKIDLPASSTIDLFSSS
FT                   SDVSKMICDSVGTCFKSPLETCSKRPYNSECVKSCDAYYSCENDYICASEWRDNSIFFD
FT                   VCLQACFDFKDSLINGNLYCFDLLRYGNTGHYLDEICNSTSNYCSYDWKIEPCTNENCM
FT                   KDTRDGQIYKITTIGKQTWMAQNLNYRGYIFPTAMRDSLSYCYNDSCLKYGRYYTWAAA
FT                   MDSAAIFSTGGKNCGYFSYDTICKPKYPVQGICPYGWHLPTIEEWRLLVTTVGGEDVAG
FT                   QILGATTGWWLNNEKNKNSVNFDIFPTGYADFVGSTINFIDLGYGGKLGVLGVGKSAKF
FT                   WSSSYHNPSTINGVSDHKIFGAEGLYYSPEYVNTTNGVGFVSFARSVRCVKD"
FT   gene            232776..234011
FT                   /locus_tag="FSU_0205"
FT   CDS_pept        232776..234011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0205"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAN49025.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25744"
FT                   /db_xref="UniProtKB/TrEMBL:D9S531"
FT                   /protein_id="ADL25744.1"
FT                   /translation="MQYSSKLLGFNEKKIKPLSWSFLPPSKKAKNSPTTRMPKRIRHRR
FT                   NFGPNKASILEFFAFLRKKSAQSVHCHILTLQEYIFAGNAKTPAFFACRRPEVNMNRSE
FT                   FIAMAKDVHEHPEHLADYRKIYKNVYPFSDGIFKMLIANEAKPERTVKFLNAMLGLTGD
FT                   KAIKTYTLGVPENPGVLNDKTAIFDIYGTTQAGEPVLIEVQQNFNTLFVDRLIYYTARV
FT                   ISRTVKKAQDYNLPHIYVLSILTENQFPRERDTYLHHAQLVRNRHLFYSKLDIYLVELE
FT                   KFFAIEDRTLPENREQSDRAEMLRIFRDVLEDKDIPEEKLKRLLDKDFANDVSFKGYTD
FT                   ETLLNEVDGMTDMLYEKQGSYLQGKDDERNEIAIAMLAEGDSIEKIARVTKLSENDVRK
FT                   LQAEQVRETASA"
FT   gene            complement(234087..235583)
FT                   /locus_tag="FSU_0206"
FT   CDS_pept        complement(234087..235583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0206"
FT                   /product="xylanase"
FT                   /note="identified by similarity to GB:AAB53151.1; match to
FT                   protein family HMM PF02055"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25362"
FT                   /db_xref="GOA:C9RPJ1"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ1"
FT                   /protein_id="ADL25362.1"
FT                   /translation="MTYSMKGFSLFAGSIAFLSTLACAATINVDMGKEYQRISGFGAAS
FT                   AWAGSITDKNAAFLWDSTSGAGLTLHRIRIAPDGSTSETSIAKKASEYGVKVWAAPWTS
FT                   KYTVNYDGDKKHLDFNHAQDWANTILKFTQDMRKAGVNLYAISSQNEPDGTGDNHYEPD
FT                   ELARWVGDYLGPTLDTTGIKIIGTEAINWYGFPNYKKAFFNNPAALKYTDIFGTHEYGG
FT                   DPAAYPEIHEAGKEFWETEVYDLGSNKEDVGMGSALRVANMIHDALTISNMNAWHFWWI
FT                   YSCSEPSCGNGALWPQGQGNPDNVEPTKRLWVMGNYSRFARPGARRIDATKKPERDVKV
FT                   TAYRDSLKTKIAVVILNSKNEEFKADFDFGSTKIGSFKPYVTDDNNNLKEGSEVKVDGS
FT                   KCSYSAPARSATTVEFILWQEPKVEPPKDSTESIAFGRLSVPQKRQSTYKVFSPIGAFI
FT                   GEFQAEHIDELRNAMTSAGLSRGVYMVKLGNAKTQRMVLR"
FT   gene            complement(235703..238297)
FT                   /locus_tag="FSU_0207"
FT   CDS_pept        complement(235703..238297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0207"
FT                   /product="SNF2/helicase domain protein"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24615"
FT                   /db_xref="GOA:D9S533"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D9S533"
FT                   /protein_id="ADL24615.1"
FT                   /translation="MWIMQKFSLKNIRFLIGEFEKRLADLRSFSDFTSKAETAVKESAD
FT                   AVLNSLIKEKLEGVFLGRLDLEPETLLSLTERKVTNASHLMGVSESVLANAFAVPAADA
FT                   KKIVEYVGEHYENARKSVNVKLNVDEKTRESSDLVRALYAYRHGLSLAQKCQELLKENE
FT                   ARVIENINALRPYTSSFRFVATLLFNKEAKVRFNSLNELYESDFWQRSASLLSELQTLI
FT                   TADPSFAWEAFSQSPIPFFTDLERICPYALGNEEIVSSELPKEILDERTNLDGLKTQLR
FT                   QYQVLGVKFILHQGRVLLGDEMGLGKTVEAIAALVTLKNLGETHFMVICPASILVNWIR
FT                   EIQKLCDIPAVKIHGPDKFIYFDAWKKNGGVAVTTYETSRQLELSEKDSISMVVVDEAH
FT                   YIKNPGSQRTVSVRKICKHSNRLLLMTGTALENRTKEMLFLLQILRPKIASMAMGFAKE
FT                   STSQEFMQMIAPIYYRRKREDVLKELPELIEEESWIEGGDAEMAAYEEAAVKEEFMTMR
FT                   RVSFNVDDFEQSGKLKRIKEIVRQAKFENRKVLVFSFFLETIKKVCAYLNDSCMEPITG
FT                   AVPVSHRQEIIDAFEKSPAGTVLPLQINAGGLGLNIQAANVVILCEPQLKPSAEMQAIS
FT                   RAYRMGQVRNVLVYRLLMLDSIDEKINTLLKFKKQVFNTFADKSLSGTQDLEISPDEIK
FT                   NLFKKEVERIRAAQGSVPTDKSLIAENEWLGKETNEEINEFGYREHDPVLITPDFMRKT
FT                   CERYNELYFEGMLDVDRLTFELDYSSSYLACFVPSYLSIVFSRHFEFDYRKYRNTMVHE
FT                   MCHYYLYSFSIENRSDNTFKYETVHGKAFQDLVDRLNSKHAELNVMLRDCDC"
FT   gene            238489..240063
FT                   /locus_tag="FSU_0208"
FT   CDS_pept        238489..240063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0208"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24845"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ3"
FT                   /protein_id="ADL24845.1"
FT                   /translation="MKKKWLAVIAFSLLSTACSDDNIGNFPSAAGAENPTSAGIESSGI
FT                   ESSADSPDAESSSAFSSSSVMSSSVESSAESSTESSAESSSGTESSSSATPKSSATNFL
FT                   DTPFGDYEYAITDSYEGGAGGFGGGFSDATTSTKGGGAGGLTGGAGGVSVTGGSPGGAG
FT                   GVGGTSGAGGLGGTNNRTSGLLTAGEWNDLDNWKFWSGLLNENKYYDKTSYWKFYPKNL
FT                   VAVQVVDGNNTAIANVPVELLKGGTVLFSTKTDNAGFAYCWQSLFANDDSDIVEADYSL
FT                   NVNGASYTEPVKFTSLGDEQVNVNVVVSADAKLAAAKADIAFIVDATGSMTDEIRFLIS
FT                   DLNYIIDHASLGNNVALRTAALFYRDVQDEYITRYDDFSDNVSTTQEFVAKQKAGGGGD
FT                   YPEAVDYALEASLQKLSWNESARARIAFLILDAPAHHKDNVIESLQKSIALFAQNGIKI
FT                   IPVAASGVDKDTEFMLRFFELATGGTYVFLTNDSGIGNKHIEASVGDYEVEKLADLMVR
FT                   LIKKYIE"
FT   gene            complement(240153..242849)
FT                   /locus_tag="FSU_0209"
FT   CDS_pept        complement(240153..242849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK48233.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26915"
FT                   /db_xref="GOA:C9RPJ4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ4"
FT                   /protein_id="ADL26915.1"
FT                   /translation="MSENTSNDTQNLDSSAFTRVKNHYEALRSELGNNQRSSEYTIAEY
FT                   GSCGEVVPDIKTTNDQPVWSQVNYKFLENKYNVKDNNHLCVHPNLWENGASNHLSGVFE
FT                   VLKGKIYQVRGYDMSNLTFVRSNPPIEGCRDIELPRWIVFDTLMSNECTDAAMKLFEEY
FT                   LKETLSGYSLSGSIVGMIISHSHIDHYGGMETVAKYFIDSGNGNIDEKESENDVKKVAN
FT                   RFILAPAGFYDHSVSENVYLGNAMGRRASYQYGSFIKPSDPNDVHGEISIGIGQGQSTG
FT                   RPSAVGKPTIEISKNTTLILDKIKVEFQLTPGTEAPAEMNNYIPEYRALWLAENCSGTL
FT                   HNLYTLRGAEIRDAKAWASYLMQTALLYGDNTDVIFQSHNWPHWRSKTDEKGNVLDVDI
FT                   RKFIIDTASIYKYIHDQTLLYMNMGYKMDEVADMLVLPRGIQKNWSLKPFYGTPVHNAK
FT                   AIYQKYLGWYDANPIHLQELPPEQLAKEMMRYMQAGSKEKMLSMISDDIAAGNFWTAAY
FT                   MANQIILAGDENESVAKDLCASALQQLGYQCESGTWRNAYLSAAYELRNGKIHSKRSSS
FT                   DSTAQMPAETLLDYISIFFDGERAASKISCDMYLKVPEDATTSYFLFVVKNGAILYHKV
FT                   ENADQIKAISGSATMVTLQDLRLVAAGKYTGSCGALKQISKAMVSIDCDRFKCFDIIDK
FT                   HDGEVLFEKDKNAKTDEERYEKVDLKKEVEDCIDLLEQYTDKFKKEDDVVHLSNVDIPR
FT                   WERYYNLLKVQTQVILDGDFFIPGDATMGIGKDNQFMSYELYYTLYSLYRYLYRSYLKN
FT                   DYGYKFTDSSKSTEFIKLKEKIVLLETYVADFYLSKSKDEVVFEEGDALAWCYLNNDDD
FT                   TTDVSFSVAYFFGLLYNLYKKFSDEIK"
FT   gene            complement(243167..243646)
FT                   /locus_tag="FSU_0211"
FT   CDS_pept        complement(243167..243646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0211"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:BAC52278.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25261"
FT                   /db_xref="GOA:C9RPJ5"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ5"
FT                   /protein_id="ADL25261.1"
FT                   /translation="MKLLREIVGYVLGGVLFVGLIPTLMWLASGMPDLLPIDIARGGVV
FT                   IAIMLAGLALSIWTIVYMKRRGKGNPMDAFGHEVAPRTSHLMTDGPYRLNRNPMLTGTF
FT                   IYLVGAAVWIWHWQALLVYAAFVAIMMVQVFSEERRLRRDFGKEYEEFCKIRRRF"
FT   gene            243788..244636
FT                   /locus_tag="FSU_0212"
FT   CDS_pept        243788..244636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26823"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ6"
FT                   /protein_id="ADL26823.1"
FT                   /translation="MKLSYRTMIASLIGLTFCFFACANDENGMKADGTLDYEAIKDSTL
FT                   HWNVTIYRIQKFNGDTSEWDALDCRVHDSNFNCRRVTNVDCNRDIVRMLSCRDANNNFI
FT                   ECPGYKDTIYDTTYKNLNFGKDALVNYIPVAKIPAFNRDSVAKLFSKISGEPCSRLLSF
FT                   SSNYHLEAIGLPDSLTLNLEREYIPEEYIRPKDFFVHLSLITNESTGEKTCRQDSSRIM
FT                   YNFYPGTCYYSSLPEKAKVVNYELFNTTIQSYKDTTISWKLVYKDQYGRGDTLDITTKF
FT                   E"
FT   gene            complement(244856..246718)
FT                   /gene="pckG"
FT                   /locus_tag="FSU_0213"
FT   CDS_pept        complement(244856..246718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /locus_tag="FSU_0213"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="identified by similarity to SP:O83159; match to
FT                   protein family HMM PF00821"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26479"
FT                   /db_xref="GOA:C9RPJ7"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ7"
FT                   /protein_id="ADL26479.1"
FT                   /translation="MSLTLNDIKHPKISTWVNEMIAMCEPDNVVVVDGTQEEYDALMQK
FT                   CVKAGLATKLAKKENCYLFRSLPSDVARVESRTFISSVKEEDAGPTNHWIDPSELKQTM
FT                   RKLYKGCMHGRTMYVIPFCMGPLGSPISKNGIEVTDSEYVVLNMDIMTRAGKKVLDIFN
FT                   ADVNAEFVPCLHSVGKPLRECESDNGIWPCADVEYKYITQFPEERLIWSYGSGYGGNAL
FT                   LGKKCFALRIATVLARDEGWLAEHMLILKLTNPKGEVKYVTGAFPSACGKTNLAMLIPT
FT                   IPGWKVETIGDDIAWMKFGKDGRLYAINPEAGFFGVAPGTSAESNKNALVSAEKNTIYT
FT                   NCALTEDGDVWWEGIGYPAQGKLVDWKGKTRDALPKDKAPKGEEMAHPNARFTAPAKQC
FT                   PCIAKEWEDPAGVPISAILFGGRRPSTIPLVHQSLSWNHGVFLGSIVGSEITAASTIDA
FT                   SQVGKIRRDPFAILPFCGYNMGDYFKHWIEIGQKSTEDKLPKIFYVNWFRKDANNEKLP
FT                   GGFMWPGYGDNSRVLAWIFDRCNGVDNAVETPIGYMPKEGAINTDGLADYYKETLPQIT
FT                   KVDVEGWKKELADVKENHYPKFGKHLPKELSEIIDMIQDRLNKA"
FT   gene            246905..247963
FT                   /gene="romA_1"
FT                   /locus_tag="FSU_0215"
FT   CDS_pept        246905..247963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="romA_1"
FT                   /locus_tag="FSU_0215"
FT                   /product="romA protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25742"
FT                   /db_xref="GOA:C9RPJ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ8"
FT                   /protein_id="ADL25742.1"
FT                   /translation="MITTIILTVLFLLGDAGVLFLSQESFGKLPQGKHLERVKKSPHYD
FT                   GKQFVNDEETEFMTGNKSTLTVWREFMFNKKKNTVPDTAIHAIKTDLRKLPNDKDWIVW
FT                   FGHSSYLVNLSGKKILVDPVFYKGSPVKFANKMFKGTDIYKPADMPDIDYLVITHDHWD
FT                   HLDYETVTELEPRVKKVVTALGVGSHLEYWHYPVNKLIELDWWEKAQLGDSTRVTATPA
FT                   RHFSGRDLHKNKTFWASFVYESPKRTIWIGGDGGYGSHYSKIKANFPNIDLGILENGQY
FT                   NPDWAQVHTMPQYLGREMLELGAKRYLTVHHSKFCLSKHPYYEPLENAKKAAQESGKPL
FT                   LMPLIGEVVYLD"
FT   gene            complement(247964..248638)
FT                   /locus_tag="FSU_0216"
FT   CDS_pept        complement(247964..248638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0216"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24911"
FT                   /db_xref="GOA:C9RPJ9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPJ9"
FT                   /protein_id="ADL24911.1"
FT                   /translation="MKVCEIFKSIEGEGIRMGQAAVFVRLHGCNLRCSYCDSMYAVEGP
FT                   DFKQMSVGEVLAAVEMYRNESGVKCVTLTGGEPLIHEGVGELLTAFSDAGFEVNIETNG
FT                   TVPCKWQLPGLFYTMDWKCKSSGMSARMKMENIISLGKNDVLKFVVGSVEDLQEAEGVV
FT                   ARLSLTSPDNMPHIFISPVWGELTNEQIVNWMVGSKVMTQNNARFQVQLHKIVWDPDMR
FT                   GV"
FT   gene            complement(248672..249001)
FT                   /locus_tag="FSU_0217"
FT   CDS_pept        complement(248672..249001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0217"
FT                   /product="putative 6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /note="identified by match to protein family HMM PF01242"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26213"
FT                   /db_xref="GOA:C9RPK0"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPK0"
FT                   /protein_id="ADL26213.1"
FT                   /translation="MYRVIKRIEISGAHKLSLPYESKCRGLHGHNWIITVFCQSETLDE
FT                   NGMVVDFSRIKEIVKGKLDHQFLNDVVNFNPTAENMARWICEQVPHCYKVQVQESEGNT
FT                   VEYEV"
FT   gene            complement(249003..249656)
FT                   /locus_tag="FSU_0218"
FT   CDS_pept        complement(249003..249656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0218"
FT                   /product="protein ExsB"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25241"
FT                   /db_xref="GOA:C9RPK1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPK1"
FT                   /protein_id="ADL25241.1"
FT                   /translation="MKDALLVLSGGMDSVTLLYDRAADIALAVSFDYGSNHNDKEIPFA
FT                   RMHCEKLGIPHITIPLKFMHDYFTSSLLSGADAIPEGTYADENMKSTVVPFRNGIMLSV
FT                   AAGLAESRDLKRVMMANHFGDHAIYPDCREEFVKNMSAAISAGTYANITIDAPYTNISK
FT                   ADIARKGKALGLDYSETWSCYKGGKIHCGKCATCLERKAALAEAGINDTTEYEA"
FT   gene            complement(249759..250424)
FT                   /gene="bioD"
FT                   /locus_tag="FSU_0219"
FT   CDS_pept        complement(249759..250424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="FSU_0219"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24799"
FT                   /db_xref="GOA:C9RPK2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPK2"
FT                   /protein_id="ADL24799.1"
FT                   /translation="MSKGYFVTATGTDVGKTFITGLLVKKWRDSGIDAGYYKAALSGAE
FT                   LRDGKWIAGDADYVKRIAGLSDTQEQLVSFVYKEAVSPHLAARKEGNLVNLSKVQADFN
FT                   AACSRHEFIFAEGSGGIICPIRYDDQKIFLEDIIKTLKLPLIIVTTAALGSINACVLTI
FT                   EYARSRGLDIRGIIVNRYGCSGNFEMEDDNIRMMQDLTGLEILAKVKEGDSDLGVAVF"
FT   gene            complement(250421..251626)
FT                   /gene="bioF"
FT                   /locus_tag="FSU_0220"
FT   CDS_pept        complement(250421..251626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="FSU_0220"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00202; match to protein
FT                   family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26887"
FT                   /db_xref="GOA:C9RPK3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPK3"
FT                   /protein_id="ADL26887.1"
FT                   /translation="MNERILDFFTKDALEAARANNTYRTLRHISSPEASHVTIAGKDTV
FT                   LLASNSYLDLANIPELKQAMADAVLEWGTGSGGARLTTGNKTPHDKLEEFIAKFKGEEA
FT                   AIAFNTGYMANVGTISALCGKNDFIFSDELNHASIIDGIRLSRAKCFVYKHNDMADLER
FT                   AIETAKVEFCAREKLAENAVSNFRGLIVTDAVFSMDGDLANLPELLRIARARDCLLMID
FT                   EAHATGVLGRTGRGLAEHYNCEHADVTVGTLSKAVAAEGGFVAGSKQLIEFLKNKSRSF
FT                   IFTTAMAPAVAAAALHNLQFIDAHPERVQQLRDNVKFFCDALRFHGLQVPQTESAIIPI
FT                   IIGDEAKALRISETLQNEGVLIPAIRYPTVAKGQARLRASLMATHTKEELEFAAAKIAE
FT                   AI"
FT   gene            complement(251742..252524)
FT                   /gene="bioW"
FT                   /locus_tag="FSU_0221"
FT   CDS_pept        complement(251742..252524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioW"
FT                   /locus_tag="FSU_0221"
FT                   /product="6-carboxyhexanoate--CoA ligase"
FT                   /EC_number="6.2.1.14"
FT                   /note="identified by match to protein family HMM PF03744;
FT                   match to protein family HMM TIGR01204"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26496"
FT                   /db_xref="GOA:C9RPK4"
FT                   /db_xref="InterPro:IPR005499"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9RPK4"
FT                   /protein_id="ADL26496.1"
FT                   /translation="MDYYSLKMRASQHVGEGENSHEQHISGAERIVGRDSVEAVCAAMV
FT                   RRAMNHSKGDPDFINVKIEKVHESDIQVLKSLPVTRVDVETWQEGLEKAFGLITPLMAL
FT                   RQAQGPCDGAKKFKEKLQDLLRETFPMRGAMLYDIATGNRLEPDKDRGVRATYMDALHS
FT                   SEVDGCKNHFNEAIVLATKVANAPGMVAEFCVSDDPNYVTGYVASKELGYVRIMKMKEM
FT                   GDENGGRIFLFDSRKASAEECIEYLQKKKVLVDVVGRT"
FT   gene            252634..253947
FT                   /locus_tag="FSU_0222"
FT   CDS_pept        252634..253947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0222"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25492"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A7UG35"
FT                   /protein_id="ADL25492.1"
FT                   /translation="MGDYKKFIADFPVDSAEFFTAITYATTELYISMHVLDLENNTAFP
FT                   IKTNEFIDKFMKCGSTLQESITNIMVNLACPESVSTIKNFTILSTLSERMKNANVISEI
FT                   FHGKIHGWSKAMFVRVGDDKPLRRVLYVVENVNAQMTKLEQEKELLEQNRKQQNMINAL
FT                   MNGYASVVGVDFVTEKVEFFRTSDRIKSALGFMKEPPPFKILVEKLINTAVHEEDRKSI
FT                   REVADESYIKEYLPVGNSLSKIFHNEVGQYVEMKIVRTGEETTVFGFTDKNNEITEIND
FT                   KIYKDSLTQVMNRKYFDDKLALRNSQAVVMADIDFFKEVNDNYGHQCGDAALAAVASIL
FT                   NSSVRNLDRVVRYGGDEFLISFKGITHEVLRNRLEQMRARAEKIKLQDYPDVKLTMSFG
FT                   GTFGDGIVSDMLSFADKALYVSKKKRNCVTLVPFEEKI"
FT   gene            complement(253955..255286)
FT                   /gene="bioA"
FT                   /locus_tag="FSU_0223"
FT   CDS_pept        complement(253955..255286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="FSU_0223"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26513"
FT                   /db_xref="GOA:D9S547"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9S547"
FT                   /protein_id="ADL26513.1"
FT                   /translation="MNTLLNFDSEHLWHPYAALKNTPARFLAKSAHGTTIETADGLKLI
FT                   DAVSSWWCMAHGHNAPEIVEAIRKQSEKMCHVMFGGFTHEPAIELGEKLVNFLPEGLNK
FT                   IFFADSGSIAVECAAKMAVQYQHSLGRPERCKLVALKGGYHGDTAGAMALSDPDGMHVL
FT                   FRGIMPHHYFAERPNCRFDSAWDDSDFASMERVVEEHKDEIAAVICEPVFQGGNGMWLY
FT                   NAGYLRRLRELCDRYGILLILDEIASGFYRTGPRFAMMHTATQDCADFIKPDIMCVGKA
FT                   LTGGSITMAACVASEKVADTITNSKIPAFMHGPTYMANPLACAAGIASLSLFESRDYAS
FT                   SVARIEKRLKANLEPLRSLENAADVRVLGAIGVLELKAKPSADDILRVIRETGVWLRPF
FT                   CNYVYTMPPFITSDAEVERICEAIKMIGKCEPAPIVDGEDEFHE"
FT   gene            complement(255402..255983)
FT                   /locus_tag="FSU_0224"
FT   CDS_pept        complement(255402..255983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0224"
FT                   /product="FMN reductase, NADPH-dependent domain protein"
FT                   /note="identified by match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26358"
FT                   /db_xref="GOA:C9RPK7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPK7"
FT                   /protein_id="ADL26358.1"
FT                   /translation="MKVILFNGSRRENGCTYTALNIVANQLKAAGIETKIVFVGGRVLK
FT                   GEVNEVVHEAKELLETADGVVYGSPVYYASPSGEMLMFLDRLYGIAEANLLFKPAANVV
FT                   SARRAGTTATLDVLNKYPTYAQQPLVTSRYWNMVHGSNPEDVLKDEEGVQIMKELGRNM
FT                   AWLLKSIDAGKQAGVTQPDAKQKVYTNFIR"
FT   gene            complement(255980..256528)
FT                   /locus_tag="FSU_0225"
FT   CDS_pept        complement(255980..256528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25115"
FT                   /db_xref="GOA:C9RPK8"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPK8"
FT                   /protein_id="ADL25115.1"
FT                   /translation="MNYLIVPGLNNSGPKHWQSFWEKSLPNATRVIQRCWDHPEKADWV
FT                   ETLDKCIQQLNADTILVAHSLGVCTTVNYLLKAKSQGGVPPYIKGAFLVSPSDVDNVEL
FT                   IGNFAPMPLEKLPIPACVVASENDPFVSMERSEFFASAWGVKLFNAGALGHINSDSDLG
FT                   EWEQGRKFLAEFESTEVLK"
FT   gene            256765..257814
FT                   /locus_tag="FSU_0226"
FT   CDS_pept        256765..257814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0226"
FT                   /product="licheninase"
FT                   /EC_number="3.2.1.73"
FT                   /note="identified by similarity to SP:P17989; match to
FT                   protein family HMM PF00722"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24776"
FT                   /db_xref="GOA:P17989"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR008264"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="PDB:1MVE"
FT                   /db_xref="PDB:1ZM1"
FT                   /db_xref="PDB:2R49"
FT                   /db_xref="PDB:3AXD"
FT                   /db_xref="PDB:3AXE"
FT                   /db_xref="PDB:3H0O"
FT                   /db_xref="PDB:3HR9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17989"
FT                   /protein_id="ADL24776.1"
FT                   /translation="MNIKKTAVKSALAVAAAAAALTTNVSAKDFSGAELYTLEEVQYGK
FT                   FEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQ
FT                   KTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNL
FT                   WSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWG
FT                   KGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDDEPAPQSSSSAPASS
FT                   SSVPASSSSVPASSSSAFVPPSSSSATNAIHGMRTTPAVAKEHRNLVNAKGAKVNPNGH
FT                   KRYRVNFEH"
FT   gene            258003..258482
FT                   /gene="ssb"
FT                   /locus_tag="FSU_0227"
FT   CDS_pept        258003..258482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="FSU_0227"
FT                   /product="single-strand binding protein"
FT                   /note="identified by similarity to SP:P02339; match to
FT                   protein family HMM PF00436; match to protein family HMM
FT                   TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27239"
FT                   /db_xref="GOA:C9RPL0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPL0"
FT                   /protein_id="ADL27239.1"
FT                   /translation="MAYLNKVMLIGNIGKDPEVRVNPNGGRKRVSFSLATSRRYRDNNG
FT                   EQKEQTDWHNIIGWGKIADIVEQLGIRKGMSLYVEGSLTNRSWTDQTSGQKRYVTEINM
FT                   DTFQLLTPRGQGGAPGAGGFSQANSYQPNSFNGMQQNSAPAYDAGMAEDDVDLPF"
FT   gene            258725..259444
FT                   /locus_tag="FSU_0228"
FT   CDS_pept        258725..259444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26139"
FT                   /db_xref="UniProtKB/TrEMBL:D9S552"
FT                   /protein_id="ADL26139.1"
FT                   /translation="MFSIFCIIQSEEWSTRASFLFFSLCMLTGCIGTACFERPTLVLTS
FT                   AYSPTDLVTHNKKYEDYISSFDNANNEKKEQGFATASNSNSDSAIDDDDVELAPEVMDR
FT                   LDTYADKAETVIEKMFDIMNALNSFEPMEANAGEMEREKRSQQALAINNKATSLNRKTI
FT                   GIFHPLEAREAHSELVQASETLRTASHELYSYCLVEDTQEAMKKYSQARDLIVIAKRHI
FT                   DKFNKIIQNLTNNQPQQ"
FT   gene            259464..260453
FT                   /gene="asd"
FT                   /locus_tag="FSU_0229"
FT   CDS_pept        259464..260453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="FSU_0229"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by similarity to SP:Q04797; match to
FT                   protein family HMM PF01118; match to protein family HMM
FT                   PF02774; match to protein family HMM TIGR01296"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27139"
FT                   /db_xref="GOA:C9RPL2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPL2"
FT                   /protein_id="ADL27139.1"
FT                   /translation="MIRNVAIMGATGAVGQELLKILEQRNFPLQNLKLLASERSVGREY
FT                   EFKGEKLKVELTCKDAFKNVDLVLSSAGASVSKEFAPIAVDAGAVVVDNTSFFRMDPNV
FT                   PLVVPEVNPEDIKLHKGIIANPNCTTIMMVVALKPINDLSKITRIHVATYQSASGAGAT
FT                   GMAELKQQYQEIVEGKPVTVKKFAHQLAYNLIPHIDVFTDNGYTKEEMKMFNETRKIMH
FT                   SDVRCAATCVRVSALRCHSEAISFETERPLSIEEVSNAIKNGEGLQLCDDVANNVYPMP
FT                   LNLMGTDDVYVGRIRKDLACDNGMNIWIVGDQIRKGAALNAVQIAERL"
FT   gene            complement(260595..261824)
FT                   /locus_tag="FSU_0230"
FT   CDS_pept        complement(260595..261824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25498"
FT                   /db_xref="UniProtKB/TrEMBL:A7UG44"
FT                   /protein_id="ADL25498.1"
FT                   /translation="MNLKTMFGIGLVSVGAAFAQEASESTAPSMSEQQLQQQEEQAAAS
FT                   ESLTAPVPFVAPEIPKDSKRTPFNAILHGKSYNRNSNMAAANNTDLLLKYPNLFANRKF
FT                   FYIEPTNKLGIVSLGSFFTAFDISKATHDDSQLGRLTLGYAVPGFGFYVRAGLGRDRVS
FT                   NDAGVVSTTYGGDDWAAAIAKSFLGMNVAADVDWLTTKKQTHSDPDKGVETEDRFDSLT
FT                   VNLSLTNAPTAKNFTWTLGARFVSFNNETEVDGDVEKANDPASFWDLSPYIRGGLSVLE
FT                   NENARILIGGAAIVSYRNYDDPVDQYAITAVLQPSMLGEVFVGEEKNFMFYGEVGYDWV
FT                   AFQYLKNNDSDTSRMMDVMNSVNASVGFRYQYKDFLAVELGLGEKLFTGLGNYFQADGT
FT                   FIDFSAMVRF"
FT   gene            complement(261927..263042)
FT                   /locus_tag="FSU_0231"
FT   CDS_pept        complement(261927..263042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0231"
FT                   /product="putative aminopeptidase"
FT                   /note="identified by similarity to SP:P24828"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24835"
FT                   /db_xref="GOA:C9RPL4"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPL4"
FT                   /protein_id="ADL24835.1"
FT                   /translation="MKDPRITQLAENLINNAIALKAGENILIETTDTPDELSTELIKAV
FT                   AKVGGNAFIHNYNSRVRREVIRSASEEQMKLSADLAMNEMKQMQAYLSIRAMNNAMENC
FT                   DIDDKKMLAYRTITQDVLNYRVNNTRWCVLRWPNPSMAQGAKMSTEAFEDFYFKACLAD
FT                   YPKMQRAALALVDLMNRTDKVRLVAQDTDITFSIKDIPAVPCCGNMNIPDGEVYTAPVQ
FT                   GSIEGVIHYNTPTLYEGKQFSNIRLVFKQGKIVEATCETGDNKSLNAIFDTDEGARYVG
FT                   EFAIGFNPFVLSPMCDILFDEKIAGSIHFTPGMCYEDAPNGNKSAIHWDLVLIMRPEYG
FT                   GGEIWFDDKLIRKDGLFVVDELKCLNPENLG"
FT   gene            complement(263144..264091)
FT                   /pseudo
FT                   /locus_tag="FSU_0232"
FT                   /note="TonB family protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM TIGR01352"
FT   gene            264514..265818
FT                   /gene="alr"
FT                   /locus_tag="FSU_0233"
FT   CDS_pept        264514..265818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="FSU_0233"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by similarity to SP:P10724; match to
FT                   protein family HMM PF00842; match to protein family HMM
FT                   PF01168; match to protein family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25791"
FT                   /db_xref="GOA:D9S556"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D9S556"
FT                   /protein_id="ADL25791.1"
FT                   /translation="MQNTPEIYAFLPIASPFLKWLTYISIIMKLLATPPDLNKIARPNW
FT                   IEINLDALCNNIQFIRSQIPASTKILLPVKADSYGHGSLACSFAAKFGGADYLGVAHIS
FT                   EGMLLRQYGMDLPILVLGPCTPSDFAYFVEYQLTAAITDIRTAMAFDQFLGETGTECKA
FT                   HLAIDTGMNRYGFDAEDFNNIRAALSLKHLKFEGMFTHLATADMPGNPKTEIQIQRFTR
FT                   LVDVLEAEGLRPEICHCSSSAGTLTHPESHFDMVRPGLTLYGYNCMGAIPTTLPIKPVM
FT                   KIKSTIRHVHDVKPGETVSYGGYWAAQQLTRIATIAIGYGDGYLRGEYNKGFVFIRGQL
FT                   CPILGRVCMDATMVDVSHIPDVQVGETVDVVNGELDFRISMESVAEEHHTIPYEITSRV
FT                   ARRLYRKYYWKNRLVRWDYLKEEFGVKDFKEYPLR"
FT   gene            265836..266396
FT                   /locus_tag="FSU_0234"
FT   CDS_pept        265836..266396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0234"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="identified by similarity to OMNI:NTL02MA4212; match
FT                   to protein family HMM PF01035; match to protein family HMM
FT                   TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25068"
FT                   /db_xref="GOA:C9RPL7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPL7"
FT                   /protein_id="ADL25068.1"
FT                   /translation="MKFNDPKFTKISHRNVWGEWTFIFEGSKLCGLKFRETSDEVKATP
FT                   SNVQACAYASPDMETELNSRVRSAYRKAVNELNLYLAGKICEFSIPIKIYGTDFQKKVL
FT                   EVTRQIPYGKTCTYKQVAEAVGHPQAVRAVGNVLHNNPIQVVIPCHRVIDSRGRLSGYA
FT                   LGVGLKRRLLCMEGAIPNELMLE"
FT   gene            complement(266399..266812)
FT                   /locus_tag="FSU_0235"
FT   CDS_pept        complement(266399..266812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0235"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:C95042"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25251"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPL8"
FT                   /protein_id="ADL25251.1"
FT                   /translation="MNVLIWGSDTILGHGLLSMLKDIKDGVFNAIGNIEIGEIFACDAE
FT                   SDKDVIDEACANADFVFNLSYGFKSDKLIEGLNVHNNTCPVLLGHSVGDKSLFREYAQS
FT                   NNVPILEWAPNYDMELLSVEAQVYDMLGALQCA"
FT   gene            267270..268934
FT                   /locus_tag="FSU_0236"
FT   CDS_pept        267270..268934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0236"
FT                   /product="diphosphate--fructose-6-phosphate
FT                   1-phosphotransferase"
FT                   /EC_number="2.7.1.90"
FT                   /note="identified by match to protein family HMM PF00365;
FT                   match to protein family HMM TIGR02477"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25722"
FT                   /db_xref="GOA:C9RPL9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPL9"
FT                   /protein_id="ADL25722.1"
FT                   /translation="MSENLSVLTKARQAYQPKLPVSLKNGALSVKINKGAATESVSDQA
FT                   KIKELFPNTYGLPVVQFEAAEAKAGKALRMGVVLSGGQAPGGHNVIAGIYDGIKSVSKD
FT                   SVLFGFLGGPSGLENGKYIEIDDAKMDAYRNAGGFDMIQSGRTKLETEEQFNKCIAVAN
FT                   KLDLDAIVIIGGDDSNTNAAVLGEYFQSKGVKTCVCGCPKTIDGDLKNEFIETSFGFDT
FT                   AVKTYSELIGNIMRDANSAQKYWHFIKLMGRSASHIALEAALQTHPNICLISEEVKAKQ
FT                   MKLKDVIKQVADVVYARAAQGKNFGVALIPEGLLEFIPDVGVLISELSEALAHHEAEVE
FT                   GLDTAAKVEKLCAWVSAESAEVLKSLPAGIQAQLMLERDSHGNVQVSLIETEKLIIEMV
FT                   KKELKNRGDFKGKFSALNHFFGYEGRCAAPSNFDADYCYSLGFAASVLALNGMNGYMSS
FT                   VRNVTKGIENWVAGGLPITMMMNIERRHGADKPVIRKALVELDGPMSAPFKYFAARRDE
FT                   WAKTESYTYPGPIQYWGPSEVCDITNFTIKLERGAMK"
FT   gene            269040..269210
FT                   /locus_tag="FSU_0237"
FT   CDS_pept        269040..269210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0237"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26425"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPM0"
FT                   /protein_id="ADL26425.1"
FT                   /translation="MACANCKLRAQYDKNPKSLIGRIWRFHINFCPGWKSYIKSLSEEE
FT                   RIAAKEKYNLK"
FT   gene            complement(269360..270529)
FT                   /gene="prfB"
FT                   /locus_tag="FSU_0238"
FT   CDS_pept        complement(269360..270529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="FSU_0238"
FT                   /product="peptide chain release factor 2"
FT                   /note="identified by similarity to SP:P28367; match to
FT                   protein family HMM PF00472; match to protein family HMM
FT                   PF03462; match to protein family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25168"
FT                   /db_xref="GOA:D9S561"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D9S561"
FT                   /protein_id="ADL25168.1"
FT                   /translation="MLNGILFCSGRPEKFEKWSCKWHSTLHILGLSSCAAASINSGGIF
FT                   DLEAKTEELYVLEKDSGDPNLWNDQEKAQSMMKKIGNLKGLIDSWKEVSQTCDDLAELY
FT                   EMSKDEESADLTATLESDIADLKSRVEAMEFKKMLNGPDDACACLMSIHPGAGGTESQD
FT                   WALMLFRMYTHFFEREKMDFKVVDFQEAEDAGLKSATIEVSCENAYGLLRSEIGVHRLV
FT                   RISPFDANARRHTSFTAVYLYPEHEDVEFDLDMSEVRVDTYRSSGAGGQYINKTDSAVR
FT                   MTHLPTGIMASCQTERSQIQNRETCYKMLKTMVAEHYRLEEEAKRDARMAEKKKVEWGS
FT                   QIRSYVLQPYQLVKDLRTGVETSDTAGVLDGKIKPFIDAYLLSTSEGNK"
FT   gene            complement(270574..271581)
FT                   /locus_tag="FSU_0239"
FT   CDS_pept        complement(270574..271581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0239"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26608"
FT                   /db_xref="GOA:C9RPM2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPM2"
FT                   /protein_id="ADL26608.1"
FT                   /translation="MSLKLISRGAAAVLLTAGIASAQLMNSKSLDVIRVEKTGISAGKI
FT                   DSLATMLGQQQAPGQKLTDEMMTQLRYAVVDNLVGQELIKLEAKKMGIKVAPAKVDSLT
FT                   NLFKKQFPSEDAFQKELKKSNTTMKQFKEKIEDQLKSEQILEKKVPYPSAPTEKDLEAF
FT                   WQLNKSKVAINDTISGARIFISTKGKNAQEISDAKDMLKGLAAQVRSKKATFAQLAAMY
FT                   SDDKEAKKTGGIMNKFVAKSKSAAFAKAVGKIKVGDISEVITENDGVSIFMLTEKNDGK
FT                   FESYKHQIDYILRVQAEQERQAKLKAYLDDLGKTYKVQYLDKKYEPPQAIGATK"
FT   gene            271736..272605
FT                   /locus_tag="FSU_0240"
FT   CDS_pept        271736..272605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0240"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24666"
FT                   /db_xref="GOA:D9S563"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D9S563"
FT                   /protein_id="ADL24666.1"
FT                   /translation="MHMNKIKVYTLQGKWTGDFDSNNKWYKDEALKLKGKDIDLLVLPE
FT                   LFHTPYFPFEENADFFDLAIEKDHPIVAEWQEIAKELNAVVVFPFFEKRARGIYHNSAF
FT                   VFERDGSIAGLYRKSHIPDDPAFYEKYYFIPGDTGFEPIKTSAGTLGVLICWDQWFPEA
FT                   ARIMSLKGADVLIYPTAIGWMDSEPKEIYPRQQDSWMTVMRGHAIANRTFVIAANRSGV
FT                   EGHLTFWGTSFVAAPDGYILQKCDPEFLGASYVELDLAETEENRRWWPHFRDRRVDLYK
FT                   DILKIWAD"
FT   gene            272705..273730
FT                   /locus_tag="FSU_0241"
FT   CDS_pept        272705..273730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0241"
FT                   /product="peptidyl-arginine deiminase family protein"
FT                   /note="identified by match to protein family HMM PF04371"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24932"
FT                   /db_xref="GOA:C9RPM4"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPM4"
FT                   /protein_id="ADL24932.1"
FT                   /translation="MTTKSSVRYPAEWEKQSATWLAFPHNKTNWYGERGINIRKFYVEL
FT                   IRNITEFQPVNLLLPAKNFLTDEEKAALANRPFPVNFIVIKTNDIWIRDYGPFFMKKGD
FT                   KKVVTETQFNAWGAKFPPWGLDNAIPQKIAEKQGLPLNESVPFIFEGGAIEVNGDGLGI
FT                   TTEDCLVGKNRNDEKDLKKVVKSLCKAFGLKEMLVLPHGLHGDHTDGHIDNVARFVAKD
FT                   RVVMCMTDNKRSPNYAILTEAQQFIESWLKEHYETAKVDTLPLPPQRVLDDGQILPASY
FT                   MNYIYVNGGLIFPKYKCPNDAKAKKYFESVYPDRKVIGIDCRTVIEEGGSLHCMSKHEN
FT                   E"
FT   gene            complement(273841..274428)
FT                   /gene="rhnA"
FT                   /locus_tag="FSU_0242"
FT   CDS_pept        complement(273841..274428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhnA"
FT                   /locus_tag="FSU_0242"
FT                   /product="ribonuclease H1"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25289"
FT                   /db_xref="GOA:C9RPM5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPM5"
FT                   /protein_id="ADL25289.1"
FT                   /translation="MPKQKFYAVKSENEKKIVTTWDECLKLTHGVKGVLFKSFGSREEA
FT                   QAWLDGMEAPAPDGIRVFVDGSFSPGFGPAGWAFVVTEDDNELARGSGITAFDAESRNI
FT                   DGEVMASFQAMRWLDAHDMKGVICHDYEGIARWAKGEWQAKSNIAKMYVAAAKPYLHRV
FT                   QFEKVAAHTGVKWNELVDKLAKEAIAKAKKCK"
FT   gene            274477..275043
FT                   /locus_tag="FSU_0243"
FT   CDS_pept        274477..275043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24694"
FT                   /db_xref="UniProtKB/TrEMBL:D9S566"
FT                   /protein_id="ADL24694.1"
FT                   /translation="MFSSRYFADGKRYFAMRLLCKPLLYRWFLRKAGYNKSSDTFSFPQ
FT                   SLQDHEKTVFFMPEDKKIAKVILDELPEESFKSILFIAHSDLEALLQKKKATASYYTDK
FT                   DCRYGEPLFDRLEYQVKTYAPLACVYLGTYKPQFLYLALISGAVLRVGFDCAREYPFLN
FT                   LSLHALKTISPARMMARYFSKDNED"
FT   gene            275046..275918
FT                   /locus_tag="FSU_0244"
FT   CDS_pept        275046..275918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0244"
FT                   /product="PHP domain protein"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27291"
FT                   /db_xref="GOA:C9RPM7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPM7"
FT                   /protein_id="ADL27291.1"
FT                   /translation="MQKMFSTIITENGGYADLHMHTKLSDGTLSVDELLMLCKRKGLRC
FT                   ISITDHDNLDSYKLAEEPAKEIGLEIIPGIEISAVWQGKDIHILGYFCDPTNLALNMEL
FT                   EDFAKQRIARVKAIIKKLNALGIGITFEKVHSYCKGKIIGRPHIAMSLVDEEYISNFSE
FT                   AFTKYLGDGCIAFVEKKGLNPQETIRLIENAGGIAVLAHPYKSGLSDKFIENMVEWGIQ
FT                   GMEVYSPAQKGAVGRKYKEMAQRFGLVGTGGSDFHTENGTYPPGCMKMPYTVVQALRER
FT                   REKSRAEWF"
FT   gene            275909..277975
FT                   /locus_tag="FSU_0245"
FT   CDS_pept        275909..277975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26682"
FT                   /db_xref="UniProtKB/TrEMBL:D9S568"
FT                   /protein_id="ADL26682.1"
FT                   /translation="MVLMNRGILFLAVIWTLTTSVFADVIHAKPSKLPAPQDSVFETPN
FT                   APDPAPRETDAGRWVIPLREVMQRTYDVAGQKSEWVLGTSILGSPELPAKSLGIGSLSK
FT                   RYPSKLAGIYTTRLSYDASTLALNGENGILFEERHGIPVDTPITDVNWERGAFEGNALR
FT                   LEFRRLITDSVTLDLGVSSHSDMLSKPYEYQPVTHSPFFALGRDSTQIPFGGRNIAMNS
FT                   MHLQPIVTWRFGYGKAFVKINYLSLDNADNTTHKVLLDTLDPTARNFQTDPYRIIIESR
FT                   TYGGGVEFYPIKDLTLGTEIHYGNHEIELRNLSKIIKGSDTTYNENGLRSITTSYYDTS
FT                   KVRNYETILGNFDIRYSSFLNPRIRFEYEFLNTEESGHEKTKQKFYQDREIGYAEVSDT
FT                   LFGKALFRVQAGMQRNSSLLDSVEFAPAFSIDGTYLLPHDLMASASYRHDNKFPDVTQL
FT                   KLVETGRVAFPNENLKHEVRDRVTANLVWQKRDVFYGLGLRYEHANNLIKPHWAIAGRI
FT                   DSTSSYDDINDVTISEVTDSVQSAFRYENLDHAHTLDWLMQVGFRLGNWKFYLERGQKM
FT                   TRTKLIDTPSLYYKGSIHWQNRFVKDRLGVSVRVDFQWFNNRYDCTINEKGEPELVSLK
FT                   KYLAMDFEARMQILSFELYNRIENFNHSIYAPESGYTPEGLRFAYGIVWTFGN"
FT   gene            complement(277993..278988)
FT                   /locus_tag="FSU_0246"
FT   CDS_pept        complement(277993..278988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0246"
FT                   /product="sodium/calcium exchanger family protein"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00367"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25256"
FT                   /db_xref="GOA:C9RPM9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPM9"
FT                   /protein_id="ADL25256.1"
FT                   /translation="MILSIVAIVVGLVLLVWSADRFVDGAVGVARFLGMSTFLIGMVIV
FT                   GFGTSAPEMVVSILSAMNDTPQLALGNAYGSNIANIALILGTTALIAPVVVQKQAMSRD
FT                   IPVLLAMTVLTVLLLWDGNVSLVDGVVLLVAFAAIMTFNILSELRQKRKRKKSAEVHDE
FT                   LESESTEQVSIVKSSLLLLLGLVLLIVSSRMLVWGAINVAQALGVSDLLIGLTIVAVGT
FT                   SLPELASSIAAARRGENDLAVGNVIGSNIFNTLVVVGLAAVITPIKAMEPEVLIRDLPI
FT                   MSALTLLLFFICIPFKKKNGKRVSGFGRIGGAFFLSLYVAYLVLLGIQAV"
FT   gene            complement(278995..279939)
FT                   /locus_tag="FSU_0247"
FT   CDS_pept        complement(278995..279939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27117"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:D9S570"
FT                   /protein_id="ADL27117.1"
FT                   /translation="MMAQEAAPVETAPVAPAPVAEQAAPAAEVAPAQAAPAEDKFTAVE
FT                   QELAPENLFNEPTAVRGEDAAKPVVKKTTKKFVYRPVYSASEIENTSGNVKTIYVTETA
FT                   TADTIDMDQLRGLIPLKFTFGLQGFIGNSFLSGDNGRYEYDRYSGLTWSIGAFALFPLD
FT                   EYNMAFKTGVLFEHDKVSNSYSETYKETFGEYRFSFSQYRISLPLLLSLKSAKSNVYFD
FT                   VGVQPSFAVADKFRMKSSDKSVYIKDDMMDNDCRSVIDWSIVFGFGIRANRYIGFDARF
FT                   TWGINNQYDDYDVWSINNLSSKSITVGATFYAF"
FT   gene            280092..281630
FT                   /locus_tag="FSU_0248"
FT   CDS_pept        280092..281630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0248"
FT                   /product="cytosol aminopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00883"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26278"
FT                   /db_xref="GOA:C9RPN1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN1"
FT                   /protein_id="ADL26278.1"
FT                   /translation="MKTNIVTTASGKANAYALFFVKKSVQFSNVLSENAEKQVESVLNG
FT                   MEDGPFEDLEFLEIDNQPTIFVNAAKERGLSSLDHLRMAAFRLAKKASKRQIPVVSIML
FT                   ADAAPEQFKSILLGLHYADYKFDAYKSKQKDSFQVTFELVAGEHTAEFKKIADVVAIEN
FT                   KAIVLAKNLINTSSSDLTPAEFVENANTIAKYTPGLSIKVRNMKQLEKEGFMGHVTVGK
FT                   GSSHEPYMITLSYDGSKSSKKAAKNARTSADHLVFVGKGLTFDTGGLCLKPPKSMPEMI
FT                   SDMSGAATVLAAIQAIATLELPIKVSAVCCLAENAIGNKSVLPGDIFTAKNGKTVMVDN
FT                   TDAEGRLVLSDGLAEAGLIGATHIVDLATLTGAMVRALGYAVAGFFSNDDDLALKVINC
FT                   GEACCEKFWSMPLEEEYADALKDHFADLKNTGSDAGAIAAALFLQEFVPENTAWTHWDI
FT                   AGTAFVNKTWKYTDFGATGFGVQTLIELARRMSGMVCEDTANEDADGEYVAVEA"
FT   gene            281721..283556
FT                   /gene="guaA"
FT                   /locus_tag="FSU_0249"
FT   CDS_pept        281721..283556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="FSU_0249"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by similarity to SP:P04079; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF00958; match to protein family HMM TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25857"
FT                   /db_xref="GOA:C9RPN2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN2"
FT                   /protein_id="ADL25857.1"
FT                   /translation="MKNVDTIAVLDFGGQYAHLIANRVRRLGVFTEIHSPAAPVSELEG
FT                   VKGIIYSGGPSSVYAADAPEYNPEILNLPVPKLGICYGHQLIAQQLGGHVEPGKVKEYG
FT                   IADLIVGDEKCPLLKGLPKASPMWMSHGDQVTKLPEGYKIVASTKDCEIAAVAFDSDKP
FT                   ERQIFGIQFHPEVTHSKFGMKLLENFVDFTGAKKTWNMKSYLPLITQRIKDQVKDRKVF
FT                   LLVSGGVDSTVAFVLLNRVLGPEKVLGLHVDNGMMRLGESQKIMDFLTKEGMNNLKIRD
FT                   ASKHFLAKLKGVTAPETKRGIIGKEFLTVKDEEMAKLNLDPNEWMMAQGTIYPDTIESG
FT                   GTKNADKIKTHHNRVQEVLDLMEKGLVLEPLADLYKDEVRALGEELGIPHNLVWRHPFP
FT                   GPGLGVRLLCSEGKLTSDMVKFEDVKDTAGQSLADYLKANNIAGRMLPIKSVGVQGDGR
FT                   TYAQPFLITTPGLSWKECEKFSTELANRFKAINRVIYQIGSVADEDPKLVEQYATRENF
FT                   DTLRKFDNICTEFLQANDLYEKIWQMPVVLVPLRTANKPCIVMRPVNSTEAMTANFAEI
FT                   DQGMLAGLWRKFEAEGAGSLWYDVTHKPPGTIEWE"
FT   gene            complement(283871..284887)
FT                   /locus_tag="FSU_0250"
FT   CDS_pept        complement(283871..284887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0250"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24661"
FT                   /db_xref="GOA:C9RPN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN3"
FT                   /protein_id="ADL24661.1"
FT                   /translation="MRSYILRRLLLMIPTLIGISLVCFILIQLLPGGPVEELISRAQQA
FT                   ASMKGGVDASKALSPDQIAQIQAYFGFDQPAWKRYLTWLWNVLHLNLGESYTYGLPVWD
FT                   VIVSRFPISLFFGVTSFFLSYLICIPLGLWKAVHHGSKLDSFTSGLIFSGYVMPGYALG
FT                   ILLIIFLAGGSYLDIFPLGGLTSDDFEDFTFFGKVFDLAQHLALPIFCYMISEFAFLTF
FT                   LMKNSALEELGRDYMRTALAKGLSFKQALVRHALRNALIPIATRLSEICTLMFAGALLI
FT                   EKVFDIDGMGLLYYNSMVNRDYNVVMGIIFLSSLMAMVGRLFSDILYTLVDPRIKFS"
FT   gene            complement(284888..285718)
FT                   /gene="dapB"
FT                   /locus_tag="FSU_0251"
FT   CDS_pept        complement(284888..285718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="FSU_0251"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by similarity to SP:P04036; match to
FT                   protein family HMM PF01113; match to protein family HMM
FT                   PF05173; match to protein family HMM TIGR02130"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26332"
FT                   /db_xref="GOA:C9RPN4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR011859"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN4"
FT                   /protein_id="ADL26332.1"
FT                   /translation="MSVQVMVNGIPGNMGRIVAETCVARGLELVPYSLTGEIIVENEAE
FT                   VAGKTIQLLKPSNREARIGEVLAKYPNMICIDYTHPTAVNDNAAFYVKHKIPFVMGTTG
FT                   GDREALAKLVADANHPSVIAPNMAKQIVAFQMMIEFLAKEFPTAFEGYKLSVVESHQKT
FT                   KADTSGTARAVVGTFQKMGFDYTPDDIEKVRNEKEQMERMHVPEEYLGGHAFHTYSLDS
FT                   ADGTVHFEFQHNVCGRKIYAEGTVDAVNFLADQIAAGTAKPFNMMDVLRSGKMR"
FT   gene            complement(285808..286548)
FT                   /locus_tag="FSU_0252"
FT   CDS_pept        complement(285808..286548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0252"
FT                   /product="ankyrin repeat family protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25663"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN5"
FT                   /protein_id="ADL25663.1"
FT                   /translation="MKKKILALCAAGLIFSLTGCEETMDPNDPQSVRRYLTKKQIGFTP
FT                   NQFVSYAVNSDTAKMTLFLQASFEIDQPADNGNNAVAIAANKGNMMVLNYLFDHGAKAN
FT                   VNNGNGEPVIDNAVMMGNKEVVVRILDQLKKEGVEPQNLATAVLIAAKTGKADMLEVLA
FT                   NAGAPLENRSPDGYMPIHWAVKSGNYDAMMFLINKGVDVNAKCGQGYSVLDWATNEGYT
FT                   RLIKALKKKGAKNTPKYMLDSRGR"
FT   gene            complement(286657..289035)
FT                   /locus_tag="FSU_0253"
FT   CDS_pept        complement(286657..289035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0253"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase D"
FT                   /note="identified by similarity to SP:P23931; match to
FT                   protein family HMM PF01464; match to protein family HMM
FT                   PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26972"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN6"
FT                   /protein_id="ADL26972.1"
FT                   /translation="MIWSNKFVRLGLALAFLILTACAPKQAKLAASSQGKPIQLEKVSI
FT                   DVPGPNPGKEVVGDSTRPSWVYYQYGLQAIDNNQWAVSKHYLEESLRLLVTEKYDSTKS
FT                   KLTRSEDSIYKMQMPVRIVQALEDVYPNLAEQEGSDSTSTDSLSIDGVDAYDENAADSA
FT                   SMRVIENFLDTVDAGRFSLPIRFNERVMQEIYYMTTSARGFITRSLSRKTAYDSLIYSK
FT                   LAQKRMPRDLIYLALVESGFNVKAYSRAKAAGMWQFIPETGIRYGLEVDFWVDMRRNPE
FT                   MATEAALSYLSTLYAEFGDWLLSMAAYNCGEGRIRRLIREKKADSTWGNRPVTYWDLQL
FT                   PQETMHYVPRILAAMVIGHYPEHYDVSVTKHQLAPYDTVTVYDSFSMDEISKFLKVPED
FT                   TLRTLNMELTMWCTPPNRDAYLLRLPYGTRAAFVQNYDRMEKNGFSSWKQHKVRKGESL
FT                   GAIAQQYGVRVAEIQRANDLKKTKLKPGRTLLIPIKVAPRRSTGKKPTKVRTYVVQLGD
FT                   NLGSISRRFGVSQESLRVWNNIETGYNVKKGDTIYVSKPDLKPTSFIQQRVALKKGEKY
FT                   VVKAGDTYAQIAKKYKVPVFLLLQANQGFTKRLTIGDSLVIPAYVRPLRRMSGAVDDGV
FT                   PEVEPSKSNEPVTDSKKSSKTAKKTAEKTPEPATKTSKKAPVNTTIIYTVEPGDNLFAI
FT                   SKKFSTTVAAIRDMNEMGNSSNIKVGQKLKIPGSAAPAPSAPKVEEITHVVKKGEGLWD
FT                   ISRQYGVTIEDIVKWNGLKDTKIKINEKLKIKTTKKIKK"
FT   gene            289499..291625
FT                   /locus_tag="FSU_0255"
FT   CDS_pept        289499..291625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0255"
FT                   /product="thrombospondin type 3 repeat protein"
FT                   /note="identified by match to protein family HMM PF02412"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26550"
FT                   /db_xref="GOA:C9RPN8"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPN8"
FT                   /protein_id="ADL26550.1"
FT                   /translation="MKLLLSTILFCAVFLFAQSGFSFNSSGIHVPGARTLNPGDLFIMG
FT                   GFDMASSNKPASLEGYITDEDGNQKKLTESPSNSVLGYIGYGLLDYLELGLHLSVHYDG
FT                   DAAGTKLKGLGFGDIGLMVKAQPPSQSSRDLLNASAAIEFFLPTGTNEKGLRPRHLWYI
FT                   HKNSTTHSYSSADYVISGTLFLTMNIHRNLRWNNYAGILRTLENHENIFIWGSGLTLFP
FT                   YEWVSLILEASGETWVRSKYIKSGFVNDQIRFSPGLKLRLPKFTTLSINADLGMDLFRT
FT                   RKIGRGHPITVKNNSHTYKYTVPGSPPIAASIKLSRTFDLNGKIEDYKKRMDSCPKSSR
FT                   TLKENGYKCAPDEDNDGIADDMDQCPNTPEAVLIDGWGCPFDHDNDGVPDYKDKCPDTK
FT                   EGYPVDENGCIRDADNDGVPDELDQCPESTPDEEINERGCILDTDEDGVPNALDSCPNT
FT                   PAGLTVNKYGCFLDRDRDGVPDEWDKCPDSAPNEIVNMYGCPIDSDEDGIPDFMDKCTN
FT                   TPAGVKVDSIGCRLDFDGDGVFDEEDKCPDTPENAPVDKQGCPLDSDKDGVFDYLDNCP
FT                   NTLERTEVDVNGCPIREKLNLDKIARRIQFHKGTDKPLNSSYTALSDVVSVMRHNKQIA
FT                   IEIQCSVKPGESKDPQALSDARATMVYEFIVNKGIKEEKLRANGFGLQLPQVRGHSKLN
FT                   PVGVRLLPYNIKDE"
FT   gene            complement(291631..291813)
FT                   /locus_tag="FSU_0256"
FT   CDS_pept        complement(291631..291813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26019"
FT                   /db_xref="GOA:D9S578"
FT                   /db_xref="UniProtKB/TrEMBL:D9S578"
FT                   /protein_id="ADL26019.1"
FT                   /translation="MLSMKQKIPGILFLLAMPLSVLLYIKVEALSGSEILGLFSAVALY
FT                   VVVALVIALLFNKKS"
FT   gene            complement(291883..293532)
FT                   /pseudo
FT                   /locus_tag="FSU_0257"
FT                   /note="putative endo-1,4-beta-xylanase; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by similarity to SP:P10478; match to
FT                   protein family HMM PF00331"
FT   gene            293729..294724
FT                   /locus_tag="FSU_0258"
FT   CDS_pept        293729..294724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0258"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25693"
FT                   /db_xref="UniProtKB/TrEMBL:D9S579"
FT                   /protein_id="ADL25693.1"
FT                   /translation="MRFSIQIVYYKQMKFSKLFIIVLFFAFMTACDNGDSLDITSVEEN
FT                   KQFSFEVYLESRIIPDSAIVSMYNSSNRLEKTVKTRKKCFAGAKCMFETAPLKYEEYAK
FT                   ITLFAHATTENKTIQMEFERYAPMNTSTSTINVYYGTPVLNIYTAAASKAIEYNLLEKN
FT                   MSYGDATQNAYDNMKNFGISDREYEKDQYFPNVSSMNPIQLPYIYCRYFLSDSVFYSDF
FT                   LELQEAIRDGEWADTLFRIRAADDLARTYQNPNWVDVPGMTFYNQNEYIPNFWESAFGM
FT                   EVCNDKNIGDTLINANRRSSLYDSVFVCTEQMYSYYAKWQHWVLSRPQRD"
FT   gene            294731..296986
FT                   /locus_tag="FSU_0259"
FT   CDS_pept        294731..296986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0259"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25021"
FT                   /db_xref="UniProtKB/TrEMBL:D9S580"
FT                   /protein_id="ADL25021.1"
FT                   /translation="MGVEMKSKILFGVLISMFIAILAACGSDTYYSGHFEDLDDNFGKS
FT                   SSKITSSTSQIFNENIAFEGRFNLVSVFEPIKLEISALDENFEKTQTIEARIVRNRLEF
FT                   TYKAPEIHFYRPFAQLDFTCRFRDTKDNTEMQFTIIADMNEKEYYNIDFYRTLESGYMK
FT                   KLLQQKENFDIARQHTREAIHNLLDPELEHEYGISNAPYGKDTLEALAYNYSLFFTWDS
FT                   TFYKNFKKLSQAVGSDKTWDEILSVSDISERLIDHYRLEESRCDKNVLENIAQDRDFSQ
FT                   LRYNMAIWIAQGKNDIDCNAIPQKPAIDTTKKDTTSKDPIIEKFGNCTVNRKHTKAKLG
FT                   DGEYYSCNGTKWISVSAPEYHEDFGKRGEIVTYDDSYFMCNYEYSWRLLNDDEILPPVK
FT                   DLLKCNDHQVVEYDNKYYRCRFEYVSLVNQDAWLEIPEDSVAQYQKNGKFCTDSTQGIT
FT                   EEENGSYFTCNHYSWTKLLDYEKKQYEHELAHKDECKNGNKGTAIYWNNSNYFYCNNDT
FT                   RNWKSMGIQNQEHYGLGIFDGGVFISKDTLEKEIDDFTIKASQRPGWIAGLFDVINVTA
FT                   NINSHPYGAFFKKTRPYLSGLRGDKTIDFKNLSDQSESFDKFMEQYTHPESAYPAYIAQ
FT                   LTNVGEESYIDFATADKFCPKGYHIPDTTEWRTDSLNALPINASIYHDSPLYVRYNGKT
FT                   YLYDIYWTKTPVNSTTQYCIENHSENNQNTSSRIIECPKDLYPGVQTLCIKDGESND"
FT   gene            296979..299543
FT                   /locus_tag="FSU_0260"
FT   CDS_pept        296979..299543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0260"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27325"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPP3"
FT                   /protein_id="ADL27325.1"
FT                   /translation="MIRYFLILCLGIFLTSCSDDNSAGSSIHYVEGNENVESRTLALQG
FT                   KFSLNNKLIPVKIDIDVVDENLDSIATIKASLKKERNGTITFSSDYDDFASSIVRIKYT
FT                   CAYNDSSSKLKMDFVEYINIDKNPRPTLNLPMALASERIKELVQEDGFYLARAKEKVLR
FT                   EIFELLDYNNKQIIDFEQDSSSKHLAGLNQHVNMISTVEKSDSAFYKNYKSLRSAVGSE
FT                   KTWQDILSETEIADMAFAHDPDIIYADYWTKAFGLGSCDSTHFQDTTIISNKESVYNKK
FT                   KFLCDYKNKTYYWRTFNDVEAVNGLCTYDRKDTVIQDSLVWTCDSAKTKWNVMSGEQAL
FT                   PYKNISCDKILEGTYINYNSNNFACVYENNKFIWKDSVSENYKWRNSLDVYLKNKVGLC
FT                   DEDNSLGRSTIMDNKYYQCRDGIWTEVDKISYYLGYCNKSRTNDKAMHDSVGYFICNDK
FT                   WTEIPIPQYYGDICTKGFVHYAKKYGDTYYICKDQPNYYWSVALKEELSIPIQNDYFCE
FT                   EENNGEVFELDAVGYKCVYPIWQYAQDFEVKVSKAMERNKYSKDMCKKGPANSSIFWDK
FT                   IDSTFYGCVDNYTEANYGWGKVFWNNYNNPLTKFKSPEEFAGGTYDSLKNYKVNGWTLT
FT                   FSYGSSSLNGSIEYITLYLKKAISPKGDEYDIQEGNNVTVIRAAAGNKTVSFDSITNKS
FT                   DSFDKYFTDWKNKIIESTQCPTPMLPEFKCVSNWDESDIEINFTNYNQNSYTTWNQAKS
FT                   FCPEGTHIPSAEELSISNYAASFNNERFTAVQQKMNNGKKGSFSANYALVWTSTEKDSK
FT                   TQYCLEYVKSNSNQVVASGIVECPKDLYPMAQAICISDRSKK"
FT   gene            299540..300157
FT                   /locus_tag="FSU_0261"
FT   CDS_pept        299540..300157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0261"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25369"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPP4"
FT                   /protein_id="ADL25369.1"
FT                   /translation="MMKYLKSIFTFLVVLTALFWSGCTTDYEIEKEVHNWSFVGLDNDS
FT                   TAVVKVVLEQWGTSHDHHLMGWDDDFHNTTDLKYYSVNINSYKISERLNGDRKMLPEQD
FT                   STEEYRIKAEKIVDYSWTCAIILQDKKKKNLDTLEIDYCPKENSAETPKFVGRYLKINN
FT                   CFYKIEKGKFPIQKPEFCFDHTDYSVKFTHTDGKFIMYGGEP"
FT   gene            300175..301062
FT                   /locus_tag="FSU_0262"
FT   CDS_pept        300175..301062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0262"
FT                   /product="radical SAM protein, TIGR01212 family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR01212"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27292"
FT                   /db_xref="GOA:C9RPP5"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPP5"
FT                   /protein_id="ADL27292.1"
FT                   /translation="MGMHYKPYRDLLLELFPNYLKVRKLPLNGGMSCPNLDGTKGFSGC
FT                   SYCNNRSFSPVFDEAKVSIQEQLKKYIPKLRDKYPNAGILAYLQPYTNTHAPLEHLREI
FT                   IDPIIKHKEIAGLAIGTRPDCLEDEKIEYLAELNHKKPIIVEIGLQTANDLTLAGINRR
FT                   HTLAEFEDAVKRCQAAGLTVTTHVIVGLPGEKMEDFKHTAQVVHDLKLAAVKIHPLHIV
FT                   VGTVMAQDYANGEVKLLSFEEYCEAVAEMIKIIGKDIAIERFSGESPSELLIAPNWCGE
FT                   RDKIITTVEKLLSA"
FT   gene            301083..301598
FT                   /gene="apt"
FT                   /locus_tag="FSU_0263"
FT   CDS_pept        301083..301598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="FSU_0263"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by similarity to SP:P07672; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26662"
FT                   /db_xref="GOA:C9RPP6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPP6"
FT                   /protein_id="ADL26662.1"
FT                   /translation="MKRIEDYIIAVPDFPKPGVLFRDITGILSDPDGLKLTLDTFYKTL
FT                   ENVDFDVVVGLEARGFLFGVPIAEHFHKPFVPERKKGKLPRETVEITYNLEYGTACMEV
FT                   HKDAIKPGQRVVIVDDLLATGGTAKAAAHLVEKMGGKVECFAFVIELADLKGSEVLDGY
FT                   RVESLTKF"
FT   gene            complement(301595..302824)
FT                   /gene="fabF_1"
FT                   /locus_tag="FSU_0264"
FT   CDS_pept        complement(301595..302824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF_1"
FT                   /locus_tag="FSU_0264"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P39435; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24669"
FT                   /db_xref="GOA:C9RPP7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPP7"
FT                   /protein_id="ADL24669.1"
FT                   /translation="MSRRVVVTGGSCVTSLGMELDDIFSELKSLKNHIVRMDDWDKYAQ
FT                   MNTRLAGPILYDLPEYPRKKVRGAGRVGVLAITSADKAMQMAGLAGEKELLKSGRVGVA
FT                   YGSSMGSVRPLLDFVSMQNPPYNCANVSVTTYIQSMPQTCAVNVSLFFGLTGRLITTNT
FT                   ACTSGSLSIGYAYEAIKYGMQDVMIAGGAEELAATETAVFDTLFATSVKNSTPELTPAP
FT                   YDRDRDGLVIGEGAGTLVLEEYEHAKARGAHIYAELVGFGHNTDGEHITQPKKDTMQRA
FT                   LELALKDAEISTDAIGYVNGHGTATHHGDIAESWATYNAFKQRAVAISSLKSYMGHTLG
FT                   ACGGIEAWLGINMMNRGWFSPNLNLKNVDPECAPLDYITGSGREIDTEYFMSNNFAFGG
FT                   INTSLIFKRV"
FT   gene            complement(302821..303567)
FT                   /locus_tag="FSU_0265"
FT   CDS_pept        complement(302821..303567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0265"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659; match to protein family HMM TIGR01831"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26723"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9S586"
FT                   /protein_id="ADL26723.1"
FT                   /translation="MMQRYGMENEKSVLITGASGGIGLAIAEAVAKEGYTVVAHYNRNS
FT                   APIDELAERIRANGGKIRTLQFNICDREQCKEVLEKDIAENGVYYGVVTNAGVCADAAF
FT                   PAMTDEFWDKVLNTNLNGFYNVVHPIVLPMCRKRKGRIITISSVSGVIGNRGQVNYSAS
FT                   KAGLIGATKALATELASRNITVNSVAPGVIETEMIKDAPLDMILPTIPMKRVGKPEEVA
FT                   ATVVFLLSEGAAYITRQVISVNGGLA"
FT   gene            complement(303564..304034)
FT                   /locus_tag="FSU_0266"
FT   CDS_pept        complement(303564..304034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0266"
FT                   /product="thioester dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26082"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPP9"
FT                   /protein_id="ADL26082.1"
FT                   /translation="MTEVFDTKDLVSELVPHKGKMLLLNRVRDYDLKENSITTEIDIAC
FT                   DNMFYEDELGGVPVWVAFEYMAQSVSALSGICGRAKGEKPKTGFIMSVSGFKADVPVFK
FT                   EGETVVVNVLENIRMDKAVTFEGFATVNGTLAVTAKLNTVEVDDPKSSLNLN"
FT   gene            complement(304031..305281)
FT                   /locus_tag="FSU_0267"
FT   CDS_pept        complement(304031..305281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0267"
FT                   /product="putative 3-oxoacyl-acyl carrier protein synthase
FT                   II"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24872"
FT                   /db_xref="GOA:C9RPQ0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ0"
FT                   /protein_id="ADL24872.1"
FT                   /translation="MKRPVYINDFSLRCILGSDEAQVLDSLTNGKRGTFTTYDVAGVMR
FT                   PAATIDPATLAPVPEQKFDNRVNRLSQAAFSAIENTIRKAVEKFGADRVGIFLGSCDNG
FT                   SEASMAALKYFKETGAFPEGYVLDYQRADFPAQFIAQRFGITGMLSVHSTACASSASAF
FT                   VSARNNLYASNCDVAIVGGVDIASLSVILGFASLEAMSDKPTNPFSANRSGLSLGDAAV
FT                   FFVVTKEPCADLCTAKCEGLKIVGFGESADADHITAPRADGEGAYQAMKAALNDAGLDA
FT                   SQIGYVNLHGTGTELNDAMESRAINRLFGEASHADVPVSSTKALTGHTLGAAGALELAF
FT                   CCLAMNSRRESDACKNSSEKDYLLPAHLFDGVVDPNLPPVHLVKPGETAKDLKYCMSNS
FT                   FAFGGCNVSLIVENGLA"
FT   gene            complement(305308..307653)
FT                   /locus_tag="FSU_0268"
FT   CDS_pept        complement(305308..307653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0268"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25017"
FT                   /db_xref="GOA:D9S589"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D9S589"
FT                   /protein_id="ADL25017.1"
FT                   /translation="MNAKSGIILWVVIHAILIILGISVPWKMDSDLYSILPDSNEIKNV
FT                   SAAEKTLSSRSMRNITVLVGHENFEVARKVAASLDSIFKGDSSIEESRLYVDEKTLNET
FT                   REFLFEHRYTIQGENVREAFFNLNHKFLELAALQKIYGSFSMANLNRLDEDPYLLGEAS
FT                   FDNFMKKTLTSSTHFSLRDGVLAAQDSGMTYVMWNAVLSENVSSLATDDHVIGRLNQVL
FT                   DSLENANLGLRISASGVPFHSYESSSEAKREVAWISGVSIVLILLLLLYVFRSAVPILA
FT                   TLSTIAVAIFTALSFTWFVFGNVHVFTFVFGTSVIGVSIDYAVHFFTNWKSGERNVRSK
FT                   IFKGLLLGFLTTEVSYVSLTFADFTLLRQMAVFSIVGLLSSFLTITLLFHALFEKTRNV
FT                   RTKNRTFSVKNLPLSIPKNFIKCYSNLPTWVIVLFFVFFAIALLPGLRALNIHTDLGSL
FT                   YSMSEKLKAGEVLNRKLNDVGISSNYFIIDGATEQDVLEQEELLTDRLLQAEKKNLLKS
FT                   YLAVSSFIPSQATQRKTFENTQKLLKDDLTKEYLTSIGVQNDSLLDASLKEAPKYVGLK
FT                   DLNQFPSSIRSMVEMLWVGAVENSQGKKFYSAVFPLHATDAFDAKQLAKNMPHVYVVNK
FT                   MQNINESFTKISRVSLTLVGLAYIVMFIILVFVYKFTGALKILRAPILASLFAASVFGY
FT                   AGIEFNFFAIVGVILTLGIGIDYALFFREGGRQKSVTALAVMLSAATTLISFGGLVYSG
FT                   FTPVWTFGLAVLLGISCCFVLSPLSAKR"
FT   gene            complement(307674..308294)
FT                   /locus_tag="FSU_0269"
FT   CDS_pept        complement(307674..308294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC59150.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26753"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ2"
FT                   /protein_id="ADL26753.1"
FT                   /translation="MRMSCRNIGVLLLTVLLGIGSSMADVFERPLSAKNRPELEKSLAK
FT                   VMDYQVASGDFKQTKSIQKLNREFVSTGTFRISKKAGIIWKTQKPVFSELAIHNAGIVE
FT                   RDTNGQIRTLLPKENPIFAEVSNNIQSLFSGKVTELEKNFKVFYEKKSCGFRIGLIPRE
FT                   AMIRMLVDNVVMDACKNVDRIVITDGEKIPTTLDFLNYKVSKK"
FT   gene            complement(308296..308733)
FT                   /locus_tag="FSU_0270"
FT   CDS_pept        complement(308296..308733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0270"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26172"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ3"
FT                   /protein_id="ADL26172.1"
FT                   /translation="MAVKKIKETIEFQVEFYDVDSMQVAWHGNYVKFMEVARCALLRKI
FT                   GYDYNEMTRSGYIWPVVDLHIKYIRPMIFMQRIRAEVTLVEYEVCMKLSYKFMDAETGA
FT                   VLTKAESTQMAVDMKTKDSLWACPTCFVDKVRAFLANDKVV"
FT   gene            complement(308750..310276)
FT                   /gene="hutH"
FT                   /locus_tag="FSU_0271"
FT   CDS_pept        complement(308750..310276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="FSU_0271"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="identified by similarity to SP:P10944; match to
FT                   protein family HMM PF00221"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26539"
FT                   /db_xref="GOA:C9RPQ4"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ4"
FT                   /protein_id="ADL26539.1"
FT                   /translation="MKTVVIGSGKLSIEDVVAIAKKQVAVELDSSAEFQRKIDSGAEFL
FT                   DEALAEHGGIYGVTTGYGDSCTQVLPPEHYSQLPINLTRFHGCGLGDYFDAETTRAIMA
FT                   VRLNTLAQGFSGVSYALLKIITQFLQNDILPLIPQEGSVGASGDLTPLSYLAGAVIGER
FT                   NVMYKGERRSSLDVMKELGITPHKFRPKEAIAIMNGTAAMNAVACMAYSRAEYLSDLAC
FT                   RITAMITVAMKGNAYHYYERLFEAKPHPGLGLAAKKIREALNLDVAKNVVPEKIQDPYS
FT                   LRCAPHVIGLFYDSSAFLRQLIEIELNSANDNPIVDPFTKNIFHGGHFYGGHICLAMDT
FT                   LKNMVANIADLLDRQLAMIVDIKFNRNLPPNLAGSKGDYDINHGFKAVQIGVSAWTAEA
FT                   LHLTMPMSVFSRSTECHNQDKVSMGTIAARDCIRVLELSEQVAAATLLASAQALRIRLE
FT                   RNEISEDRLKNLQETYNQVFSKFAPLECDRQLEQDLRNTLELIRQKFYAV"
FT   gene            complement(310291..311244)
FT                   /locus_tag="FSU_0272"
FT   CDS_pept        complement(310291..311244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM43229.1; match to
FT                   protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25723"
FT                   /db_xref="GOA:C9RPQ5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ5"
FT                   /protein_id="ADL25723.1"
FT                   /translation="MSKHWSEIEEVGGSVWHFRFMLWIVCHLPLFLVELCTAVICFFFW
FT                   LGAAPVRARSKIYLEHLRKLGVYVGAFGTYKHILSFALSMVEKLRGWKGAIKLNQIESQ
FT                   NDDLQMLVSQMNQGQGAFLLCSHLGNMEMLRSLTEYGEFHTSRKFQVFPVVDLSGSKKF
FT                   NALLRELNPELMENVIDANSIDVDSAIWMKEKIADGNLVVIAGDRTSAHTRSRVLETMF
FT                   LGETANFPEGAFSLAGILNAPVYFVFAIRKHDFNIRSPYEMHVVRAKTNLECSRKERPM
FT                   RLKMLLQEYTELLERLCKEHPYQWYNFYNFWDRLEK"
FT   gene            complement(311247..312020)
FT                   /pseudo
FT                   /locus_tag="FSU_0273"
FT                   /note="glycosyltransferase, group 2 family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00535"
FT   gene            complement(311989..314355)
FT                   /locus_tag="FSU_0274"
FT   CDS_pept        complement(311989..314355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0274"
FT                   /product="AMP-binding protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25089"
FT                   /db_xref="GOA:C9RPQ7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ7"
FT                   /protein_id="ADL25089.1"
FT                   /translation="MKQVAGKIFFTAISVLYPVLVYCGIRYWGLSPRRMSLMLLALGFY
FT                   HFLNFTRSKSKADRGRTGAIVALILVCALVAFFANNILFVKFYPVLVNLSLLAFFGFTL
FT                   WRPPSFAFRMACLGNKSLNTSPSFKAVERYCNKVTFAWCLFFVVNGSVSALTVFVGSDK
FT                   IWSLYNGLISYILIGLFFIVEYLVRKMVQSKMQSYVPVCDLERDSRPDGAFVAEGKTWG
FT                   DFVSDVSKVRYYLEARENVPWILHCEDSYYFTVSLLAMLQSGRKALVTANRQEAFIKEI
FT                   KKPEYGFLTDEPFAGSVAGANEMPATLIQDVLGNENAHCSDGDKAREIKFGKFDKSKAE
FT                   MVMYTSGTTGEPKAVYKRFLQFENELFELVKVFGNDWVNRKVYSTVNHHHIYGLLFTAL
FT                   LPIATGLPFRRHRIDFPTELANIAGEAAVIASSPAFLKRLSAETDKPIDFKCTPIIYSS
FT                   GGPLPEEVARKACELTGFWTMEIYGSTETGGIAYRQSKNGPVWTPFEVCKMSVAENGCL
FT                   NIKSSYILEPEGFTTGDLVDLYDDGRFLLKGRSDSIVKIEEKRISLPEVEMRLKQTGLV
FT                   QDVRVVPMVGKRQYLAAAIVLNEAGRTKFAGSPKLAINNYFHDYLLKFIENTVSPKKWR
FT                   YLEELPQNTEGKIRMRDIQALFGLAESPNFKILKFRREPGALTAKLLFPATSDYYDGHF
FT                   PEFKLLPAVVQVDMVLRLARNFLEVPKELSKMNRTRFANPILPDVPVMVKITYDADAGK
FT                   VTFAYTSEDGETSYSNGSLVMNTSTGDAGEGENRG"
FT   gene            complement(314355..314612)
FT                   /locus_tag="FSU_0275"
FT   CDS_pept        complement(314355..314612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0275"
FT                   /product="putative acyl carrier protein"
FT                   /note="identified by similarity to SP:P11830; match to
FT                   protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25979"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ8"
FT                   /protein_id="ADL25979.1"
FT                   /translation="MDKQVIFEKIKAALIEDFDLEENRIVPEARLYEDLELDSIDAVDL
FT                   IVKLKSFLPRNIDPEAFKKMRTLENVVDGIYNLVQNSESK"
FT   gene            complement(314616..314891)
FT                   /locus_tag="FSU_0276"
FT   CDS_pept        complement(314616..314891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0276"
FT                   /product="putative acyl carrier protein"
FT                   /note="identified by similarity to GB:AAG38843.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25005"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPQ9"
FT                   /protein_id="ADL25005.1"
FT                   /translation="MSDLNTRIKEVMIESLELEDITPADIVDSAPIFGKNAAGEGLGLD
FT                   SIDALELGIAIKENFGVSFSTVKEETKQHFASVNALAAYISANSKG"
FT   gene            314987..316090
FT                   /locus_tag="FSU_0277"
FT   CDS_pept        314987..316090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0277"
FT                   /product="methyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26788"
FT                   /db_xref="GOA:C9RPR0"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR0"
FT                   /protein_id="ADL26788.1"
FT                   /translation="MFDFYKNDSIDAVNAKFEAQKIAFAPLSFQAARALRDMGILEEIS
FT                   KSRKKGITISEIAQKLDISLYGVGVLVEMGLGMGAIKLHKDSSEDDLRLTLGKIGFFLL
FT                   NDEMTQVNMDFSQDICYRGAENLEQSIREGKPSGLPHLGPWKTVYEGLSQLTDQQKKSW
FT                   FGFDHFYSDLAFPEALPIVFEKLTELKQPRLFDIGGNTAKWAIACCKYNADIQVSIIDL
FT                   PGQTAVAEKNAAQAGFKDRIDTIACNVLDDTTEFPQGANAVWMSQFLDCFSLKQITKIL
FT                   TKIHKAATPETDVYVLEPLWDKQRFEAAAYSLQATSLYFTCIANGNSKMYRYEELKKAI
FT                   EIAGFELKEAHHGVGPNAYSLLRFRKK"
FT   gene            316105..316779
FT                   /locus_tag="FSU_0278"
FT   CDS_pept        316105..316779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0278"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:SO4366"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25579"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR1"
FT                   /protein_id="ADL25579.1"
FT                   /translation="MQKVFIEKMASFVPTEAHPKPDVSFVPMLTRRRLSYISRMVVLVS
FT                   DQVSRDNDGNKLTPCKVTFASQFGEISQQLKISQTLLDTGMVSPAHFSLSVFNASIANA
FT                   SILETNTAGYSAVFSGKDAFTTGLTDCIAALESESTDTRTFIFADELIPETYAPVAGVP
FT                   YPNAVCAIALRLTTDESKADPTFKNVDIASQLAQLKMLRNNFDTAAEQAIAFLCAIDMQ
FT                   KT"
FT   gene            316782..317552
FT                   /locus_tag="FSU_0279"
FT   CDS_pept        316782..317552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0279"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="identified by similarity to SP:Q42670; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25047"
FT                   /db_xref="GOA:C9RPR2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR2"
FT                   /protein_id="ADL25047.1"
FT                   /translation="MAKIRYIRRILAKLFCFAFFGICSLILAILLFPIIHIITGFNERR
FT                   FKIFVRKFNHQYFKIFVKIAELLGAIRLTVENRDSLKNLRSKVVIANHPSLFDVVILFS
FT                   LIPNANCIVKGELIQNKFISLIIRNLYIPNNIPFEEQLEMAKASMDEGNNLIIFPEGTR
FT                   SKPGEPWEFKKGAARFALYAQSDVVPIFFGGNEKIGLRKHDKLLQFHPTERYIYNLKIL
FT                   KPIPVKEYESMPLTKSATKLTHKMKEILEKELPN"
FT   gene            317687..318697
FT                   /locus_tag="FSU_0280"
FT   CDS_pept        317687..318697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25537"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR3"
FT                   /protein_id="ADL25537.1"
FT                   /translation="MNFFKKFLATTLALAASIYAAERVYLAPFSMVGLNEDFGIAAEKL
FT                   MNAYIDDNGRFILVNYAEDDSVKTGDRESANNIAIKKNCTKFIMAEFTRLGENVITAFK
FT                   LYDINNEAPVWSDRLKAKNPDDFDPIIQRVARNIGTRHKATNDDDIYTVTEQETKNPRK
FT                   KGVTSYWGAKIVGALPLNPSEAKMDAGLGAFVLYDARDLLFGFDWTITNLGESYDKTRL
FT                   IDLTLSAYYPFTTSNITPYAGGGLSYSWRDTHIDTDRFYNSNEANGLSLQIGGGVLFNR
FT                   ASRVMFIAQATYFIDFFETSFYREQYDTVGRITNIIESKHYMNGFKFGLGLAIGF"
FT   gene            318681..319265
FT                   /pseudo
FT                   /locus_tag="FSU_0281"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            319342..320745
FT                   /gene="argH"
FT                   /locus_tag="FSU_0282"
FT   CDS_pept        319342..320745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="FSU_0282"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by similarity to SP:O34858; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27322"
FT                   /db_xref="GOA:C9RPR5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR5"
FT                   /protein_id="ADL27322.1"
FT                   /translation="MAKKKDTQTNMWTGRFASGMAQSMVDLSFSLQFDAELIEEDIEGS
FT                   IGHGKGLVESGVLSKADYKKICDGLKSILDDYHAGKNLWCDSDEDIHMAVERVLTERIG
FT                   ALGKKIHTGRSRNDQVCTDFKLYMRHRAAEIRQLEIELMETVLDLSKKYFGKMMPGYTH
FT                   LQQAQPIYFSHYLMSMFFAVSRDVKRLDNFLELHSQLPLGSGAMAGSAFPYHRALVAEA
FT                   LGFKDVSPNSIDAVSHRDMMLEFNADLAIIANTMSRYAEDFVNWSSSEFGYLTLHDAFS
FT                   SGSSMMPQKKNPDSMELIRGKSGRMLGNFTALYTLAKGAPLSYSRDLQEDKEPVFDSVH
FT                   NVKVILRVMKEALETARFNFETMHAKMLPALLATDLADLLVEAGVPFRDAHHIVGSLVG
FT                   DAARAGKQFTELSDEAWAAAGVPDVAKMKKTLTFEYSVSKRNIEGGTGPKSVKQQFTKA
FT                   AALIKKLKK"
FT   gene            complement(320820..322133)
FT                   /locus_tag="FSU_0283"
FT   CDS_pept        complement(320820..322133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0283"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM71308.1; match to
FT                   protein family HMM PF09603; match to protein family HMM
FT                   TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26722"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR6"
FT                   /protein_id="ADL26722.1"
FT                   /translation="MNTVLNLKNTVLLAAAASFFSIVGCSSEESIVYSNENNPVFRDGK
FT                   IIDPRDNNSYGVALIGDLYWMTENLRYADSVSTKNLAGNTWCHEDDAKCEKYGRLYSWT
FT                   AALDYDKKFNSASVGYVSSTKGICPNGWRIPSGNDWLSLVNYVETNNGGEGSGTSLKST
FT                   ETWSASDEVRKPTNRFGFGAKASGRRNNDGETFMSTGRIAFFWSSNEHDNGTAEGWQLR
FT                   HDVGVIQLGNFYKDHGLAVRCVANKNSANIVTGKDVLDSSYLEKIPQDYGTLKIGDQSY
FT                   RTIEIDGVTWMADNVNVNDDGSSCYNDDKEYCKEFGRLYSYEAALKICPDGWQLPTKTQ
FT                   YSSLKMYAKTNAALRSTSGWSNNASKGLNFWGFDAKPAGGMDGKDFFDLKASAYFWVNE
FT                   NLSDESKASTFWINYYDQVPSFMSYDKKNKYSVRCVKK"
FT   gene            complement(322172..322837)
FT                   /locus_tag="FSU_0284"
FT   CDS_pept        complement(322172..322837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0284"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26910"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR7"
FT                   /protein_id="ADL26910.1"
FT                   /translation="MEELTEKLSEIKASIDAIRKTGKLSHWRMVYADTLYTRAQEYVAV
FT                   DRYPEAKLVAQKLDRWIQAHKPALETNKGDARPPMIFWNADLLNNIVKRIRTTLNAKKM
FT                   LVPSTERDSINRRLNIVDGWIQKGEYLVAHDELLALRSALIARLRRSYRARIVASSAYS
FT                   GGYVQPAGSTVGLYNSLHTLEETFHIVGEHDPIWIEDFLEIYNDLFRIVDRLVPQDKK"
FT   gene            complement(322837..323487)
FT                   /locus_tag="FSU_0285"
FT   CDS_pept        complement(322837..323487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0285"
FT                   /product="putative chemotaxis MotB protein"
FT                   /note="identified by similarity to SP:P28612; match to
FT                   protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26567"
FT                   /db_xref="GOA:C9RPR8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPR8"
FT                   /protein_id="ADL26567.1"
FT                   /translation="MRRNRDENSNPWMAYTDLGVALVSLFILAFVAMATLKEQKAEDLT
FT                   RTEEEVLSCQEQMRKIAAERNALLSKSLQTSIEAGLIALEDGKIQIQASFLFPINGANL
FT                   TKEGEGVIRGISKGLLEALDSTDVIMVSGFTDDIPFSGSTSYTNWNLSTERAVNVVKML
FT                   VKMGFPPDRLFAAGFGEHRPKYPNDSEEHRRLNRRVEIGVTPLQSNKTAEVTP"
FT   gene            complement(323490..325388)
FT                   /locus_tag="FSU_0286"
FT   CDS_pept        complement(323490..325388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0286"
FT                   /product="fimbriae-associated domain protein"
FT                   /note="identified by similarity to GP:3929312"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26737"
FT                   /db_xref="GOA:D9S5A5"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5A5"
FT                   /protein_id="ADL26737.1"
FT                   /translation="MKNAFNTILILTVVGFIALIAGALYFGAPAFGWIIMIAIMAVYLV
FT                   EQFSAIRKMKQIIAEDEVIDSCEKGNAYPEPGTGVVAKRIELAKRLLQKNIRLDSTIAF
FT                   DVLSSGSSIPLNRSVGSTVILLGLMGTFFGLMQSVATAGGAIDNSTTQGTLDTIQVLFQ
FT                   NMKGIFGTSLCGLFAALILSASRTVLSSKRDEFMAHLDTFTLDMQEDESAEGVIEEDKN
FT                   ELERLFESVEKNLSVIASSVKDGLAGVVSMVGEELSAMTSKLNQDVVESVQKVSTEMTS
FT                   SIKTVNDSLAGAVANMNESTQKFGELVGASVTNAFSPINENIGALSKSVEAIPSKLDDK
FT                   LNGISVALNASLEGLSSGVKSSLDGVSGNVETALSKVASEVKAGLDGVASDVKAGLQDV
FT                   AKGTMDVAYLTKDAMDEASKSIGDSVAEQVKQSSEQWADFMQRLEDKTTANVDSQREGL
FT                   ETLKNVALQVAENAQAGSAELSQNVSEKLGALSSDILGAFQKLSETSSVLLEAQKALTE
FT                   SIDNRVVKEKEATDALGGNIVETAELMRVNQSELSANLEMLRSGLETILEKLSGDTAEY
FT                   EEEDNFVEHLNQSLEAFHERASEVLMENAVKTQEILLEVLEQTQRSAIPAQPKAEG"
FT   gene            complement(325396..326313)
FT                   /locus_tag="FSU_0287"
FT   CDS_pept        complement(325396..326313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26255"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPS0"
FT                   /protein_id="ADL26255.1"
FT                   /translation="MEEAFRRAIRKMTGASVRLAVRPNRSAIVATLSQSMMVTWSIALF
FT                   EHLDAMLNNPDANVGSSELISYSESAWKLCESGFPQIFKDCEKLYSEFRAKWIQRFSTD
FT                   EVLRLLLEGGDFLVHDEEKGWALTVKNNKQDINNFYSATIHLLVSDAEPLFVRMHGRVM
FT                   QLQEKLCKYWLSESAVDPVSKLLPCLEASLREKENAMVVSLRTSLNSLAKKRFAAAFAS
FT                   KGPVRYYSSAMSCARNVGRYWNPHYAYENCFLAFTDDFCDYAQGLTTQVIEWYQSKWSL
FT                   FLRGFSRGQLNLFETVAPYQAQNV"
FT   gene            complement(326323..327039)
FT                   /locus_tag="FSU_0288"
FT   CDS_pept        complement(326323..327039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC95135.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26239"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPS1"
FT                   /protein_id="ADL26239.1"
FT                   /translation="MKNLICSSLVAVATVASVAVASGMPFPVAENNKVFLQEKDSPYVL
FT                   EQSVVVGATDTLVIEPGVTVLMGEFAKLMIQGSVKIAGTNDKPVVFSGADSVANWNGFH
FT                   IMSSAQPFEIKNLTVENAFRNTIFRSSGTLENVNFFNNYYGLWVDESPNVTLARCTFAH
FT                   NRYALSVRAGRVVSNGTSISENVYGLYLETAGKLDGDTDLIRNNQESDIRSEAADLKTS
FT                   KKRVRRNVWHNIEARF"
FT   gene            complement(327036..327875)
FT                   /locus_tag="FSU_0289"
FT   CDS_pept        complement(327036..327875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0289"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25489"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPS2"
FT                   /protein_id="ADL25489.1"
FT                   /translation="MNFTKFSAFSALSIALLTLCSCERNEIHLSFNTKTVSPQTFVLES
FT                   TLNASIPGDSINEPESMRTHVNVRSTMSLLMSYDDGSGRFEMKIDSVDYTSDKRSVDEF
FT                   RNIEKYLSIQNFQFKLDHDGIITDPTIENAVEMPSEDDLNLIPLFLKAQPLLPEKSVKL
FT                   GESWERQMPIFGKGNSSTTVYKTFTLQDVFLQDGVRMAKIHMGVKYLELPDTTSNLQLK
FT                   SSDYVVGDGMVLFDVTHGIISSAEMNLVAVIDVRDLVAGDTLPSMNVNQKITLRNVQ"
FT   gene            complement(327899..328366)
FT                   /locus_tag="FSU_0290"
FT   CDS_pept        complement(327899..328366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0290"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24670"
FT                   /db_xref="GOA:D9S5P3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5P3"
FT                   /protein_id="ADL24670.1"
FT                   /translation="MRMALRQAQIAFDMKEIPIGCVIVKDGVVIGKGYNQVEQLKDATA
FT                   HAEIIAIGTAASTLDNWRLDGCTLYVTLEPCPMCAGAILNSRVSRIVYGSPDSRFGGCG
FT                   TTIDVITGNALKRAVEVTGGILADECLGLLKGFFQQMRLEKGDTGAKPQTP"
FT   gene            complement(328540..328842)
FT                   /locus_tag="FSU_0291"
FT   CDS_pept        complement(328540..328842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0291"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26735"
FT                   /db_xref="GOA:D9S5P4"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5P4"
FT                   /protein_id="ADL26735.1"
FT                   /translation="MIDFITLHFDEIFFVCFFVAGLVIPILMGCNEHPYNEPKIWKIRL
FT                   VALPIILGCVFYIFRNSCGVLGRIYISLGLWLVFMFPRGYVEYMLYRRKSGNKKE"
FT   gene            complement(328853..329329)
FT                   /locus_tag="FSU_0292"
FT   CDS_pept        complement(328853..329329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25937"
FT                   /db_xref="GOA:D9S5P5"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5P5"
FT                   /protein_id="ADL25937.1"
FT                   /translation="MLGSIWPCLLFMLIITGVPVWLSKKKFSERENLKWKVYVLMLPAI
FT                   CLAFFCLLFCGEKAYHEFTLDVVFTWLGLTFFAWFILLPFFMIDPAFFRRDTNIWDNTN
FT                   YHSEVEENIDDLFDMAMKVGREKREGKDTSKQEAEYEQKLKNLEEISNSNKSNW"
FT   gene            complement(329383..330393)
FT                   /locus_tag="FSU_0293"
FT   CDS_pept        complement(329383..330393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0293"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25143"
FT                   /db_xref="GOA:D9S5P6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027633"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5P6"
FT                   /protein_id="ADL25143.1"
FT                   /translation="MNEVYGMIVSWMTTNKCNLTCKHCYQDAGENKSAELTTDEALKLI
FT                   DEIAKAGFKIMIFSGGEPMTRPDIVELVAHARERGLRPVFGTNGTLITHDLAFMLKEAG
FT                   AMAMGISVDSIDPARHNDFRGLPNAFELTLMGIENCKAAGLPFQIHTTIMDWNQNEIFD
FT                   IMDWVKEIGAVNHQIFFLIPVGRGKEIEGHALRVAEYEGLLRKIMEKSRTLGIPVKPTC
FT                   APQFLRIADQLDIKTRYSRGCLAGLDYCIVSPIGKVRPCAYMMEEAGDVHDTPFDEIWA
FT                   NAEIFKQLRTKAYKGACSKCKFNDRCGGCRARAAYYHDGDFMQEDSYCAYGRGLK"
FT   gene            330493..331746
FT                   /gene="fabF_2"
FT                   /locus_tag="FSU_0294"
FT   CDS_pept        330493..331746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF_2"
FT                   /locus_tag="FSU_0294"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P73283; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801; match to protein family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25204"
FT                   /db_xref="GOA:D9S5P7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5P7"
FT                   /protein_id="ADL25204.1"
FT                   /translation="MMNRRRVVITGMGAVTPVGKSAPELWNAIKAGKCGIGPITLFDAT
FT                   NCPVKIAAEVKDFKPEEHGIDPKEARRMARFTQFLVAAANEAVKDASLTKEEIAADTTG
FT                   IVAGNGLAGMDVVEETYSKYLEGGRRRVSPLAMPELIANEACANVSIALGITGSAWTVC
FT                   TACASGTDAIGVALDAVRSGRLDVCLAGGSESAITDYSIKSFAGMHALTDKFNDAPEKA
FT                   SRPFDKDRSGFVMGEAGAILVLEELEHAKARGAKIYAEVAGYGSSADAYHITSPRPGGE
FT                   TCAKAMVKALKDAGIAPTDVDYYNAHGTSTHLNDLTETQMLKIALGEHAYKIKVSSTKS
FT                   MTGHCVGAAGVIEAMISTLAIRDSFYPATINLDNPDAECDLDYVPHKGVEGNIDVAVSA
FT                   SLGFGGHNGIVVIKKFKD"
FT   gene            331896..332666
FT                   /pseudo
FT                   /locus_tag="FSU_0295"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by similarity to GB:AAN66992.1"
FT   gene            332685..334412
FT                   /locus_tag="FSU_0296"
FT   CDS_pept        332685..334412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0296"
FT                   /product="AMP-binding family protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25507"
FT                   /db_xref="GOA:D9S5P8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5P8"
FT                   /protein_id="ADL25507.1"
FT                   /translation="MILNKFLSKIDYKSYEDLYKNFKITIPNDFNFAYDVVDEYAKTEP
FT                   KREALVWCDDNDESHIYTFKDLSLASQRTANFLVEQGIQKGDRVMLILRRRYEFWFFLL
FT                   ALHRIGAIAIPATNMLAAEDLEYRFNAAEIKMVVTYDDPALQKEVDKAKSKCESVEKLV
FT                   TVGQTARQNWISFYDDYELFPSTFERPVGDAATHNDDIMIVYFTSGTSSNPKMVAHTYT
FT                   YPLGHIVTAKYWQHVVDGGRHLTVAETGWAKALWGKIYGQWIAGSAVFTYDMTTFIPGK
FT                   LLEKMAEYKVTTFCAPPTVYRYILQHGLSKYDLSSLQYCTTAGEALNLDIYNRFYEQTG
FT                   IRMQEGYGQTELTLTTGNFGFSEPHPGSIGKPSPGYQMEIINAEGKPCEAEEVGELIIK
FT                   IDQGKPFGMFGGYYRNAERTEKVFEGGVYHTGDTAYRDKDGFFWFVGRTDDLIKSSGYR
FT                   INPFEVEEVLHKHPAVLEVAVTGVEDKSRGQAVKATVVLQKGYEASKELAKEIQLFAKN
FT                   IAASYKSPRIIDFVTELPKTISGKIRRATIRDKDTAENVTAPDEANAENAASETSEEK"
FT   gene            complement(334510..335796)
FT                   /gene="hemL"
FT                   /locus_tag="FSU_0297"
FT   CDS_pept        complement(334510..335796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="FSU_0297"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27156"
FT                   /db_xref="GOA:C9RPT0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT0"
FT                   /protein_id="ADL27156.1"
FT                   /translation="MNHSLSEKLFAEAKTLMPGGVNSPVRAFSNVGATPPFIKRAKGSH
FT                   IYDVDGNDYIDYVGSWGPMLLGHAHDAVIKAVADTAQNGLSFGAPCGLESELAKFVMSL
FT                   VPSVEMIRMVNSGTEATMSAIRAARGFTGRDKIVKFEGCYHGHSDSLLIKAGSGMLTTG
FT                   KPSSKGVPADLAKYTLTLQYNDVAGVKELFDKIGDEIACVIVEPVAGNMGVVPAKPEFL
FT                   QTLSEETKKHGALLIVDEVMTGFRVGIHCAQGLYAIKPDLTTFGKIIGGGMPVGAYGGR
FT                   LDVMQQIAPLGGIYQAGTLSGNPVAMAAGLATMRELSTHPEHYVHAEAMTKRLIAGLKS
FT                   AATEAGIPLATNQVGSMGCIFFTEGPVTCFADVQKSDLELFRKYFLGMLDEGFYFAPSQ
FT                   FEAIFVSAAHTEDEIDRTIEAAKRVFKKL"
FT   gene            complement(335801..336610)
FT                   /locus_tag="FSU_0298"
FT   CDS_pept        complement(335801..336610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0298"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25718"
FT                   /db_xref="GOA:C9RPT1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT1"
FT                   /protein_id="ADL25718.1"
FT                   /translation="MKEYEAFLKNLGVTNAIAQDIIEIATVLVVIAIILAIIKFILSFA
FT                   IKKGADESVKPLLYSLFSYALYIVGLLMILHILGVNTAGIVTVIGAASLAIGLALKDTL
FT                   GNIASGILLLFLHPFRASDYIECGSLKGKIVGVGLFNTTLISLDGLYVSAPNSMLWGAP
FT                   IVNFSRNPSRRLDLAFGIDYADSAETAMNEMKQLVDNDPEVLKSPAPSFFVSALEDSSV
FT                   AVNLRIWVKTANYWDMRCKYMKAVKERFDEVGISIPFPQRVVHIVKE"
FT   gene            complement(336678..337643)
FT                   /gene="hemB"
FT                   /locus_tag="FSU_0299"
FT   CDS_pept        complement(336678..337643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="FSU_0299"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by similarity to SP:P30950; match to
FT                   protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26442"
FT                   /db_xref="GOA:C9RPT2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT2"
FT                   /protein_id="ADL26442.1"
FT                   /translation="MIIRPRRLRRNEVIRNMVAETAVNPDALVYPMFVVEGTGVKEEIP
FT                   SMPNQFRFSIDEILKELESCVALGIKSILLFGIPNHKDEMATSAYDKNGIVQRAVRAIK
FT                   AKFPSLYVITDVCLCEYMSHGHCGIIKDGDVDNDPTLELLAKTAVSQVAAGADMVAPSD
FT                   MMDGHITALREALDNAGFTNTPIMGYSAKFASAYYGPFRDAADSAPHFGNRKSYQMDVR
FT                   NGREALHEVELDLEECADIVMVKPGLAFLDVLRQTAEISNVPVAVYNVSGEYSMVKAAA
FT                   KMGWIDEKSIIRENMIAFKRAGADIIITYHAKEILENKIL"
FT   gene            complement(337649..338545)
FT                   /locus_tag="FSU_0300"
FT   CDS_pept        complement(337649..338545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0300"
FT                   /product="siroheme synthase"
FT                   /note="identified by match to protein family HMM PF01903;
FT                   match to protein family HMM TIGR01470"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26023"
FT                   /db_xref="GOA:C9RPT3"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT3"
FT                   /protein_id="ADL26023.1"
FT                   /translation="MKAILIIAHHCILPGAYKGFEEILDRLHHDLPGTRVASTSLLDLE
FT                   NDLRTLLREDVESVTLLPYLLLNGQHTKNDVPRVVAKLQEEFPQIPITLLPCLGDWKEF
FT                   SSMVVCGIRNAQLDEKKPSESLVSRLSSKTSNLFSIELNLEGRNVLVVGGGRIALRKVK
FT                   TLIPTGAHITVVAPQIDPEFETLKADEPSSITLKQRPYEPLDLRCVFMVFICTDQPAVN
FT                   AQVSNDARARRILVNNACDYLDGDFIVPARMDFGENIAVTVSTQGRAPSLAKKLKQKIQ
FT                   TEWAEDLAQIEKDFKKE"
FT   gene            complement(338545..340122)
FT                   /gene="hemDX"
FT                   /locus_tag="FSU_0301"
FT   CDS_pept        complement(338545..340122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemDX"
FT                   /locus_tag="FSU_0301"
FT                   /product="porphyrin biosynthesis protein HemDX"
FT                   /EC_number="2.1.1.107"
FT                   /note="Also 4.2.1.75.; identified by similarity to
FT                   GB:AAK00606.1; match to protein family HMM PF00590; match
FT                   to protein family HMM PF02602; match to protein family HMM
FT                   TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25214"
FT                   /db_xref="GOA:C9RPT4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT4"
FT                   /protein_id="ADL25214.1"
FT                   /translation="MENSNHFGKVYLIGAGPGDPGLLTVRGKSILEKADVVVYDRLVSP
FT                   GVLSLCNPKAKMVDVGKMPTHHKVKQSEINKLLVKFAVEMPGATVARLKGGDPFVFGRG
FT                   GEEALELVDAGVEFEVVPGVTSAIAVPAYAGIPVSHRGIATSFHIITGHEKAEAGDSLS
FT                   LDFENLAKSQGTLIFLMGIANMDFIARRLIECGKDPKTPLAFIEKGTTPNQRTVMATLE
FT                   TAGETIVRENVTAPAITIMGGVVELGKTLAWKKNLPLSGKRLVVTRAAKQSSGITARLT
FT                   ALGAEVIETPMIETRNVLPYCHAELPSCIANSYEYDTAELADLADFEDLKDFDILAFTS
FT                   TNGVESFFEQLFTAEYDVRELAGKKIASVGKITEKKLLEYGIRCDYVPKDHTGEGLGLL
FT                   LREVVDDESRILLLQGNLADDTLLKLLPKATRWIVYETLPIAELPDWKREAIASADAVV
FT                   FASSSAVENFAQISSLSSFVSRLSFCIGRMTEASAKKHGFETVTSDETTMDSLVKKIVE
FT                   YYTMGENA"
FT   gene            340177..340734
FT                   /locus_tag="FSU_0302"
FT   CDS_pept        340177..340734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0302"
FT                   /product="putative deoxycytidylate deaminase"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25546"
FT                   /db_xref="GOA:C9RPT5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT5"
FT                   /protein_id="ADL25546.1"
FT                   /translation="MNSSRAKLRDEVYTQMMCAQARLSKDQNTQMGAVLVSADGRVIST
FT                   GYNGAPAGFDDETVPYTREKQLLAYDLLDADSGELLSHHEFEANKYPFMVHAEINALHY
FT                   ARGKVPPGSKLYVIGFPCERCSLDISLSGVAEVFVTKDDYDPKSTLNNNRDTAYYMFAQ
FT                   AGIIVTLCGKRIKPVVSKPEKK"
FT   gene            complement(340868..341923)
FT                   /gene="hemC"
FT                   /locus_tag="FSU_0303"
FT   CDS_pept        complement(340868..341923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="FSU_0303"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by similarity to SP:P06983; match to
FT                   protein family HMM PF01379; match to protein family HMM
FT                   PF03900; match to protein family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24562"
FT                   /db_xref="GOA:D9S5Q5"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5Q5"
FT                   /protein_id="ADL24562.1"
FT                   /translation="MSDLKLRIATRKSALALAQTTMVADAIVAANSVIGNAADSNNARD
FT                   SLTYELVSMTTEGDRRLDKSLASFGGKGVFIKELEIALLEGRADIAIHSLKDMPAEVLP
FT                   QFKLAAVLKREDPRDAFLSRGGSAGIRFMDLPAGARVGTGSIRRVVQLKALRPDLEYVP
FT                   IRGNIQTRIGKLAELDGVVLAAAGLKRMGLADQVTEYFSTEQMLPASGQGILAIETLND
FT                   ATVQESRVTGRADLAQILARVNDVATYCIASAEMAYLKALNAGCQFPVASFAEFVCEDG
FT                   IENRGTCGALEENANRIAQTLKIRGIYWDEKSEKLLRAEVAGNVDLNSEDCVQQSKNLG
FT                   IELACAIQKQL"
FT   gene            complement(341936..343189)
FT                   /gene="hemA"
FT                   /locus_tag="FSU_0304"
FT   CDS_pept        complement(341936..343189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="FSU_0304"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM PF05201; match to protein
FT                   family HMM TIGR01035"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25551"
FT                   /db_xref="GOA:C9RPT7"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT7"
FT                   /protein_id="ADL25551.1"
FT                   /translation="MRKIYMAGMSHKVAEIAIREKFYIPMDVKTEALMHSPFDELLILA
FT                   TCNRTEVYVASDREISDGELVRYVCGLARQDYDDFAKFFYFKSGDDVAHHVMNVCAGLD
FT                   SVAMGEDQILHQIGRAYETAHQLNATGNTLNKLFQSAIHTTKRIKTETNLSKLSCNIPF
FT                   LAMKQVQKTFDDLENRTVYIVGLGEMGSLMLKYVQENTTKIFASSKTFANAEKFADVLT
FT                   PVKFEDRYEVLGKCDVVILCSACQEPIVTKDEFVKAIQVADSIDVPSKRLVVDLANPRN
FT                   AEASIGELPGVEYVCVDDLEKIVSENRRLRMIEFDAAQKILKEGLDEFLHWNRMDEVSK
FT                   QIHLHAEKMLTTANEESEKLLRSMPELSEDDRHRIQMMYERFAKKMANDFLYKVKAENS
FT                   PEDVQVFLKCLDSKSPRN"
FT   gene            complement(343498..344361)
FT                   /locus_tag="FSU_0305"
FT   CDS_pept        complement(343498..344361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0305"
FT                   /product="nirD domain protein"
FT                   /note="identified by similarity to PIR:G83581"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25002"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5Q7"
FT                   /protein_id="ADL25002.1"
FT                   /translation="MLSQKLLAIIQDGFPLVERPYKALAEMLNVSEQEVFDEVEKMCVS
FT                   GVIRRIGGVYDSKKLGFISRLCAGKVPALSLDFSAEPHSQTPMEKFATVVMSEPAITHN
FT                   YIRSHEYNVWFTVIAENESAIQTVVDRVCAQTDLHDVHVLTATKKYKINTVMSLDERRK
FT                   TKDERGESAPALRHSEDQVPRLSDNRRLEESSNFLGKLTDSDKSRIHIACDDIPHTLTP
FT                   FKDWGVSCDELREDLAAKRMRRFGAILRHQDAGFPCNAMVCFSLDERRKTKDERGECCG
FT                   DACIPP"
FT   gene            complement(344384..345556)
FT                   /locus_tag="FSU_0306"
FT   CDS_pept        complement(344384..345556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0306"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26696"
FT                   /db_xref="GOA:C9RPT9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR023930"
FT                   /db_xref="InterPro:IPR034479"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPT9"
FT                   /protein_id="ADL26696.1"
FT                   /translation="MISITKLLMDTPNFGDSLRYEPRAHESKNGVGPGRGPVVVWNCTK
FT                   TCNLKCVHCYARSEAIKYQNELSHEEGIKLIDQLADFHVPVILFSGGEPLLRPDFFELA
FT                   NYAASKGIRPTISTNGTCITPDVAQKLKAMGVGYVGISLDGCEETHDKFRGKQGAYQMA
FT                   LRGIRNCVATGQKVGLRFTITKYNYQDLNAIFDLLEAENIDRVCFYHLVYSGRGSAMVD
FT                   NDLNHEESRKVMDLIIDRTLDFKKRGVNKEILTVDNHADAVYLYQRMKREDPERAEKIL
FT                   DLIQRNGGNRSGMAFGNIDSIGNVHPDQFTQYITLGNVRERNFGDIWTDESNPIMAGLK
FT                   NRKPILKGRCPNCKFLNLCNGNFRTRAEAVTGDFWAEDPACYLTDEEIGL"
FT   gene            complement(345586..348081)
FT                   /locus_tag="FSU_0307"
FT   CDS_pept        complement(345586..348081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0307"
FT                   /product="internalin domain protein"
FT                   /note="identified by similarity to SP:P25146; match to
FT                   protein family HMM PF09479; match to protein family HMM
FT                   TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26315"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU0"
FT                   /protein_id="ADL26315.1"
FT                   /translation="MLRSFYAFICLLIAGNAFAVVAVRDTIYIDYDLQGGTNNPENLSS
FT                   YLYKYSDRSDAPSINFFPPTKDGAEFLGWYFNSSPYDNNAITYADAVISVTRTQNGRLS
FT                   LYARWGVKAKIPQQNESGCMLVHDAAELYGAVKVSDSLMRKNKQICVSIENDIVVNKNL
FT                   LASDGTPNEGSHYWWKPFGNFMGVIEGNGHTISGLYGNVGLVNLAEGEHNALIQNLGII
FT                   DSYFAGNGYVGSFIANTLGFGTSLKNVYSTATLDSRGSYVGGLVGYARVQQDYCIDVTL
FT                   ETSISKAPRAANTYDNNHNAVTVENAYFAGRLVGYRGGGLVGGTDFSVFKNTFFVGTAE
FT                   AKEIFSAISQKGLTQCQDFPNWKVVAENTFYIDTYTNDEFEASAASATAFSDGTVLEKI
FT                   VKGSSYPIWTQDIGKDAYPKLNGVYYDIAYDLAGGVNDSVNPSYYKPEQEVLLKPASKD
FT                   GDIFEGWFADSNFTTPVEKILATDKGNKKFFAKWKKGYSITYVNDGTYSSVLNRNPVYR
FT                   YADSATFVLKEPSKNGKTFVGWYSDSSFTTKVTELPTGNTEDIVLYAKWSAREIKIIYN
FT                   LDGGTMGDAKNPETAMSGESILLKSPTREGFLFRGWIGPNGGNLDKLGDFDRSIYVNSK
FT                   DDEFNLKAVWIYAPQKPATDADGCYLVTNVHELFYFDEIANNELSEKPPIKSCIKIMND
FT                   IVVNENMNKDYVDWHPMNYENIFAGIIYGNGHSISGMYMSCNFFYNDNYKAFYGLIENK
FT                   PYQQVYPEVQNLYLANFYFANEYYDKVLLNVNGRDGVGGPRSGIRKTIDPTPLKKNFAP
FT                   RYDAKGRSMNARPNYGVYF"
FT   gene            complement(348244..349392)
FT                   /gene="tgt_1"
FT                   /locus_tag="FSU_0308"
FT   CDS_pept        complement(348244..349392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt_1"
FT                   /locus_tag="FSU_0308"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25920"
FT                   /db_xref="GOA:C9RPU1"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU1"
FT                   /protein_id="ADL25920.1"
FT                   /translation="MKLNENPFELLKKSAKSKARLGVIHTAHGDVTTPVFMPVGTAATV
FT                   KGLTSRDIREIDAEIILANTYHLYLRPGTKLIAEAGGVQKFMSWNKPMLTDSGGFQVWS
FT                   LKQFRKITEEGVQFKSLLDGSRHLFTPASVMNAQREIGADIIMAFDECTPYPSTVEEAE
FT                   KSLALTLKWTREAKEWLLANPPIHGYPQFFFGIVQGGMHKELRQKSIEALKEIEPDGYA
FT                   MGGLSVGEPVETMYEIADFCTNLLPEDRARYVMGVGTPWNLLELVKRGVDMCDCILPAK
FT                   NAQDGLVYTSRGVLRYKGAKFAHQHDLPLDPNCDCYCCRNYSRAYLRHLFKEKEPLGWT
FT                   LAAIHNLHFYIHLMKDVKSNIADDTFEEWADEQVKMLQENAG"
FT   gene            complement(349382..349552)
FT                   /locus_tag="FSU_0309"
FT   CDS_pept        complement(349382..349552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25096"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU2"
FT                   /protein_id="ADL25096.1"
FT                   /translation="MAIDHNLLTGQFRPLGENKIEHTLSASQKVLPTHTGKSAVRHLTP
FT                   RKSRSTKSREA"
FT   gene            349736..351121
FT                   /locus_tag="FSU_0310"
FT   CDS_pept        349736..351121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0310"
FT                   /product="pyridoxal-phosphate dependent TrpB family enzyme"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01415"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27160"
FT                   /db_xref="GOA:C9RPU3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU3"
FT                   /protein_id="ADL27160.1"
FT                   /translation="MRNSLKIDGQVKTYLHEDELPKAWYNVRADMKKKPAPLLNPGTGK
FT                   PVTFEDLQPVFCDELIKQELDNDTAYIEIPEDIRTFYKMYRPSPLVRAYFLEQALGTPA
FT                   HIYYKFEGNNTSGSHKLNSAIAQAYYAKKQGLKGVTTETGAGQWGTALSMSSAFFGLDC
FT                   QVYMVKVSYEQKPFRREVMRTYGASVTPSPSMTTDIGRKINAEFPGTTGSLGCAISEAV
FT                   EAAVKQPGYRYVLGSVLNQVLLHQSVIGLETKAALDKIGVKADLIIGCAGGGSNLGGLV
FT                   SPFIGEKLRGEADYDILAVEPASCPSFTRGKYAYDFCDTGKVCPLAKMYTLGSSFIPSA
FT                   NHAGGLRYHGMSSILSELYDQGLMRATSVEQTKVFEAAKLFAQTEGILPAPESSHAIRA
FT                   TIDEALKCKESGQAKNIVFGLTGTGYFDMVAYQKFNDGEMSDYIPTDEDIAKSLAQLPK
FT                   VEG"
FT   gene            complement(351242..351502)
FT                   /gene="rpmA"
FT                   /locus_tag="FSU_0311"
FT   CDS_pept        complement(351242..351502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="FSU_0311"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26184"
FT                   /db_xref="GOA:C9RPU4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU4"
FT                   /protein_id="ADL26184.1"
FT                   /translation="MAHKKGQGSVRNGRDSNAKYLGVKKYAGETVKAGNIIVRQRGSHF
FT                   HKGNNVGMGKDFTLFSLVDGTVKFERLDAKRQKVSVYPEEA"
FT   gene            complement(351506..351991)
FT                   /gene="rplU"
FT                   /locus_tag="FSU_0312"
FT   CDS_pept        complement(351506..351991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="FSU_0312"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by similarity to SP:P02422; match to
FT                   protein family HMM PF00829; match to protein family HMM
FT                   TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24569"
FT                   /db_xref="GOA:C9RPU5"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU5"
FT                   /protein_id="ADL24569.1"
FT                   /translation="MYSIVETGGFQYKVELGKAYKVPTIDAAVGSELELKSVLLFSGKE
FT                   VQVGTPVLNDASVKVEVLAHGKEDTIIVFKKKRRTRYERRNGHRQGYTEVLVTELRSGA
FT                   ESAVVDPQVITRNRARVAALAKQKVQNKPLTRKEKIAQGLPKPAKVKKNSLRKAKEA"
FT   gene            352552..354312
FT                   /locus_tag="FSU_0314"
FT   CDS_pept        352552..354312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25700"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU6"
FT                   /protein_id="ADL25700.1"
FT                   /translation="MKHLSMFLMSCLAISTNAATYNAQGKAINSKDAQNPGIVVYEKTK
FT                   VINQNKKTNHNILAKTNSNDRVTKSYAIYNSDESIYYMDGYKKSFKAFFDTYVNPREER
FT                   DAPRNNYQPLNLSNNAARYRSNNGDECKVVAGTLPTNKHFYKQNDRQMLLDYVTGTSFG
FT                   VSIYDNYDKTSFTCNSTGNHLHLSLCLGSLGSGINIYNVVGDKKIDITKQSCKNETQSN
FT                   QYALRDYKLGIDHFFADKLVSAIAPYATRYTIDEGDARKQGKFAAHPQNPYTLDMHIGN
FT                   TIATSSKNVVTYNEESAYLDDYIYNNRVIEFVPYTENGTKTGAGIAMNAISVGGIEQIY
FT                   YENGTQKGLFVNKVNVPRLPYAAGYAKPEIYHLGNMYFKYDKQVIEYGPQNALAQHVRG
FT                   YSDNWGASSLAAAMTAVLLSKQPFYKWHPEVVKALWLTAYSEELPNLYYNSNKVLVQGK
FT                   HISTIQELMSKNVSRYWYGNNDDFFKNETETFVASVEPGKKYAAAIAWLVRGDYALNES
FT                   EVSSNYTLTIKDSKTGKILNTPENSVATYRFAELIIPAGVTQLKFEIKRIKNTGDRIIL
FT                   GFNLHKVSSN"
FT   gene            354697..357528
FT                   /locus_tag="FSU_0315"
FT   CDS_pept        354697..357528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0315"
FT                   /product="putative lactase"
FT                   /note="identified by similarity to SP:P77989; match to
FT                   protein family HMM PF00703; match to protein family HMM
FT                   PF02836; match to protein family HMM PF02837"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25031"
FT                   /db_xref="GOA:C9RPU7"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU7"
FT                   /protein_id="ADL25031.1"
FT                   /translation="MSKIISLDGDWQMIWDTEDTGISNRWYATYPEKTQTVSVPHIWER
FT                   AFDKLLMAQDCAFYFKRFTIDDEKQVTKRIFLRFEKIATHATIWLNGKLLGDHFGAYTS
FT                   FVIETQKAIKLGEENILCIRVANMGATNSRIDFGRESKEGANDRYAHPGEMPVGLPWSQ
FT                   YPYGGICGHVDLILGNAAFISDIHVEPDMDQERVSVEAFFNNPRGYQSRLRILMKNPNG
FT                   DVYEFFKDIKLEKENATQKFLLGIKDWKKDKCVWSPERPNLFAIEMQLEIKGAKGKAPE
FT                   YTFPVVKTFGFRKFDCLKGDYYINDSIVKLMGVSYNQQWSEGGLWTDQNPALEKDLNAV
FT                   KAAGFNVIRSCGAPLSSTALDICDKIGLFVFQEFPIHTMRSTAQGLEITKKLINDMVRD
FT                   QHNHPCIAAWILGSENGTFMLQNGNKLLNAISPIDTCRPAISNFNSIYLDNEANFHKDT
FT                   GKIIPVSIDRISQYATMRVNPRLNPSAAYTHYLAHMLDKEDEELMVPDTGLGDSHFQDE
FT                   EEPILNDIENKVLVTLKNNTLFPKRATTIAGPRSIKSQKAIKNEFKSVETFVDDSKLSI
FT                   WPNFESFNADVYRIALKSKYDQITAFQSNPQISGFFLDQWADNGTDFSGLNDENRKSKG
FT                   VQNFAREITTPSRVLISELEHVATPQSEVSFQLTLLNNSRLEDVEIEVSLLDAKDKVLN
FT                   TQKVMPEEPAEKKTLTQLGICTLMAPRATGLYKIKLTLKDCGKEIHSSYEDLIVIEQAD
FT                   VKDAMSKVCFLDNYDESSDVLAALDGSEQIIFTANLSSWPDEILEKIIDVTKNGGKTLL
FT                   LSDMTTEDIDLLNQSHNFENKIEAHWTTGANEFSLHYLPKDSPLLAVFGGNGVLDHNSA
FT                   SAMPGISLNELAGAKVYARSVTLKDGEIKTGVDLQLVPFGKGQIMFNQFSVIEGLETNA
FT                   LSDALFTAIVNLL"
FT   gene            357609..358880
FT                   /gene="proA"
FT                   /locus_tag="FSU_0316"
FT   CDS_pept        357609..358880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="FSU_0316"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by similarity to GB:AAB39854.1; match to
FT                   protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27153"
FT                   /db_xref="GOA:C9RPU8"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU8"
FT                   /protein_id="ADL27153.1"
FT                   /translation="MTQNNVNLEKYSDELANNAKNASKKIRTLSAEKRAAVLARVAEIL
FT                   RAKKPEILAANKIDLEAAAGKLDDSKMDRLTLNDARIESMAKGAEEIAAFTDPLGRVLE
FT                   SRELKNGIKISRVAVPIGSVFFIFESRPNVTIDGACLCFKAGNAVILRGGKESLNSAKC
FT                   LAGIFHQALEENGVDKDAVQLVTETSHDLVGMLLQRNDCLDLVIPRGGERLIRAVVEQS
FT                   KIPVIKHFNGICHVYVDKSADMEKAVNILINAKTQRTCVCNAMECVIIDRHIDDANVKK
FT                   LIDCLADRGVELFGNKDAQSHDSRIKDIGDDSNYHHEYLALKASVKFVDNVEEACDHIE
FT                   KNSSRHTEAVVAEDASVQDYFVANVDSSSVMVNASTRFADGGEYGLGAEVGISTDKLHA
FT                   RGPMGVESLCSYKWILRGNGQVRG"
FT   gene            358927..359277
FT                   /gene="hisI"
FT                   /locus_tag="FSU_0317"
FT   CDS_pept        358927..359277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="FSU_0317"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="identified by match to protein family HMM PF01502"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24760"
FT                   /db_xref="GOA:C9RPU9"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPU9"
FT                   /protein_id="ADL24760.1"
FT                   /translation="MKFEDLIKEVKFEVEFGGVKLAPAIVQDADKGDVLMMAWMNEEAL
FT                   RRTHECGEMVFWSRSRKEYWHKGDTSGNVMTVVEWAADCDSDALLFKVRMKGPQVACHT
FT                   GARSCFFKTCDK"
FT   gene            complement(359323..360582)
FT                   /locus_tag="FSU_0318"
FT   CDS_pept        complement(359323..360582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25331"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV0"
FT                   /protein_id="ADL25331.1"
FT                   /translation="MVKMRSLFVLIFLCLASASLWAQESQMVSKKSLFLRAREVLHESL
FT                   KNEDYERAATAFDYLRENVSAGAPLELFEEYLVDMELKRFENAIAIYTDGRRAFLDSAY
FT                   TKKFDLRLRENDGLNLYLYRHLSPFDKPIADSLIARVDSSDIKQESKDLYKTLLYSEIL
FT                   LGYKTKLSNSSDSVRYIYFIKDTTCAEDFLLTAQNFVQNYPSSVHSSYLKDQIIPFVQK
FT                   IMDRHRLYRKDPFAHKYYTGGSNLYVYKWMGTLSGDATDYLNNKMGTSFMIELSLRSWR
FT                   FSLNGYYSYGMITYLKPDFKNDSDDVSEEDVTYGLNLGFTAFDSRYIRVEPFLGYSRTS
FT                   FESVAHADASDEFALGTNIDYRFWSTTPKNAFSYLTVSCFLRFKYMAQFGSFKQEGVGN
FT                   NKKLGTVRHTFALGVGIGDW"
FT   gene            complement(360583..361839)
FT                   /locus_tag="FSU_0319"
FT   CDS_pept        complement(360583..361839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26344"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV1"
FT                   /protein_id="ADL26344.1"
FT                   /translation="MKMRILLSLLLLSVVAFSQPSKKELYDRARDVLRKSLECRDYERA
FT                   GEALDYLKTNVENGAPLSEMEEYLVNLELGRFEDALVFYGDIHRDIFDKNYTRPAVSRV
FT                   EVEDLLNRYLIQTNKMDKRFVDSLCVRIDASDERQEYKLLHKTLIYLDFVAAHASTVGE
FT                   GDDVVVLNYNEDLSSLEEFLALIKKYVEEYPYSDHAAYLKDLFIGPVQKYLEEQKQFKQ
FT                   DPLGQKYYTGGFGFYMYMGFGFMTGEGSDYLNYESDTPIMLGLDFRVKRFDLSLFWSFG
FT                   YITGYNFKKCDVDVKEMSSGGINIYGREGTWAVGASLGFVAYDSKYLRVEPFVGVSSLR
FT                   YDHLASTTLVPEFMLGNNVDFRFYAAQPSSVGAYAHSFLLRFKYMMHIGSVEEKCCNNG
FT                   KDFSAVRHTFAFGIGAELW"
FT   gene            complement(361843..363141)
FT                   /locus_tag="FSU_0320"
FT   CDS_pept        complement(361843..363141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27110"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV2"
FT                   /protein_id="ADL27110.1"
FT                   /translation="MKPFFLLILLCSIASFAQPSINKNFDEFEKSLMLNGSAENSAESE
FT                   QPSLDKFEQSLMAESSDMEPIYRARDNLLESLKEKDYSQVLKLMDTLSTMENRMVIPLS
FT                   SIEKEVIYIEIQKYDKLLDYLVEFYRGVYDTSRYEQNVVFASQDGLEIYLQQRLRERTE
FT                   FKNEFYSLNEEVLKKLPKRKRDKLKMLLLLPEAYKSEKYGTIVLHLAESLIADYSNDPD
FT                   VPWIKNCIYLPLSRMDPVEFMLQRRKEQKENIIQEKLYSGGFGLNALFISLGGASGSKN
FT                   FYNRERFEVENLPINIEIYAQIKRFAILGELVNNGMTGSHTYEVGLGFVAFDSRYLKVR
FT                   PYIAWGKSFMEMRPKDDEWVAYGNDSGPMTFTAAVNVDFKFITAFLFYADHAFSSFSLV
FT                   GKLGFSNIDFDHKYVKGETTSFFFNLGLGIYLW"
FT   gene            complement(363150..363488)
FT                   /locus_tag="FSU_0321"
FT   CDS_pept        complement(363150..363488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0321"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25263"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV3"
FT                   /protein_id="ADL25263.1"
FT                   /translation="MRLVGQKISIALLALSFAGCAGSNQNGTQQSLRRAPLDESVEVAI
FT                   IPASLLPIIPEKAEHVNTLLLTGSAFGNEEVFKSVARKQGANFVFVKKTGEYYGSTASV
FT                   VDLYYLPE"
FT   gene            complement(363595..366732)
FT                   /locus_tag="FSU_0322"
FT   CDS_pept        complement(363595..366732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0322"
FT                   /product="SNF2/helicase/endonuclease domain protein"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04471"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25841"
FT                   /db_xref="GOA:C9RPV4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV4"
FT                   /protein_id="ADL25841.1"
FT                   /translation="MLDSIKITETSFVFDNTNAPFLKTLTDNGFATLLADGGIDVPFEN
FT                   VYELNEFEREIVGLPPLYPFEILVSHQGIPFTPAFTYEVSYKSFAPCGDELPKKEQKGP
FT                   VVSLIVKGEQIEYLLTLEQYRLVKALAEFNGLQSKSKLESYKSFAEIKELSKESASALD
FT                   ETLNNRNVVLPKNVRLDISYNNGELEITPSIDDSSNDEFVKKFDGSSEVHDHYPMAKGV
FT                   QKTIVVLDTPVQESLKKVKQKRKVKNPEEIKAIVEHPEEFFDPEVTDLSAFYSDRVIGK
FT                   GLYEPKVYPFITPYKSQWIPSFEVEDRTNGTTKIAIKNATELAEFSEAIATAKRENKPY
FT                   CEYKGANISIGEAEKMEKFAKEQLRKKEAVTATGPNSIEEKKKQHEVLLIEENLEVTGY
FT                   DVTKEQNYLPKHLTLEENPYLQKEFKLKDHQVEGIAWLQNLAKNAKGGLLADDMGLGKT
FT                   LQVLYMLDWHSRFNNAANKPYLIVAPVSLLENWVREYKRFFKEGMNIEIVERIPNENKG
FT                   FVAFHAYKHIMVVGYEAMRRGQFTLAAIDFAVIVLDEAQKVKAPGAMVTNAAKALKSDL
FT                   RISMTGTPVENTYMDLWCIMDFAVPGLLGNAKEFARKYQDPLKDAETDIAMLGNKLRHE
FT                   LGGYFLRRIKSEVSKDLPEKHVEYHKVPMPSEQYSRYVAAINLGIKTHAHPFERIQSLR
FT                   KISDHPYLDFKDVDHLSVDDLIRSSAKLSATMRILEDIRAKNEKVIIFTDRRDMQRMFQ
FT                   RILLQKFGIEASVINGDTSTSDRGNKVSRQKTVDIFQEKSGFNVIIMSQLAAGVGLNVV
FT                   GANHVIHYSRHWNPAKEMQATDRVYRIGQTKDVYVHFPMAVCDNFDSFDVVLDALLQNK
FT                   THLASASLYPTDRIEVVQKELDGKLFGTTMADDQSYVALEDIDDMNEYLFEAFVAVFYA
FT                   ALGYKTVVTPRSGDKGVDVLAFGSKDNLAIQCKHSRNKVGVEALGEVAVGANVYKEKYS
FT                   GKVFKPVVFTNSEFGVDAKERAKSSDITLVDGSSLSKSFKSNTYQWNDVYMADSNR"
FT   gene            complement(366722..368089)
FT                   /locus_tag="FSU_0323"
FT   CDS_pept        complement(366722..368089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26078"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV5"
FT                   /protein_id="ADL26078.1"
FT                   /translation="MINLPDFDKKAFVKRAKNVFPAKLEVLLNEHLQKMEALVAKLDVV
FT                   EETEISESAVLAIRRKIVAYFRNTPEQDPFSIRERRLMCYFAGDIVGGPVTYEKIATII
FT                   NTGWGDRYLAPLMRVCLNKWNSVSDEIAPMHDLFLKKLKAYKGPQSRYNEWKEKLDYFK
FT                   AGNTRVLNGAVNLGKNLRMGYESPLDFKSVIDFPKDMIHSEYFQKVIRTFYTADVGKGI
FT                   PQSLDNVLEEHGNSDTSMIVLSDFIRGCEERSVKRDQLKLQSMALRRIGHPADKGKWTL
FT                   FDKRDSELQKKVENARQIVNFWLIQEYINEIFQTLIVDPRRKEFWLQLTKTISDVKVIG
FT                   PADGKRRLSRIESLKDSLDYCFKVTASQTSAYAFVMTIGSYKFIEFSEKGNALYIYRND
FT                   ENVDQLLGANRIYSVNDLKKPYLPNMDTSYAYSCRMVHKSSNWEYPLLMWMKRYVR"
FT   gene            complement(368100..368831)
FT                   /locus_tag="FSU_0324"
FT   CDS_pept        complement(368100..368831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E86127"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27028"
FT                   /db_xref="GOA:C9RPV6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV6"
FT                   /protein_id="ADL27028.1"
FT                   /translation="MARRHKITLDAGGDQNPFAMSTGDMMSGLMFVFVLLIIALVWQIT
FT                   KQDNIKKQAINKYQDTRDEIYKELKSTFKDSLNVWGAELDSATLTVRFNEIALDGTPVL
FT                   FASGDTLLPPRYKSMMKFFFPKYLEILDGEKFREHIEEIRIEGHTDSTPCYSLCKTLER
FT                   NYLYNMNLSQARSRNVLRYGLTETDVSKDTTLLEFARKYIIATGLSFSQPRATQEKSRR
FT                   VEIRVRTKAQEQIEEIIKTLK"
FT   gene            complement(368831..370585)
FT                   /locus_tag="FSU_0325"
FT   CDS_pept        complement(368831..370585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D82160"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24842"
FT                   /db_xref="GOA:C9RPV7"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPV7"
FT                   /protein_id="ADL24842.1"
FT                   /translation="MNFIGKIMGDTCTLVVLIFLFIIFVYYIWKVIKICKITISQIGNV
FT                   ANRPNLLEYLEKPYLVTRFISKEYKRTICFKDRDDSLKTSEFASDYFNLGAILTAAKIN
FT                   VNAMGAAAGILVGIGVLGTFIGLTIGLGDIDLTQIKDNPDQLIKGVGGLIAGMKTAFVT
FT                   SVAGMLLSTIYTLAEKYSLNILTKKCVTISDKLDEVYYISELEKQTIIQERQKKDMSYL
FT                   VKGLVSEMNKSMDSQIKFVAAEMTKNFTAIDGNGNTVTSGNMLNAVMKSCAEQKSMIEG
FT                   VLEEFYDRLSDGLRESALEPLMQKLDELTKAIQSPAASMASSIGDDLRRSIMEMIDELK
FT                   NSVSNATTERLEILGRQLDNASDTMSTLPEILQKLTENIQNNVGQMSEQISAANAQTAQ
FT                   VGANLVEKQSQMNDKSVALMQEFEKQANASTATLKETAALLTKFERLHKTVESAASKLE
FT                   SASGHVENSATSLQQSQDNLVQTYKKSIEETDHTFKQIEESLDHSKEVSAQYAQEFSEI
FT                   SESLEGIFKELSDGLNQYSETVAKRTKEFLDAYTQNVTKVSESLSNTYGELSDTLEKLP
FT                   NVLNGARK"
FT   gene            complement(370635..371159)
FT                   /locus_tag="FSU_0326"
FT   CDS_pept        complement(370635..371159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27159"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5S7"
FT                   /protein_id="ADL27159.1"
FT                   /translation="MFFAFAVACASGAFVACTTDNSTVLPDSSSSASAPSSSSETVADT
FT                   VWHQANLTWYTSWPEPDSEECIEYNGCTWAGYFAGVEGQMTEEWVSQHNIIAVHEKDWK
FT                   QYKLKTFRLRMNGSTIDAVVYDMCSDSDCDGCCTENAGDIGFLIDIEKYTRERFDGHGD
FT                   GVVEWTCLDCE"
FT   gene            complement(371199..371903)
FT                   /pseudo
FT                   /locus_tag="FSU_0327"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(372010..373422)
FT                   /gene="glyS"
FT                   /locus_tag="FSU_0328"
FT   CDS_pept        complement(372010..373422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="FSU_0328"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00389"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27296"
FT                   /db_xref="GOA:C9RPW0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW0"
FT                   /protein_id="ADL27296.1"
FT                   /translation="MAKKVQDALKDIISLCKRRGFIFPGSEIYDGLANTWDYGPYGVEL
FT                   KRNIKNLWWKKFVTSRHDVLGLDSSILLNPRVWKASGHVGNFSDPLVDCLACHERFRAD
FT                   QLLEEKLGEGCCAGKNFDEVHQMMVDNKIECPTCGKTDWTKPRAFNLMFQTEIGVIEGE
FT                   GNKVYLRPETAQGIFVDFRNIVDNVRPRIPFGVGQIGKSFRNEITPGNFIFRTREFEQM
FT                   ELEFFCEPGTELDWYNFWRKYCFEWLVNDLGVKREKLRLREHAKEELSHYSNGTTDVEY
FT                   EFPFGWGELWGIASRTNYDLTQHQNESKVKQEYIDPVQNKRYIPYVVEPSLGVERLLLV
FT                   LLCNAYEVEKLENDERTVLHFDPKVAPVKVAVLPLVKKGKVKEKAEELYQKLLNRWNVE
FT                   YDETQSIGKRYRRQDELGTPFCVTVDFDTVGEGESDPAKLGYVTVRERDSMKQELVAID
FT                   KLEAYLFEKLGC"
FT   gene            complement(373561..374148)
FT                   /locus_tag="FSU_0329"
FT   CDS_pept        complement(373561..374148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25610"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5S9"
FT                   /protein_id="ADL25610.1"
FT                   /translation="MLLYHFNEFDFYYVKHPHSTELATSYGLPSLHSVEKYKWLDSTAT
FT                   DEEWEEEQVQKERVFRFIDVTVERVNLYSYRQDLLDSSNSEMTLCAKDPLDGFIPHCVK
FT                   RNGPNKILDNYLNEHHSEICEIPSVRKINHAKIFVENLFDYRFDTGSFGVEYADMFCMN
FT                   FIGIEVGKYDNYMVNRLLQTLYDLKDEMKDAW"
FT   gene            complement(374278..375903)
FT                   /locus_tag="FSU_0330"
FT   CDS_pept        complement(374278..375903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26339"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5T0"
FT                   /protein_id="ADL26339.1"
FT                   /translation="MHMKKLILNLRIQKLGICMRKKICLGMGATLAFAMSAYAQNYKIN
FT                   KVGNDEEKSFNVMLNQAVVGEAPAGSWLDVAPIIPDGKVFVGFTVYDEYGDAYNQRKVS
FT                   TVEKSESKFLMPDHDVFVSASFESLRYYLTVKNTDNGNVTLSFSDRYRDRTKPGVKVTV
FT                   NPNPASGYKVASVSVNRSLDSKTIVPCTTVEPGNVTNPGMWGMGSTAVEGSCAFDMPNF
FT                   DVEVSATFVAESADLSSSSVEVVSSSSETLASSSSVELSSSSETPSSSSVAQFSSSNIL
FT                   SSSSVALSSSSVVVSSSSVTSSSSSATPSSSSVAPASSSSVKVESSSSSKPASSSSVKP
FT                   ASSSSAKAVSSSSVKASSSSAKPASSSSAKAASSSSAKPASSSSAKSGSSSSAKASSSS
FT                   SKKSTSSSSKAVSSSSIIPDIVVEAVGTEEDMPSCTAKRENMTYYVTDLKTVFVCKSRV
FT                   WTKFNPGMGLEKTTPIAKFSAFVNGRNLQISGAKIGSDINLLDMQGRVIYSSRASVPNF
FT                   SMQVPRSGSYLLRVGAQQQIVNVR"
FT   gene            376131..377327
FT                   /locus_tag="FSU_0331"
FT   CDS_pept        376131..377327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0331"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25373"
FT                   /db_xref="GOA:C9RPW3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW3"
FT                   /protein_id="ADL25373.1"
FT                   /translation="MEEPKKKGAKPVEHKKEQERCILVGIATPKIRPWLAGEQLAELGR
FT                   LAETAGAYVTRSFLQRVQNFSPATLIGEGKVGEVKRALEEDNAKMVVFDDDLSGSQVRN
FT                   LEERMPGIKVLDRTGLILDIFAKHAVTAESRLMVEVAQLQYMMPRLTGAWTHLCRQHNG
FT                   GIGTKGPGETQLETDRRMIRKRIQELKKKLEKIEDAREQQADKRNDIFQVGIVGYTNAG
FT                   KSTLTNRLTGADVYVEDKLFATLDSTTRKLFLDGENIILSDTVGFIRKLPHNLIETFKS
FT                   TLGVAAHADCILEVVDGSAPDYRDHLEVTHKTLESIIDKDTPRLRVFNKVEVASEARRT
FT                   ELLQNYPDAIQISAKENIGMERLRAAFKEQLERWHEKRAVAEAKEKEIAEAPWPPELD"
FT   gene            377365..377994
FT                   /locus_tag="FSU_0332"
FT   CDS_pept        377365..377994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0332"
FT                   /product="putative phosphatidylglycerophosphatase A"
FT                   /note="identified by similarity to SP:P18200; match to
FT                   protein family HMM PF04608"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24716"
FT                   /db_xref="GOA:C9RPW4"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW4"
FT                   /protein_id="ADL24716.1"
FT                   /translation="MNREELKEKYGKKRVPHEWRKTDWFTTLVVTFFGSGMSPKAPGTM
FT                   GSLAAAIVAYPMAMLSYAYPIVINDNAFNTKDANALESFAAIFLAVPKNFMIAALLIFF
FT                   AAIPFVKKAMKDTGTEDPGWIVIDEVCGIFMTFAFIRPEWILNAPWILIIGFALFRFFD
FT                   ILKPLGIHKMEKLPGAWGVMADDLLGGIYAGLVLTIGLVLPAVFLM"
FT   gene            complement(378003..378740)
FT                   /locus_tag="FSU_0333"
FT   CDS_pept        complement(378003..378740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26616"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW5"
FT                   /protein_id="ADL26616.1"
FT                   /translation="MSRFFLFVLLIAMSAFAQDESVSDYDRWMQAKAHRDSVRNAERIQ
FT                   KNSVPFDFLVGMTLNVGFKVINNEKQLSRYKKVERVVFFEGAFFQAGASVQWPLLKYYL
FT                   VVRLGVLFEYAPLFLSEPLYVEDGNGEDKRVTEGGLSQGRIAFPILFAVKPRSSFVSFE
FT                   FGSQISIPLFDKLELDGARDRELDSSMEFSMLLGVGFRVNERIYLDLLLDAKFYHKYNE
FT                   RFADGLAHWSSVAIKAGVTFNPL"
FT   gene            complement(378834..380240)
FT                   /locus_tag="FSU_0334"
FT   CDS_pept        complement(378834..380240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0334"
FT                   /product="Sodium:neurotransmitter symporter family protein"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25649"
FT                   /db_xref="GOA:C9RPW6"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW6"
FT                   /protein_id="ADL25649.1"
FT                   /translation="MTERENFKSRLGFILIAAGCAIGLGNVWRFPFITGQYGGAAFVLI
FT                   YLFFLLIFGFPILVMEFAVGRSSKRGVGRSFAILEKPGHKWHYAGVPMIAGNYIQMMFY
FT                   TTVTGWMLYYFYRMVTMGDLMNLSPAEVGAEFTNMLGNGPLLSFWMVVATFAGLSIVAL
FT                   GLQRGVERITKTMMSALLVIMVILMVRVLTLPGAGEGLKFYLLPDFAKLKEAGIGEVVF
FT                   AALGQSFFTLSLGIGSMSIFGSYIKKEHSLLTEAAHICVLDTGVALIAGLIIIPSCFAF
FT                   GLKPDAGPGLIFATLPNVFAQMPAGRVCGAAFFLFMSFAALSTLVAVFENIVAYWMDVR
FT                   NVERKKAVKWNFVAIVILSLPCALGFNVLSGFEPFGPGSCVLDLEDFLVSNTLLPLGSL
FT                   IFVLFCNSRYGWGQFKFISEANLGVGMKFPKLKILHLYFKWGLPIIISVIFVLGYMQKF
FT                   APSVYDKIFG"
FT   gene            complement(380261..381247)
FT                   /locus_tag="FSU_0335"
FT   CDS_pept        complement(380261..381247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26212"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW7"
FT                   /protein_id="ADL26212.1"
FT                   /translation="MRKANSSAIGSSASRKINAKICAFLLMLSLVFPAAALSSPGDPLT
FT                   WRDSTWDYRSEDPTDIKSEIEPAKLFGVASLTLIAYGAAYGFVFEKGWWDDNGGRGFHW
FT                   ENDFDYALNLDKFGHFAAGVVIGESFYEGYRWAGASEFQSYLFAGLTALATHIAIDIKD
FT                   GFAPSWGFSIFDVLSGGLGGFLPMAERYVPVFKYIDLKWSYWINSNAYYDQEHQASGGV
FT                   FTDDYVNQTFWLSVKPYRLLPESARRYYPSWLAFAIGLSIDDKVFTGEPHPRREVYLAL
FT                   DYDLEAFRPQSRLARYLVKMLNYFKLPAPTIQVYPEFHWYLLYPIKF"
FT   gene            complement(381247..382491)
FT                   /gene="fabF_3"
FT                   /locus_tag="FSU_0336"
FT   CDS_pept        complement(381247..382491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF_3"
FT                   /locus_tag="FSU_0336"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P39435; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801; match to protein family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24660"
FT                   /db_xref="GOA:C9RPW8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPW8"
FT                   /protein_id="ADL24660.1"
FT                   /translation="MENVVITGMGCVSSLGNSPELLWQNLLQGKSGIAPIQRFDASAYT
FT                   SRMASEIREFDASEIYSTRDQSRFSRCIQYAVYSAFQALKMAGISPENENPERCGAIIG
FT                   SSIGGLQYCYDAAVALSNRGPSRVSPFYIPMAIVNMPAGEVCNKTGWMGPSYTVTSACA
FT                   TSNHSIANAYDMIRLGRCDVMLAGGADETVNPLSLAGFTSMKAVSKRNDAPEQASRPFD
FT                   KDRDGFVIGEGAAVLVLESESHAKARGANILARIAGVGASSDAHHISAPRPDGKGVMLA
FT                   MANAMKEAGIEAKDISYINTHGTSTPLGDIAECSAIETLFKQSSASALENLKVNSSKSM
FT                   IGHCLGAAGALESVVTIMSVMNQKIHGTLNVFEQDPEIHLDVCANGAVNQKIDYAMSNG
FT                   FGFGGQNGVIIFARN"
FT   gene            382727..383284
FT                   /gene="orn"
FT                   /locus_tag="FSU_0337"
FT   CDS_pept        382727..383284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="FSU_0337"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P39287; match to
FT                   protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25593"
FT                   /db_xref="GOA:D9S5T7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5T7"
FT                   /protein_id="ADL25593.1"
FT                   /translation="MLLFARMPKSSRNLVWMDLEMSGLYPEKDVILEIATIVTDANLNI
FT                   LAEGPVIAIHQSENVFESMDEWNTRHHNQSGLVDRCRRSQYSLKDAELETLRFIKPFTE
FT                   KGKNLLCGNSITQDRRFLYKYMPEISEWLCYRNIDVSSIKELSYRWYPNLEDFQKEKRH
FT                   EALNDIRESIAELAYYRKTIFK"
FT   gene            383289..384662
FT                   /locus_tag="FSU_0338"
FT   CDS_pept        383289..384662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0338"
FT                   /product="penicillin binding transpeptidase domain protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27413"
FT                   /db_xref="GOA:C9RPX0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX0"
FT                   /protein_id="ADL27413.1"
FT                   /translation="MERLPYAQRMRNRCIAITVLVTIIVAIVHCSTKDDPESAKETTEQ
FT                   QAALAADTLAQAIAPSDTNPFDESYTAEASAKENPNGLSALKGIEDEDFENANNTAAGN
FT                   AASTTNATAENTDNVRDTVHIKSQKDPILADKIDVLLRRYRPDLGVILVVNTKTNEIIA
FT                   WGERRDGKVQNKPDWIGRPTFPAASLAKLVTIAAAMESNRYSLNTPIPMIGRHHTLYLN
FT                   QLRVPEKYNGPTMELSEAFARSANPPLAIVGKNVGAKRLNAAAAKLGYNKRFPGNAPNT
FT                   SSYTAPDTGYGLAEVACGFTTSTTLTPLLAAAQVRAVLTKKPLEIPWARDMAPFAPQKP
FT                   LALDVGKFSENTYYGLRESMLRSVTQGTAHKHMSTKNMARKNFEALRLGGKTGSLDGTD
FT                   PAGRYDWFMGFAEAKNDPSKSIVVIVMQMHREIRSQPATQVAATVINYWAHQNLDLKK"
FT   gene            384696..385565
FT                   /gene="lgt"
FT                   /locus_tag="FSU_0339"
FT   CDS_pept        384696..385565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="FSU_0339"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by similarity to SP:Q07293; match to
FT                   protein family HMM PF01790; match to protein family HMM
FT                   TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26796"
FT                   /db_xref="GOA:C9RPX1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX1"
FT                   /protein_id="ADL26796.1"
FT                   /translation="MELSWWNLIPTYFDGTAFQLGSFPVRWYGIMYIFAFVTAYITMWK
FT                   ISQKEKLGYTKDQLDNFFTWIIAGILLGARLGYVFFYKASYYLANPTEIIFPMIHDDLG
FT                   YHFVGISGMSYHGGLVIGLIFMYIGAKRNKLDVWKTFNLAFLVTPLAYTWGRWGNFING
FT                   ELFGEATTSAIGMWFPLAHDSTLANPILHHPSQLYEMVFEGIVLFIVLYNLRKIPKLHD
FT                   KVPCLYLMGYGLFRFFIEFFRKPDAHLGRVDLFGMSRGQTLCSAMIIAGLVWMIYLFYR
FT                   EKKATGKV"
FT   gene            complement(385659..387353)
FT                   /locus_tag="FSU_0340"
FT   CDS_pept        complement(385659..387353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26999"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX2"
FT                   /protein_id="ADL26999.1"
FT                   /translation="MSDKTDNSSSVIGLDRKKIKDFFLRKLPEMKEAVIDAIIEILPSV
FT                   PHYQEENDHFTFRIIMGNGNPPMGWNRRIYEFAGEALENLFKERVKACLKDVIHFCKSG
FT                   CDLIIQQMPAREKTEPSIQVGVFQSDLGNAGETERALLEKGFLLIECVNRSKICINSHT
FT                   PAGVSDYLLIRFDLDENEFSDDLEDKDLESYPKGFWAGLFSQIKREVHGTICLFVDPAW
FT                   DGNKDDNFDSGKIVFDDYKEMQIKPDSMLDSQSYRDLYEQNFIRKMFISMLNYDGITVI
FT                   DTNGCVRAFHCFVSIHRGKFTSGGARHRAYRALANLFKDNELYKALYFQSQEGNIRFYH
FT                   KFRVSSSFDSTVMDQCDVVNEAENVKPKTTDHVDGKAASLASAVNAGLADISTADDTSV
FT                   LSDYLNRLRDAHLGIDNFYNEPKPAEDLFNAAHEMTSESWSRVNVGRVINVPLVCLIGN
FT                   SYGYSTNAEPFLKKFLEKIPDTVWKSYMHSKCFEDSSLSSTLGSKNQESQWSKLMNEAG
FT                   ADDGKAEKYVTDELAKHIKAVYKHVSKLFAQKFEEERNLWENLFKGY"
FT   gene            387503..388102
FT                   /locus_tag="FSU_0341"
FT   CDS_pept        387503..388102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0341"
FT                   /product="conserved hypothetical protein TIGR01440"
FT                   /note="identified by similarity to GB:AAM24116.1; match to
FT                   protein family HMM PF04260; match to protein family HMM
FT                   TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25460"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX3"
FT                   /protein_id="ADL25460.1"
FT                   /translation="MAGITYEIDDKNIVEQIKSDAMNVAAELVETARLKKGDIVVVGCS
FT                   TSETLGNQVGSHSVPEVGKAIFDGLQSIFGAKGIYIAAQCCEHLNRAIIIEHEAVPNAE
FT                   IVNVVPQPKAGGSFATACYASFKAPVALEHIKANAGIDIGGTLIGMHLREVAVPVRLKH
FT                   NHIGKAIIIAARTRPKFIGGERAQYNEALKNGYPEF"
FT   gene            388142..389785
FT                   /locus_tag="FSU_0342"
FT   CDS_pept        388142..389785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0342"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26107"
FT                   /db_xref="GOA:D9S5U2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5U2"
FT                   /protein_id="ADL26107.1"
FT                   /translation="MAYMRKRVALLFVVFGVFLAICTGCNGFSEEPPAQASKANSPKYK
FT                   IGVEEKSSISEGVASQLPKAQIKHYPDLITAYFALQVGDIDILAYDENVLTHTFNDSMS
FT                   GLTYIENDIDVPNEFVIGMNKHSSIPDIKGIINRLIDSLNAAGTLTELNEHWNKNLKTN
FT                   PLISTKESGSEQILRIATSADVPPFSFMSGNQIVGLDVDIAKLLEEKLNIKTSIIKMDR
FT                   NKLVTALKNNDADLIISAFTICECLRHEIDYSKPYYIGKTAFVIRNDFGKEATLSKVPK
FT                   MTYLEPKKPDEIYKLADLSGKFVGVQTGTTLDEQVQQLIKLPRIQYYANIPEMTKALEE
FT                   RELDGIAVDYSVAETILKHHSDFSILKERLNKDVFGIAMSKNSPLKSSIDSCIKVLQKK
FT                   GEIQKIKDKWSKNMSAVRVIKQDWVGTDTLVVGTEALYAPYEFYQWGELSGIDIDIMYT
FT                   IGKMLNKNIKFADMNFDVLIPSLVNEKTDLCIAAMSITEERSSLIDFSIPYDKNESVIV
FT                   VHTPQHAIEVIGDSTGALSHIFQKIQDLFD"
FT   gene            complement(389868..390656)
FT                   /locus_tag="FSU_0343"
FT   CDS_pept        complement(389868..390656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0343"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAP04919.1; overlaps
FT                   another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27014"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX5"
FT                   /protein_id="ADL27014.1"
FT                   /translation="MNDGQLDLFGFVAPLTEPEVKVPSPDCSANGLVHFKYNPLMKKSI
FT                   RCKGGFLFGHPEVLLPAYMKGPEFAAARELAAEWAEHAVRRKTQKNKAIVKDLVNRFWQ
FT                   TVDQIFTDKGETPLASKGRLPPIRPQGVHHNLTDVLAAINDTYFDGTLTCRITWSNRVG
FT                   GLSFHSVRKDPVTGESFHLISISRGYDAANCPLYAIAGVVYHECLHIVIPVEERGGRRV
FT                   VHGREFRQREKRYIYYDEWIKWHKEVLPRNIRAMRHHKAI"
FT   gene            complement(390653..391408)
FT                   /locus_tag="FSU_0344"
FT   CDS_pept        complement(390653..391408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0344"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:E82607; overlaps
FT                   another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26192"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX6"
FT                   /protein_id="ADL26192.1"
FT                   /translation="MNAYKEYFPTKAYRIAEMRLSSLLRVERDRLDSIAESLGRECAIG
FT                   PDNLREQLPEILKFTQAYHAAYDQYLKAVLVQQPRPIQCRPACGNCCHHYPMSVEPFEL
FT                   IFMYSELRKRDDLLSLMEACQMRSDKFDSLFESRKEEGLSEDDAEDRALHDYFAWWRSC
FT                   PFSNEVGDCTVYPLRTVSCRMYFSETDPKYCTPDMLQTEQNDSYIVYMPDVVEDAVYGI
FT                   SEHYAALELPESFFGGLLALNGYEGVLGE"
FT   gene            391541..392962
FT                   /locus_tag="FSU_0345"
FT   CDS_pept        391541..392962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0345"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25754"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C9RPX7"
FT                   /protein_id="ADL25754.1"
FT                   /translation="MRKISQGNWMWPITIALSLGIAGCNLFHPTGSRDADSSDAAALTH
FT                   DGYLEYQKSNYDVARNFFSKALRADSGYSEAWVGLCKTVLKAQEGIDAFELASYAQNQQ
FT                   DENGKVTNGFLVMSDEKADSISRGIDSVMFYLNQFVARDTTDRTDKKVRFSNIADSYTI
FT                   LQLTKAALRVRAVNTQLSSVVSANSSGMMMDLNALNDLGDSLKPFLNDMAAAAEAIKVA
FT                   PEAAAEIIKAYLPDSTRQDFEDDDYAEISVGLANTVIQMNDRAQTVPEDRESVFFNFGN
FT                   GRDDDGDGCVDEEALDNYDNDGDGEIDEDVRDSRSIVLVKKRPTNYEELKALGYDPTTY
FT                   DLTKAQLDSLSVLEKYNIIDIDMDGKTTQDDLDEWEFIYRDPNERDEKKNHRLKFTTTI
FT                   NFMYAEGGMFPENQDEKTVEKINSLIEKKELIRKDNDINNIKYDWRKRAEMVGGCWTNY
FT                   DDEKFLKWFEGRIVK"
FT   gene            392959..394230
FT                   /locus_tag="FSU_0346"
FT   CDS_pept        392959..394230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27403"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQB3"
FT                   /protein_id="ADL27403.1"
FT                   /translation="MNKLTILAILACAFGIVSAKSPMHFSLRAESMGGAHVAVVDDKEA
FT                   IHYNYAGLSQINRLGNFEKRPEQGYYPRNWIGDMRLTFGGAGDIFKFLTTYSDVKDVQD
FT                   LFRAAQNDADRITADHPMPSSRTGAILDSLIANPKYVKTINSYDHKTMEARVKFDAELA
FT                   FHNFGAAFWMNGSVAPYVDAGIILPYVVVDTFIIDAVAQMGGAYEIIPNQLSVGLGGKI
FT                   VKRHKTNMVTVGLANYSSIVDTLKDQAGDATDNFFDSKTFSFGLDLGVLYQFNREIRFG
FT                   ASLRDIYFKQLAGETLIPNFTIGANYSPKFMNSNTGFGRKFNVAVDFADMFNADRNYKF
FT                   FTHLNFGFELEQTLAAIPGLNNEIRFITLRLAGGFRGGYPSAGVGLEILRFFSVEAATW
FT                   GEERGYYTGQDENRIYMVQASIGF"
FT   gene            complement(394298..395725)
FT                   /locus_tag="FSU_0347"
FT   CDS_pept        complement(394298..395725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0347"
FT                   /product="cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF00150"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25927"
FT                   /db_xref="GOA:C9RQB4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQB4"
FT                   /protein_id="ADL25927.1"
FT                   /translation="MLKQHIRVAALCSAFSFALASNSFAADLPTANEMFAKMGFGINIG
FT                   NTMEVPQNPTWWGNKFPTEAYIDSVKAAGFSTIRIPCAWYSHSNALSRDSSRADIVPGG
FT                   GPNEIASSWMDSVQTVVDYCMRAGLVTILNIHWDNGWLEGNLNDKEKDKVNARQKDFWT
FT                   QIANRFKNYNENLLFASANEPATTDDNYKHETEILMTYHQSFVDAVRATGGNNASRTLV
FT                   IQGPSTSVDRSCEVMPVSKLPKDVIADRLMVEVHFYDPYTYTLLNDVVDWGAQVYPQYY
FT                   WGDDLATGADIVHNCGYNAWAGAMGDKCTSAQIQDQFGKMKKNFVNKGVPVIIGEFGAN
FT                   DRVGVLTGDNYAKHRKGRLAYYDAVMKLAKENKVVPIAWDTGHEGENNMTIIRRQTEPD
FT                   GSVFDKDVLNIMRHAYGLDDYVNNGITHIENFKTDDGTISIFKRNRPVQSRSLRTSRTY
FT                   DLLGKQNPQARVVKVKK"
FT   gene            complement(395944..397161)
FT                   /locus_tag="FSU_0348"
FT   CDS_pept        complement(395944..397161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0348"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24904"
FT                   /db_xref="InterPro:IPR025533"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQB5"
FT                   /protein_id="ADL24904.1"
FT                   /translation="MHILYKFFFFILAAYVLSSCGDEKVIKLSSNAKQSFEGFVRDTCA
FT                   YVMIVDSSVQSKPFKEKLVPVEKGGFAEHFSINKQERGRKIFYAYSDSISPFISGTSDI
FT                   SSFFDVVELAFANHYSLEINPDDIWLMILDGFRYHVKSNREALKDKFVTPGTDTVVTFE
FT                   DNSLTTESTHHEWFWTLANLFEVLQSKLPEETGLPLKTKFSTTSPVDYNISSAMVMAVA
FT                   AEYYEYVVSSLCGIPKIKINGKKEDWILLKDSFNRLASRLDMDWWAVGLNPILDEFINV
FT                   FEGKINMDHWRGIYKRYIPEFCGNVTFNGWISRFFPYTGLDINESNYLNERIDAYKRHS
FT                   PDWNEQLDVNNVPRGVTSIRIEWNYSGEKIPLRLYTGFIGIQVDTTTNMLKAARGYALF
FT                   ENDVKE"
FT   gene            complement(397180..398457)
FT                   /locus_tag="FSU_0349"
FT   CDS_pept        complement(397180..398457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0349"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25339"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5U9"
FT                   /protein_id="ADL25339.1"
FT                   /translation="MKMKNTMKISVSKFLFLILAACVLLSCEQERDNVSVDFIPGKPRP
FT                   MQESLALADSMVVYNAQGLAYTTNSLKEIKKFAKASVLDEEYVEYDRSLRYVSEDEANL
FT                   SVSLFQKGKLIDYLFYFENPYSGDTVFDGVVYSLQGCGRIKKLDPIYAFFKERKISTEG
FT                   KTAEFKTRPNLPALKVDIYIDAFELKEGKNLGDTMPPREFETGLIQSVKKPCGWRLERA
FT                   LKRYYKEGFNLSVDATITFGDSGRVTNVSMDTEHPEYKDFLEEVKSILYYAWMPPTVQT
FT                   RLMDPLPCMYFSDNLPPELQSRNIWSYVAAQEIVKSEKVHLSFSREYFRLECKGEGSEK
FT                   DSVEIAGYSGIIKEHCDEIRFTKDFATSGINYLECIKIEPLFTKKPIKFPTIYTLFDRY
FT                   HAMYVKEDLSLNQVVQLKIPACFVEE"
FT   gene            complement(398420..399484)
FT                   /locus_tag="FSU_0350"
FT   CDS_pept        complement(398420..399484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0350"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26973"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5V0"
FT                   /protein_id="ADL26973.1"
FT                   /translation="MVGVGEPNLSINLYRDGKLVDHLLYYAKPRKETFKERVLDFLTSD
FT                   YDGAMLSLQGVGRWKKPAAIKNFFKERDIPISGTVHEFENEKSLPKLNVKIFVDSVFLK
FT                   SGKSLRDGLEMRAFKTGIVRAMNNSMGWRLKRLLYRYYKETFNLSGLASLSYKDDGSVF
FT                   LPSASTASRKSKNKAFDKELRDILYYGWKNKAFDKELRDILYYGWMPPKVRTDVGNEET
FT                   AQDIIDYVWIHLTFTRDYRMVCKENGRNAKDSVDIVGASDAKKDLCNEITFSKDLATGG
FT                   VVRYECIEYNKKVKYGDHPEEIEPRHTNVRFDKHDAVYDGGLPISQVVKLKIPPCFVEE
FT                   KINEDEKYNEDFRF"
FT   gene            complement(399587..400897)
FT                   /locus_tag="FSU_0351"
FT   CDS_pept        complement(399587..400897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0351"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26267"
FT                   /db_xref="InterPro:IPR025533"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQB8"
FT                   /protein_id="ADL26267.1"
FT                   /translation="MHSLYKFLFLFLAAYALLSCEQKRDEPVIEISSKPTESFEGFARD
FT                   TSAYALVIDTTVRDSVFNEKIIHVKRGGFVEYFANEAEKKGTNGQKIFYAYSDSVNPFV
FT                   KGSSEEPSFINLVALAYAKHYAMEINPDDIWLMILDGFRLHVKNNRKALKDRFVAPGTD
FT                   TVVSVMDNSLTLESTHKEWFYTLSELFDSLQAKLPLETGAPLRTKFSTTSPVDANISRT
FT                   MTMAVASEYYSYRVTTLCGIPKIKVNGTKEDWTLLKDSFNRLASQLDMKWWADGLNPIL
FT                   DEFINIYDGKINLKHWKNIYKYYEPEGCGTPDFSGWISRFFPYTKDLYSDTEKYIKRND
FT                   WNKKLDFKQVPRGITFIDIRWEFFQEIIPLKLYTGFIGMQVDTTNNMLKASRGYALVSY
FT                   GMQKLKNVARNTKYIPGKAYRLVESLAFSDSMNIYGE"
FT   gene            complement(400904..403321)
FT                   /locus_tag="FSU_0352"
FT   CDS_pept        complement(400904..403321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0352"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26917"
FT                   /db_xref="InterPro:IPR025533"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQB9"
FT                   /protein_id="ADL26917.1"
FT                   /translation="MHSFYKFFYLLLATSVLLSCERKQVNKPIDVSPDSSHKIYGFVRD
FT                   TSAYAMVVDTSVHDSAFREETVPVEKGGFAEYFSSFHQKGSPETKIFYAYSDSISPFVK
FT                   GRSQKSAFIDLVALAYARHYAMEISPDDIWLLILDGFRLHVKSNSDSLKDRFVGPDVDT
FT                   DIKVFANHLTMESTHEEWFGVIADFFDNLQEKLPPETGAPLRTKFSTTSPVDYNISRSM
FT                   VMAIASEYYTFFAYTFCGIPQIRINGTKEDWSLLKDSFNKLATRLDMEWWLQQLNPILD
FT                   EFVKAFDGNSSIAFWKNIYKLYEPKGCGNPKFNGWFSKFYPYLMGYSDKMEFVKRTDWE
FT                   HDVDFETLPNALTSVDVKWNYLGQEIPLKLYTGFVGIQVDTTSKMLKAARGYALRSQCG
FT                   WCDIKNVADTMTYIPGKPHRMLEMLAISDSMNIYDKNGLSFATHDRNEIENFIKASNYK
FT                   DEYMEPSIRSRIEKKYKSILSVNLFKDGKLLDHLQYFVVPEENAGGILTLQGVVAINDK
FT                   ERIESFFKERNVAIDGVVKEFENEQSLPKLNIDILVDTVVLKEGKSLREDLEMGEFKTG
FT                   IIQAFKNSMGWRLKRLLYRYYNDNFDLSAVAAMGYKEKGRVDEHVSLSLEPDSNKEFKE
FT                   ELRDVLHYGYMPPEVHTDIGNDEIAQEIVDFVKIHLAFTREYRMVCKQNGQDAKDSVDI
FT                   IGAPSAKKSLCSEIKFSKDLATGGVVRYECLEYNKIIVPKKREKMLNSKDSTLADSLMA
FT                   RFNALYGEPRERIRSTYTNAYFNKRNDVYDTRYNLPISQVVKLKIPACFVEE"
FT   gene            complement(403437..403928)
FT                   /locus_tag="FSU_0353"
FT   CDS_pept        complement(403437..403928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26638"
FT                   /db_xref="GOA:C9RQC0"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC0"
FT                   /protein_id="ADL26638.1"
FT                   /translation="MSEQTLTRENLIEFFGEQEYEKLCRHEAGHALIAFLFKRQIDYVR
FT                   INNSKEKPSATRMPGSSLDGAAHIAIAGHMSDFLIRKNFACDLDTVMKELPMELYRSDP
FT                   DYQSFQAACYYYQLAETNVVEQVYNLMMACQKSLTAIVAALSEKTNLSGADLAAIMSGK
FT                   "
FT   gene            complement(403910..404551)
FT                   /locus_tag="FSU_0354"
FT   CDS_pept        complement(403910..404551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:H97271"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26106"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5V4"
FT                   /protein_id="ADL26106.1"
FT                   /translation="MYFLGGKSEKEMKKLVIYIHGKGGYADEANHYETLFPDFDVIGFD
FT                   YKAETPWDAKQEFSAYFDAVAANYDEVMLIANSIGAFFSMNALGEKRIKQALFISPMVN
FT                   LEKLICNMMLWANVSEDELREKGEIATNFGKTLSWKYLCYVRENPIKWNIPTHILYGSN
FT                   DNLTDLETMREFAQKVGASLTIMQGGEHWFHTDERMDFLDRWIEKCQNKH"
FT   gene            complement(404583..405491)
FT                   /locus_tag="FSU_0355"
FT   CDS_pept        complement(404583..405491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0355"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM39783.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26054"
FT                   /db_xref="GOA:C9RQC2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC2"
FT                   /protein_id="ADL26054.1"
FT                   /translation="MNKNNFSLIDKKNNNGEKDEIIVYQPEGGEFHIEFRVENETVWLT
FT                   QAQMAELFDVHRQAITKHVKNIYESLELDEMSTSSILELVQKEGNRVVKRSVALYNLDL
FT                   IISVGFRVNTQKGIEFRRWANLVLKEHLLKGYSVNQRLISQENKIENLDSRVVNLEKQV
FT                   DFFVKANIPPSEGVIPANARWSGYEFAVQLVRSAKKEIIIIDPFANDTSLSLVAKRVAG
FT                   VNAVIYSARITHAMKDEVNRINRQFPTVELRTMREVHDRFIIVDETVYHVGASIMDLGY
FT                   KMTAFSVLNLVTKEQLLALVK"
FT   gene            complement(405656..409531)
FT                   /gene="purL"
FT                   /locus_tag="FSU_0356"
FT   CDS_pept        complement(405656..409531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="FSU_0356"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by similarity to SP:P15254; match to
FT                   protein family HMM PF00586; match to protein family HMM
FT                   PF02769; match to protein family HMM TIGR01735"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26724"
FT                   /db_xref="GOA:C9RQC3"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC3"
FT                   /protein_id="ADL26724.1"
FT                   /translation="MLILRGTPALSDFRLQKLSSDFKAAGIPVASVYAEFLHVVDLSAD
FT                   LTASEKETLEKVLHYGPMREVKALEGELFVVCPRPGTISPWSSKATDIAHICGLPAIKR
FT                   IERAIAYYVKFEGAAPAGAREKISAKIHDRMTQAVFADTAALEVLFSKEEPRPLNVIPV
FT                   LTEGRNALVKADKEMGLALSADEIDYLVKNFTELKRNPTDVELYMFAQANSEHCRHKVF
FT                   GAEWTIDGVKQDKSLFQMIKNTYQLHNSNIFSAYKDNAAVMKGATAGRFYADPRNNKYD
FT                   FHNEEVDILMKVETHNHPTAISPFPGAATGSGGEIRDEGATGKGSKPKAGLTGFSVSNL
FT                   KLPGAVQPWEKDFGSPSRIASALDIMIDGPLGGAAFNNEYGRPNILGYFRTFEQEVNAQ
FT                   NGKEVRGYHKPIMLAGGLGNIKHQHIEKGHIDPGDHLIVLGGPAMLIGLGGGAASSVAN
FT                   GAGNESLDFASVQRENPEMERRCQEVIDRCWAMNEENPITFIHDVGAGGLSNAFPELVN
FT                   DGGLGGKFELRNVPNDEPGMSPFEIWSNESQERYVIAIAGDKLDVFDAICKRERCPYAV
FT                   VGEAIPEKHLTLTDKHFGTTPIDMPLGVLLGKPPRMIRNEKSQKRPLSSQVVPAGVTVK
FT                   DLAHRVLANPTVADKTFLISIGDRSVTGMICRDQMVGPWQVPVADCAVTSATLDTYEGE
FT                   VMSMGERAPIALISPAAAARMTVAESLTNMAAACVPDMGRVNLSANWMATPNYEGDGAD
FT                   LYEAVKSIGMELCPELGITIPVGKDSMSMSTVWQDEKGSHRVTAPISLVISAFAPCADV
FT                   RKTLTPQLLQKKDTTLVLVDLARGKNRMGASIAAQVYNLLGDKAPDVDSAKELRAFFET
FT                   IQKLNADGKIMAYHDKSDGGLFTTVVEMAFAGHVGVTLDATALKGNVIDALFNEELGAV
FT                   LQVANADLAAVKAAFEAVGLGDTVSEIGKLNDTYNIVIGDYAEGLSDLRAIWSDTTRRI
FT                   AALRDNPECAESEYKLKLEQDDPGITPKVTFDLAASAKIIKDYASRPKMAILREQGVNG
FT                   ELEMAAAFAKAGFESIDVHMTDILSGRVSLKDFNGLVACGGFSYGDVLGAGEGWAKSIL
FT                   FNPKARAEFEAYFNRKDTFTLGVCNGCQMVSNLKDLIPGAKHWPRFVQNISERFEARYC
FT                   SLKVEDTPAVLLKGMAGSVLPIAVAHGEGRAEFASREAAEACLKTGLVALRYVDGKHEY
FT                   TERYPLNPNGSPFGINGLCSEDGRALVMMPHPERVFRTCQYSWHPAEWGEDGPWMQLFR
FT                   NGRIFVG"
FT   gene            409678..410106
FT                   /locus_tag="FSU_0357"
FT   CDS_pept        409678..410106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0357"
FT                   /product="wxcM family protein"
FT                   /note="identified by similarity to GB:AAO06351.1; match to
FT                   protein family HMM PF05523"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27188"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC4"
FT                   /protein_id="ADL27188.1"
FT                   /translation="MEWNEEQLKEPRLIDIPIAHDQRGNLSVVEGGELIPFDIKRLYYL
FT                   YDVPGGTTRGGHAHRKLRQLIIAASGSFDVILDDGKKRSKYSLNRSYHGLYIPTMHWRE
FT                   IENFSSGAVCMVLASEHYDKSDYIYEYEDFVKEATSRI"
FT   gene            complement(410090..411073)
FT                   /locus_tag="FSU_0358"
FT   CDS_pept        complement(410090..411073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM36557.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25628"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC5"
FT                   /protein_id="ADL25628.1"
FT                   /translation="MYEILPYSPELDQRFDHFVESESVNGTFLQTRRFLNYHPAGRFND
FT                   ASFALQKSGTIVAYFPGVLKDGTFVSHAGSTFGGPIISKSYYMGARLFEILQEADQYLT
FT                   TNFKHSILKITPPLFAEESPDLLEYVLEHLGYTRHTELSSQTTLSKGVDPFENCNRNQR
FT                   RLWNYAQKFIDALPESEKWEYRAIESDEDIRTFHRFLVISKEKHNTKPVHSAEELIDLK
FT                   KRIPQNLRFRGLFFKGRYVCGMMQFIFEKKRILHDQYISPDESFSEFHHTTPMNLFALR
FT                   EAAEEGFLHFSWGISTENGGNFLNEDLLHYKESFGATACVNARYEK"
FT   gene            complement(411092..411901)
FT                   /locus_tag="FSU_0359"
FT   CDS_pept        complement(411092..411901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0359"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26375"
FT                   /db_xref="GOA:C9RQC6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC6"
FT                   /protein_id="ADL26375.1"
FT                   /translation="MRKFRVVLVEPEHPHNVGFVARAMHCYALPELYIVYPKRDKVLDK
FT                   SYHTAANSHDILDNAKVVHKFEDAIGDCSCAVAYSRRIFASSIKHTMVQNLSDMLPEDG
FT                   TIALVFGRESCGLALEEVNACTYQCEIPVPGLMSLNLGQAVSISLYELCRSGALANGEG
FT                   RAKRTTRGVAETGPATIQQIDGFKKFLDRYLTGQYHDQAWRDSFLNTLLQRLHPTRNEL
FT                   SALFGLLRNLAGKPARLEHAAEKAAKQAAQNAEQDEAPKAEKSQKSK"
FT   gene            complement(411940..412791)
FT                   /locus_tag="FSU_0360"
FT   CDS_pept        complement(411940..412791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0360"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27158"
FT                   /db_xref="GOA:D9S5W0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5W0"
FT                   /protein_id="ADL27158.1"
FT                   /translation="MNVLILAAGLGTRLRPLTSEIPKPLVRVYDKSILEIQMERAKSLG
FT                   DVRLHANAHYLADQIVSEGERLGFEKVWVETPEILGTAGPLRRIYAAGYRGGLLIMNGD
FT                   AYCNFDLGAFVRNARNRSEVALLAVDFPKVNTFRVGADGCLAGVAGRFGADTGTAATFS
FT                   GISWYSDEALARIRDGEFDIREFWKQEIAAGRAPFVDMSQLHATWIDMGSPEGLMAAVE
FT                   ARLAECGRDKNEAVVEPGVVIPDGVKIAHSVIFKGAEIQPGETIENEIRGKGFSWQIPP
FT                   NH"
FT   gene            complement(412826..413263)
FT                   /locus_tag="FSU_0361"
FT   CDS_pept        complement(412826..413263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0361"
FT                   /product="putative
FT                   (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase"
FT                   /note="identified by similarity to SP:P21774; match to
FT                   protein family HMM PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25136"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC8"
FT                   /protein_id="ADL25136.1"
FT                   /translation="MLYNEEQVHALLPQKAPFAFVDEIQEITEGDQPSIVAVWHVTGKE
FT                   KFFDGHFPNNPVLPGVIQIESMAQAATLLTMIAKKADVEGKRPAFMGVENCRFRAPVIP
FT                   PQDLTLKATLVMARHGIYKYTGEIWQGETLICNASFSAAMV"
FT   gene            complement(413250..414143)
FT                   /locus_tag="FSU_0362"
FT   CDS_pept        complement(413250..414143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0362"
FT                   /product="UDP-3-O-acyl N-acetylglycosamine deacetylase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25396"
FT                   /db_xref="GOA:C9RQC9"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQC9"
FT                   /protein_id="ADL25396.1"
FT                   /translation="MKKDSRKSPREWEFSSASLSYGKANVKIEVQEYNPQLEPRVEWRV
FT                   GGRSFYSTDCAKCFTDLKFSVARTAIYESGEGVHALTLASPEHLAPVFLMWPSRRFVVD
FT                   VTCNEESDKGCVAELPLMDGSALPFFSEFRRNVGAPEELAFYDAPVHALWDLPYGSVKI
FT                   TPSEAFEVEYILERNENGRVFKSAANVSIYSAEDLYNVFAARTFILKNEFDEARKAGLL
FT                   GGVDESCGLLLDNSPEAVAPVFRVADEPARHKILDLLGDLCFAKPALPKVRLEIINGGH
FT                   LSHRTILEKVLPYALQ"
FT   gene            complement(414289..415341)
FT                   /locus_tag="FSU_0363"
FT   CDS_pept        complement(414289..415341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0363"
FT                   /product="putative UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="identified by similarity to SP:P21645; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26755"
FT                   /db_xref="GOA:D9S5W3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5W3"
FT                   /protein_id="ADL26755.1"
FT                   /translation="MSSPHAHARGIMFSVSLSEILETMNLKMPSNEGVLNFELTGFSSL
FT                   DQAGMHDVSFWTGDAKTETGLAGNAGGVSASAFAGVTAGLLFVPSLYEKYCVDGRSELL
FT                   PNVHFVCPVESPYHAMVTFMKEFVERREVFEEAKIAASAQVHASAVVEGVVGENAIIGP
FT                   NCVVMKGATIGAGTILEANVTVYPRVTIGEDCVFQAGVVVGPRGFGFYEYEGKRCMVPH
FT                   LAGVRIGNRCSFSANDVVAAGFVSPTVIGDDCHFDTFVQVAHNCRLGNNIMMASQSGVA
FT                   GSVIMEDDVEFAGGVQSAGHLTIGKGVKVAAKAGVTKSLKAGKVYAGYPAEEIDVWRRS
FT                   VVKLRMMGKK"
FT   gene            complement(415308..416273)
FT                   /locus_tag="FSU_0364"
FT   CDS_pept        complement(415308..416273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0364"
FT                   /product="diacylglycerol kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00609;
FT                   match to protein family HMM PF00781"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26533"
FT                   /db_xref="GOA:C9RQD1"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR037607"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQD1"
FT                   /protein_id="ADL26533.1"
FT                   /translation="MYKFFFLINPVSGGGQGKVIHKFLPEIMESMDFKADEWKAEFTRK
FT                   EGMEEQILTALSSTEKLVAVGGDGTVSSVLSMMLMSEYADKVQIGLIPLGTGNDLARVL
FT                   GLYKPFADKGLLYLVRRLLMAKSRPFDIWTVNDKFALANYFSAGIDARIAHDFNHDRAT
FT                   GVISSNSVIANKLHYVKRFFADRAYHLKSGKLSMVENTPELKETVDLTGHTTVIVGNIP
FT                   SFASGANPFFQSDMADGYLEVVCVPNMLNFLLAIAVGNIPVIGYFLKKNLLKSRKVRSL
FT                   TLELADDEYIQLDGEDLSGKVGNRVTIQFACQVHMLTLEE"
FT   gene            complement(416266..416781)
FT                   /locus_tag="FSU_0365"
FT   CDS_pept        complement(416266..416781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0365"
FT                   /product="bacterial transferase hexapeptide domain protein"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25726"
FT                   /db_xref="GOA:C9RQD2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQD2"
FT                   /protein_id="ADL25726.1"
FT                   /translation="MGSIIKYKGKVPQVGKRVFIAEGACLVGDVSIGDDSSVFYNAVLR
FT                   ADLAEIKIGKRTNIQDNVSVHVSTGVGVNIGDEVTVGHGAVLHGCTIEDNVLVGMGAII
FT                   MDGALIMKNCIVGAGALVTAGKNFPENSLIVGSPAHIARTLTADEIKNVKIGVEHYLDA
FT                   KDELLKDV"
FT   gene            416895..418346
FT                   /gene="ald"
FT                   /locus_tag="FSU_0366"
FT   CDS_pept        416895..418346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="FSU_0366"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by similarity to SP:P46329; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24952"
FT                   /db_xref="GOA:C9RQD3"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQD3"
FT                   /protein_id="ADL24952.1"
FT                   /translation="MNEIHGIDIKKIFDAQGENRWKIAQTSAKERIQKLKKLREAVVKH
FT                   QEEFYEAVWQDFHKPRFEAWLSEIFPTIEEIDHTISHLKKWMKDKSASRVFFLPTSKSR
FT                   LHYEPKGRVLIFAPWNYPFLLLVNPIISAIAAGNVIMAKPSHKTPHVSAVLVKMFKENF
FT                   PENEIALIEGEGAEIGDKLLELPFDHVFFTGSPKVGAHIAEMAAKHHASITLELGGKSP
FT                   TILLPGINIKKHIKQIAWGKTLNGGQTCIAPDYALCPEDKVQEFAEAFAEDIKRRFGDT
FT                   EAKRHESKDLVHIVDKRATERHAALIKDAIAKGAKQVIGGVSDIENCYTPVTVLTNVTP
FT                   DMEIMKSEIFGPIMPIIAYKNLDEAIAFVQSRPKPLALYIFGTNKRDINYVLSHTTSGS
FT                   TCVNNTIIQIENLEVPFGGVGMSGTGNYHGFFGFKTFSHERNIMEQKGFDAVTFFHPPY
FT                   GIIPGSLRSKIQNFAEKALRFLKSM"
FT   gene            418426..419577
FT                   /gene="adhB"
FT                   /locus_tag="FSU_0367"
FT   CDS_pept        418426..419577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhB"
FT                   /locus_tag="FSU_0367"
FT                   /product="alcohol dehydrogenase II"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by similarity to PIR:A25978; match to
FT                   protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26342"
FT                   /db_xref="GOA:D9S5W7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5W7"
FT                   /protein_id="ADL26342.1"
FT                   /translation="MPWREPQLIHGAGTLSELPKHLKANDIENVLLVTDEFLVKSEHFL
FT                   NIKKYLEEAGIKYAIYDKTIPNPTIDNINDAARIYRKNKCKGLVAFGGGSAIDCAKGVG
FT                   IRIVRRWTPISFMRGTLRVLRKIPYLVAIPTTAGTGSEATVAAVISNPQTHEKYPINDF
FT                   VLIPRLAILDANITLNLPANLTATTGMDALTHAIEAYIGNSNFDGSAEAAILAGRLILE
FT                   NIQNAYRDGHNIKARENLQKAAYLAGYAFTRAYVGYVHAIAHSLGGMYHTPHGLANSVI
FT                   LPHVLEFYGETCETRLGFFAKAIGAVPAELDNHEASKVFIMQIRELNRSMDIPEHLEFI
FT                   QTEDIPRLAKSASKEANPLYPVPKILNAKELETLYRIVKGTKM"
FT   gene            complement(419583..420074)
FT                   /locus_tag="FSU_0368"
FT   CDS_pept        complement(419583..420074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM72494.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25456"
FT                   /db_xref="GOA:D9S5W8"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5W8"
FT                   /protein_id="ADL25456.1"
FT                   /translation="MQAFFRLELFCYIYLQWRLTMAVVMEENANPMKFEKLFKVTPEMI
FT                   DENKHMNNVWAVQWVQDISIAHSDSVGATDVMYQFGCGWMIHTQFVEYKNQAFLGDEIR
FT                   GTTWVAGYSKVASVRKCRFERVSDGKVVFESETQWVLMDMKKGRPFAIPQEIKDRFQVK
FT                   "
FT   gene            420264..422492
FT                   /locus_tag="FSU_0369"
FT   CDS_pept        420264..422492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0369"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="identified by similarity to SP:Q9RQI5; match to
FT                   protein family HMM PF00128; match to protein family HMM
FT                   PF02806; match to protein family HMM PF02922; match to
FT                   protein family HMM TIGR01515"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26800"
FT                   /db_xref="GOA:D9S5W9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5W9"
FT                   /protein_id="ADL26800.1"
FT                   /translation="MRKSMEWNDFTSLTAENMQAIWDFKTKDPFSILGIHPLETDRGIK
FT                   TVIRTYQPQASFVRGESCDGTEEFDFVKLGDTGFFEAILDLEYKPFFYKLIIKQGDGIE
FT                   YTLVDPYAFLPVLSDFDRHLIATGTHYELYRKLGANIIEHQGFKGVHFAVWAPNARAVS
FT                   VVGNFNSWDGRRHQMRMLGASGIWEIFIPNLGENELYRFEIHGADGNLHVKVDPLAKLA
FT                   EVRPATASITTHLDGYEWGDDLYMKTHWATKVFGAPMNIYEVHAGSWRRDPANPDRFLN
FT                   WDELSERLIPYLKEMGYTHVEFLPLAEHPLDESWGYQVTGYYSPTSRYGTPDQFRHFVD
FT                   LCHQNEIGVILDWVPAHFPKDAHALGRFDGTACYEHADPRQGEHPHWGTYIFNLGRNEV
FT                   KNFLIANAMYWLKEFHCDGLRVDAVASMLYLDYGKGPGEWVPNKDGGNINYDTLEFLKH
FT                   LNSIMGRLTPHAILIAEESTSFPSITRPPEQGGLGFHYKWNMGWMNDFLSYIQHEPIHR
FT                   KYHHNQLTFSMVYAYSENFIQVFSHDEVVHGKGSMLGKMPGDNWQKFANLRLTYAFQYA
FT                   HPGKKLNFMGNEFGQFREWNEKRSLDWHLVSWDSHGKLLEMMKVLNHIYKENAPLWEID
FT                   HYYTGFEWIWCDDADNSIVSFVRKDDHGNMILCVFNFTPVVRNDYRLGAPARGAWKEIF
FT                   NTDAAMFGGSNVGNLGEVWTQDVPWQNREWSLNIKLPPLAAVYFKLER"
FT   gene            complement(422599..423192)
FT                   /locus_tag="FSU_0370"
FT   CDS_pept        complement(422599..423192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26127"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5X0"
FT                   /protein_id="ADL26127.1"
FT                   /translation="MLALSVAVSATWAGPLSAPFTHDGLFANASMGMGYASFENADGEE
FT                   SLTANGFGARVHGKLGFYVVPDLALHANLGYVMYSNFQEARYGLATYMDHDFYVLSSVY
FT                   LGVGATYYVPGWNNVFISGSLGLTGYNLNCHKYSGNTGLSALSFDIEVGKDWWVGEHTA
FT                   IGVSLAYNSGEYWSDDDGVFRSSSMMLLFSVALN"
FT   gene            complement(423219..424802)
FT                   /locus_tag="FSU_0371"
FT   CDS_pept        complement(423219..424802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0371"
FT                   /product="putative P3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25506"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQD8"
FT                   /protein_id="ADL25506.1"
FT                   /translation="MVKYIFAIVLTLLSYSFAYDDMLVNSVTVAKKLETAPVAYYGSLI
FT                   TGNVYSEDRLPWVNFDKEYPDVYKSFMEWSELKTARMQRDLAEAPEIVRKTFELRSQKE
FT                   TNGFYLIHNIIHVDKIYDKETKTWVDPPVEKTKKVFTQFAYMGPDILKDSSSFKLILRV
FT                   IAVPKFDSEIPNKRIFFLEGVSESVAFLDVQSLENVQFFPYRLNYGVEPNSAIEVRKRI
FT                   ESLVYDGDYATAVQLVDSADLSPRSKALLKYLNRDYEFILNKDSSSNYLVRQSTYRYED
FT                   GLDLLLNRVAERDYHENFKCEDLQDKPEVNKDLACPVMKSIALGKMLKSLIEGESSFSF
FT                   GLGSDFGIPFLAGDFPDYKPYFFFNVALDFRIYNVLFSFEFNTRSLDEKCDSCGFFDYG
FT                   IHSLLGYRVLRTKYFEGAAFANLGTAFYVVRRDGEEKRENRQERYFRYGFGAYVDYLFP
FT                   SLEGKTMPEGDPITGRIAIRLKAGFHNMKASKYGHSKGISPYISLGFRLRGDVVKLWKV
FT                   SDFAKLEYQN"
FT   gene            complement(424804..426000)
FT                   /locus_tag="FSU_0372"
FT   CDS_pept        complement(424804..426000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0372"
FT                   /product="P2 domain protein"
FT                   /note="identified by similarity to GB:AAC45378.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25558"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5X2"
FT                   /protein_id="ADL25558.1"
FT                   /translation="MRVCVKCFAFLSALSLFFVCNAFAEASTSRDSVMNLFVHDYEETK
FT                   SIDSLSLVEKFSESEMLRQEFDQVKYLRNAMRKALQDDNLVRLKKLVDVAESYEKTSTY
FT                   FIIHDSEKLLLKYFLGDFESLSDVQFVSRYNARPDYVYDTFHKTFKEKLKAEIESGILD
FT                   EKLKSVENESDRIFICIVLKGFFKYKYDVPSLIEEHKLQLKKREQLEYLVDAYWDKKEV
FT                   DPLKSYTFFLGGSYVAFLGDISDKVKNGFGFYGGTNWYWNNVSFEGQINAHFNDVRSSD
FT                   TLHFSNLGWNLNVGYYFRDISLLCYLTTGVEADFYGENKSNDDKNRSSMDSYQVYPVYG
FT                   AGILYDMFYLRFRSGIKNIWGDHTVNASGFRFYMSIEFSIPVLTMKPVEFVYPDTMER"
FT   gene            complement(426035..426928)
FT                   /locus_tag="FSU_0373"
FT   CDS_pept        complement(426035..426928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0373"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27054"
FT                   /db_xref="GOA:C9RQE0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE0"
FT                   /protein_id="ADL27054.1"
FT                   /translation="MSLNSNRLDAFLSHLGVERNLSPVTIQSYQEDLRHFIAWLDENGI
FT                   DLKDLQPEKLDEFLTLTAGQEEYSPTSVARHFSSLRGFLKYMQIQGEYDYSTESMLATP
FT                   KLGHYLPQYLTREEIDSVFESAANGKNPLRDTALIELMYSGGLRISEALGIKLSQIDLE
FT                   NEWLMPIGKGNKQRLVPLGSKAKENLRAWIEEGRPLTHPTTDNIILNAHGKPMSRMGAW
FT                   KIVQLHTMHLSKQVSPHTFRHSFATHCLEAGMDLRVLQELLGHADISTTQIYTHVDKDF
FT                   IKQEHRSFHPREMGGK"
FT   gene            complement(426948..428966)
FT                   /pseudo
FT                   /locus_tag="FSU_0374"
FT                   /note="putative lipoprotein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(429028..429120)
FT                   /locus_tag="FSU_0376"
FT   CDS_pept        complement(429028..429120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0376"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26635"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5X4"
FT                   /protein_id="ADL26635.1"
FT                   /translation="MWNYEKNPLVEICWITSHGQTTMELVSLNL"
FT   gene            429198..429275
FT                   /locus_tag="FSU_0377"
FT   tRNA            429198..429275
FT                   /locus_tag="FSU_0377"
FT                   /product="tRNA-Lys"
FT   gene            429401..429478
FT                   /locus_tag="FSU_0378"
FT   tRNA            429401..429478
FT                   /locus_tag="FSU_0378"
FT                   /product="tRNA-Lys"
FT   gene            429625..429702
FT                   /locus_tag="FSU_0379"
FT   tRNA            429625..429702
FT                   /locus_tag="FSU_0379"
FT                   /product="tRNA-Lys"
FT   gene            complement(429786..431390)
FT                   /locus_tag="FSU_0380"
FT   CDS_pept        complement(429786..431390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0380"
FT                   /product="P3 protein"
FT                   /note="identified by similarity to GB:AAC45379.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25892"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE2"
FT                   /protein_id="ADL25892.1"
FT                   /translation="MMARWFLMMLGVMVSLSFAARYTRYNIVLSDSSVGYSQSQTVAQK
FT                   LQTAPIAYYGSLIQRTYLQKDFYNAENAEFEQRYPRVYESFVGWANYKQKRQDNLLTQA
FT                   PEQYQKMFEQRYALMNIKGFFLIHDEIRVEKIYDKATHTWVTPKPEDAKKELFSFAYVG
FT                   PDISQDSSWIISQRMMVLLPNSEDQTVPVKRIFFMDGYSEECYSLMDTSILDKIHYVPH
FT                   RLKYDVKPTAAMSAREKMQAFVESGDFASAGALAESADLSPRSKILMKILNKEYDFIVN
FT                   EDSTGLYLDDYNGVVYTDRLDDALNDAAMHEYVSGRYCKSLQDNPDVDSALVCKAVKKV
FT                   ALREMPKPVVHWMGPIRFNAYADFGRPFLAGDFPDFDPVFYLGFGFNVYLGNWFGGLGL
FT                   SIRSLDAKCDSCGTGDFGAHVEIGYLWLKKDYIESGVWCNFGFAAIEVPPQKGVEDPKY
FT                   LHERYFRYGFGIYVEALFPKLIGRPVDSFFEQGIGNRFGVRLKLGAQNINISDIGQAKG
FT                   LSPFVSLGITWHCMGVR"
FT   gene            complement(431387..432646)
FT                   /locus_tag="FSU_0381"
FT   CDS_pept        complement(431387..432646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0381"
FT                   /product="P2 protein"
FT                   /note="identified by similarity to GB:AAC45378.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25495"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE3"
FT                   /protein_id="ADL25495.1"
FT                   /translation="MLHRFLLIVILLSVVVLGRPSSASDVPFDSVMYLFVQNPDTNTSK
FT                   KLNYVETSANVEIVSNYKDSLEKERDMAVFYRNTIEHILEHSSKDDRMESLKKVVEEAE
FT                   IFDQNASVYHVFYANDKLVIKYFLKDFEFLSQVDSVKPLLKKHIKGDLHSAVYLKLKRE
FT                   IETGEMEESLREIPDESDRAFIYIVLNSMFRYKEDVSSMIENYKYQLTDEKQLYFLVNR
FT                   FWHKENYDSKKYFAFSWGGAVIKSFGRLSDKIGLSPGMYLGIDFVRKDFLYEWFMDING
FT                   CQNKELDSLQFYDMRWDFNFGYTFLKKDHLNLFGYVSAGLGMNGLSARGKDSNDKANND
FT                   LPIQFSPAFGAGVMVDLFFTEKKHIHHGLRFRTGVRSLFSGDVLKTSGVRLYASLEWTF
FT                   REYTKKPIDFDYSFRESGVK"
FT   gene            complement(432734..435895)
FT                   /locus_tag="FSU_0382"
FT   CDS_pept        complement(432734..435895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0382"
FT                   /product="cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by similarity to GB:AAC45377.1; match to
FT                   protein family HMM PF03425"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24814"
FT                   /db_xref="GOA:C9RQE4"
FT                   /db_xref="InterPro:IPR005087"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE4"
FT                   /protein_id="ADL24814.1"
FT                   /translation="MIKQSLKVASLAVLGLSVTAAMAQPKRPHLAVYKFFDEQYRPGGY
FT                   DYSYGGTSKGVTITKSGGYKSKAALNIKLDPKEYSGASICLYNEFFDLNKYMLDSKVEF
FT                   MIKGKNGGESVKVGLLDEEVSDGKKTQVVLPMNKYIEGGAVTTDWKKVSIPLVDFPDRG
FT                   LYWDNTRKSEFPSRIDWDKIAEIRFSIDKSAASEFEVWVDNIEIVKGNKKAAPKKQMVY
FT                   WDENNDIIDGPKNPEKLDGKAKTLATFYDNQVKGFSYSYGGLTAQREAQSKTPGNKNVL
FT                   AMYIDNNDWSGVTYSLGEGKFIDLSKVRDKGGLYFWIKGKLGGEKLYVGILDNQGNDIK
FT                   SQTKVGLNDWIKVSKDWQLAKIPLKRFTDKGKAWDANKSAEVAKDIKWDKIQEIRFSVG
FT                   KGENAGEPGKPAPVTVFVDQITFTSNIDWVDPDLKWDSFKSNAPDYVISDFEGKFAKDK
FT                   WEPSTGPKSQLKFKVENCAEFKSNCLNIEHYLLADWVDVVLDMQKNGRPAADRDWTKHW
FT                   GIMFDVYSEKAWQSITVQVQDAGNEIFVSNVGAPKGKTTILVPFRTFGKFPYYQPPNAV
FT                   ENGLFDLKGVTALDFKPSGEGTAGGFKVDNIRLTNQREVKAKERPAVIKVLVKGEKDVL
FT                   NPNISGGLFGINAALWDGDMLDNKNFKVQTREYAKRINHGIIRYPGGLRADDDHWKEIL
FT                   DNHDWMVDTDEFLEWLKKTGSNAMFTVNFGSGTEKEAADWVKHTNIDKKAGILYWEIGN
FT                   EIYGNWHPYYEKYGKDGGTIYGKRARKFIEAMKKVDPTIKVAVLGVLEGDWNDKVLAET
FT                   GDIADGLIVHHYPQHFGEENDFAMLSAPQTLTAIYERLHKVVDKWTKKYNKDKKIELWL
FT                   TEWNSVDFNPGPQTLSVENGLFVADYLGMLATENVDNAQYWDIHNDITPEGGDYGYLTR
FT                   SGEECMNCPRPSYWAFQMASDALRGKLMKTTIKGDEDALLTAYWTVNGNKKQLLLVNKS
FT                   PYSEFDIKLDIPGFKGKAKVQTLDKTSEKLKEGWANDPSKKAKTVDISKGIKVGKRTLT
FT                   LITLE"
FT   gene            complement(435994..436728)
FT                   /locus_tag="FSU_0383"
FT   CDS_pept        complement(435994..436728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0383"
FT                   /product="putative outer membrane protein"
FT                   /note="identified by similarity to PIR:A49232; match to
FT                   protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25465"
FT                   /db_xref="GOA:C9RQE5"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE5"
FT                   /protein_id="ADL25465.1"
FT                   /translation="MKRLSLFAMALVVSGLVACNQASAGGSFNQQARLDSLEKDFKQVK
FT                   EEFEIFKYALEKRGISLEQARAEMEADNKVWDIPDEDSPVFGNTKSPKLTIVEFTEFQC
FT                   PYCSRIAPAMQELNKKYPNEIKFVYKHFPLSFHSNAKAAAASSIAAQKQGKFWEYRYAL
FT                   APHSRELSDSVYLAVAKEIGLNIEQFKKDMVLDSAMNARIDKDFQLGVKVGVQGTPNFY
FT                   INGKRQDRFSPDLVEKMLKEAK"
FT   gene            437066..438979
FT                   /gene="metXW"
FT                   /locus_tag="FSU_0385"
FT   CDS_pept        437066..438979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metXW"
FT                   /locus_tag="FSU_0385"
FT                   /product="homoserine O-acetyltransferase/methionine
FT                   biosynthesis protein"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by similarity to SP:P45131; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   PF07021; match to protein family HMM PF08241; match to
FT                   protein family HMM TIGR01392; match to protein family HMM
FT                   TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25485"
FT                   /db_xref="GOA:C9RQE6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE6"
FT                   /protein_id="ADL25485.1"
FT                   /translation="MIKKQKAKAQPIPTVYRLLPTKTLLSFMHMSEYLHKSFGPVIPKD
FT                   FNKDYGEQGFLLESGKTLPALTIRYETYGTLNAAGDNAVWVCSPLTADAHAAGWYTEND
FT                   KKPGWWDELIGPGKAIDTDRFFVVCSNILGGCKGSTGPATINPRTGKPYGSTFPTITIG
FT                   DMVHAQKELADGLGIKEFYSVIGGSMGGFQAMKWAIYYPEQVKRIIVIASSPRFSSQAL
FT                   GFEVVARDVITQDPNFHGGDYYDEGKTRPDIGLANARKLAHITYLSAVGMEKKFKRAQD
FT                   QENRSHAVTYSTPYDLNLPIESYLRYQGTKFVDRFDANSYLHIAHATDAFDLETEYGSI
FT                   ENAFKGIKAEVLNVNLSTDWLFPPHESRRITSALLNTGKTVTSLELDTQFGHDGFLIEV
FT                   GELGKAVGRFLDSKIIPQNGTQAVPVFHDQNDFQRISKLVKEGSHVLDLGCGSGDLLDY
FT                   LIRKKNVTGFGIEKNIKGILDCLEKDVQVIQRDLDESGLTDIKDGSFDYAIINRTIQEI
FT                   RDPVALLNELLRVAKQVIVTFPNFGHWSARGSLMLHGRMPISKELPYEWYDTPNIRVLT
FT                   LKDFYTLCNKEGFKIENLHFQNEHKISKFLTAIGLPNFGAEHVIATISKLDERRETRDE
FT                   RG"
FT   gene            438981..439862
FT                   /locus_tag="FSU_0386"
FT   CDS_pept        438981..439862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0386"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /note="identified by similarity to PIR:G97111; match to
FT                   protein family HMM PF03755; match to protein family HMM
FT                   PF08340; match to protein family HMM TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26966"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE7"
FT                   /protein_id="ADL26966.1"
FT                   /translation="MSIISMTGFGKSESTLQGITCVIEVRSVNSRFLEISSKIPKNFAY
FT                   LENDFKAQIKDKLVRGSVNFSITLGAGNAGNIPVCYNEAAVAKFVEITKAMQKKYGIAG
FT                   DIKLEHVLAIPEVLQFTDGNGDNEVWEKHLKAELDKALDGVIAMREKEGANLAVDLTRR
FT                   VIHLNEVIDKVEVLDPQRIETWKVKFRERINTLMKDSEIDEVRLLQEACIMADKLDIHE
FT                   EITRFRSHNKLFLDALAKGGAQGKNLGFILQEMGREANTLGTKCQNAEIAALAIELKNE
FT                   IECIREQSMNVA"
FT   gene            complement(440083..441339)
FT                   /locus_tag="FSU_0387"
FT   CDS_pept        complement(440083..441339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0387"
FT                   /product="hydrolase, ATZ/TRZ family"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25020"
FT                   /db_xref="GOA:C9RQE8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE8"
FT                   /protein_id="ADL25020.1"
FT                   /translation="MDKKIVLKNVFFDGAKRDILIVGNLFEKVTRPLELADYEGAEIVD
FT                   CSHFAIMPAFYNGHTHAAMSLLRGFADDMELGKWLNEYIWPTEAKLTPDDIAVGSHLAV
FT                   LEMIKSGTVFFTDMYWHREQTMRVVEEMGIRAAIGVTFAEPLMSPEAWAANVDFLKNHT
FT                   GESERVQLVVMPHAIYTVGEEKTAELIELAHAENYKIHTHLSETMTEIKNCMEQFGCTP
FT                   VEFWKRLGGLNSNFSAAHCTHFTASDRKIFAESGATAILNPCSNMKLNSGIPQVAEMLK
FT                   DGMKLGLGTDGDSSNNNLDMQEEMKTIALLAKYLGTAETLPAEEALKMATCNVAQFFGI
FT                   NAGRIAEGCLADCLLIDLNNERMVPCYNIYSNWVYSANSSAIDSVMCNGKFVMRGRHVD
FT                   GEEEILRDARECAARLVAK"
FT   gene            complement(441487..442914)
FT                   /locus_tag="FSU_0388"
FT   CDS_pept        complement(441487..442914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0388"
FT                   /product="putative UDP-N-acetylmuramate--alanine ligase
FT                   murC"
FT                   /note="identified by similarity to SP:P17952; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM PF08245"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27290"
FT                   /db_xref="GOA:C9RQE9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQE9"
FT                   /protein_id="ADL27290.1"
FT                   /translation="MTNSYFFIGVAGVGMSAIAQYLVGKGVAVSGSDRQFGEFLNGNAE
FT                   KPLVMSQLEDCGIKCFAQDGSGVVEGLTAVVVSTAIEDSNPDLKRAKELGVPVMHRSEM
FT                   LAKISKEARTIAISGTSGKSTVTAMVYHILDYAGLQPSVMTGAGLVNLQAQGKIGNAVS
FT                   GKGEWLVAEVDESDGTLVRYEPEIGVILNIDKDHKEISELEQIFLKFSQNVLSAGHILI
FT                   VNDAHPLAKKFSAGREFDFGYESYVSVQGIDFKSVGTHIQFRVRHGNELVKFEIPLPGK
FT                   HNMENALAATAAALRAGVSLHTCADALSSFPGVFRRHQILGTFNGITLVDDFAHNPAKI
FT                   AASIKSAQDFTEGRVIAWFQPHGFGPTRFLRKDLVDFIAKTLRPMDMDFDRKNDVMFFS
FT                   EIYYAGGTVTRDISAGDLADDLILKGCEAIYIADRNECAKKMLEYAEPGDTILLMGARD
FT                   PSLKEYACYVKQLLEDR"
FT   gene            complement(442936..444210)
FT                   /gene="rluD"
FT                   /locus_tag="FSU_0389"
FT   CDS_pept        complement(442936..444210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="FSU_0389"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26185"
FT                   /db_xref="GOA:C9RQF0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQF0"
FT                   /protein_id="ADL26185.1"
FT                   /translation="MNYIVEEKHNGERIDKFLVGVMENVSRTDVQKLIEAGEVKVGGGK
FT                   VSKNFRVETGMAVVVEKMIEKESSTLEPEDIPLNIVYEDDDIVVINKPRNLVVHPGNGV
FT                   SKGTLAAALLYHFKENLSTVNGPLRPGIVHRLDKDTPGLMVVAKNDAAHRHLAHQLETR
FT                   TLHRTYNALVWGCPRDLEGTIDAPIGRNPKNRLKMAVVKGGKESRTHYVAKQFFAIATL
FT                   LELQLESGRTHQIRVHSRYTGHPVVGDPLYDGRDESLNRVPPLMKPVAEKVLEIAPAQL
FT                   LQAVKIELIHPRTNKKLTFKVPMEEPFANVLKLLKKECPASAPVYDEEEGFRDFDAQIR
FT                   FDEDDEFDEYEEPLEISPDEAAPVKERKTRAQRLAEKKATAAKRRAVAAERKLIKQMKA
FT                   ARRKGVAPEDFVEPGYEPTIDPELL"
FT   gene            complement(444226..444810)
FT                   /gene="lspA"
FT                   /locus_tag="FSU_0390"
FT   CDS_pept        complement(444226..444810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="FSU_0390"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by similarity to SP:P31024; match to
FT                   protein family HMM PF01252; match to protein family HMM
FT                   TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25397"
FT                   /db_xref="GOA:C9RQF1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQF1"
FT                   /protein_id="ADL25397.1"
FT                   /translation="MEKFYNKWPFHVAVIVFSIVSDQLTKLWAVARFTDEAGNFTYEKI
FT                   PVIGELVRFQLVYNKGAAFSSRPQDLMPFLPPWLFFLLISIVAAFALAWFYKSIDKRDY
FT                   LSRLGVVMILGGAVGNFIDRMRMQMVVDFIDCDFPDFIMTRFPTFNVADSFVTVGVALV
FT                   ILSPVILRKLHKQIKEEKDAEKSAKENPPNP"
FT   gene            complement(444812..445894)
FT                   /locus_tag="FSU_0391"
FT   CDS_pept        complement(444812..445894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0391"
FT                   /product="squalene/phytoene synthase family protein"
FT                   /note="identified by match to protein family HMM PF00494"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24583"
FT                   /db_xref="GOA:C9RQF2"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQF2"
FT                   /protein_id="ADL24583.1"
FT                   /translation="MIDKLDSLDVGEKVLEGKAAWKYAEDILQLVSRTFALNIQVLRGK
FT                   LHRSILLAYLYLRIADTVEDDPDMKATEKDRVLALFADVFKTGELETEKIRTFVAALPE
FT                   SWHGSEDPNKDLCSKSEVVVPLLKSLPKNYQKPVCDVVIEMCGGMAKFALRQEAALSAG
FT                   WFTLANVGELDEYCYYVAGIVGKLLTKLFSADTCFINAEREAELSKLDVSFGLALQVVN
FT                   IVKDCVEDSGRRVCFIPEEICKRHGFAHPSELFAAGADAQKCGAVLSELVEKAWHHLDD
FT                   AIAYTKLIPNIKMRTRLFCLWPLFMAAENLSLIGNGVSVFTSDKKVKITRDTVKRIVKE
FT                   TSMHFYSDKWIDEAYKKIKG"
FT   gene            complement(445900..446475)
FT                   /locus_tag="FSU_0392"
FT   CDS_pept        complement(445900..446475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0392"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27120"
FT                   /db_xref="GOA:C9RQF3"
FT                   /db_xref="UniProtKB/TrEMBL:C9RQF3"
FT                   /protein_id="ADL27120.1"
FT                   /translation="MVINTLVEYIFWIPVLLWVGLHFWFRNVSYVVFLKNQLDRGEKWA
FT                   YVLSGFVKHPGRVSFLRFCDYLFTLVTSFATASAIVWTLQKIGLGANAYYGFVSVLIFA
FT                   WIAHLMKRRTEHKLTDLFQSAFYLEYRWVNYGIQRKGIAMSDENVRDRAGLSYAHKLRN
FT                   AEDHGRFWKYVKSMAASKKVPPEMYEVY"
FT   gene            446447..446635
FT                   /locus_tag="FSU_0393"
FT   CDS_pept        446447..446635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0393"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26173"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5Y7"
FT                   /protein_id="ADL26173.1"
FT                   /translation="MYSTSVFITIVEKIRKFAKFQGFLPTRGGSNIDVNFRLQRSKKFF
FT                   RFISLPIYQHSKELAKF"
FT   gene            446678..448003
FT                   /gene="dnaA_2"
FT                   /locus_tag="FSU_0394"
FT   CDS_pept        446678..448003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA_2"
FT                   /locus_tag="FSU_0394"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25877"
FT                   /db_xref="GOA:C9RIX2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX2"
FT                   /protein_id="ADL25877.1"
FT                   /translation="MQVEWERCLNYLHGMLSDTVFKTYFAQTKLVSQTPGHAVIAVPPG
FT                   LDVKVYAAYKDLIRLAWKDVSHDEAPVEFEFQPQDVYQPQVSSSDNSFREFIKPSVPLS
FT                   GSFRFENFVPGDKAQLAFNAALAVARNPDGTQYNPLFIYGSSGLGKTHLLQSIGNYILE
FT                   EDPTKRVIYLTSEDFSQQYMKCLQEKRITEMSDFYRNEVDILLIDDIQNWTGKYETQNE
FT                   FFLIFNALHQAGKQIVLTSDAPAAEVKNLSDRLVSRFSWGLTVDIQPPDVETREAILHK
FT                   KAEERHLEISDEVIRYLAENIASNVRCLESAIIKLTLQSSLMSHDIDMNIAQKVVTEIA
FT                   PTLRRRVSLDAVLHAVSQHYEVPETKLIEPGRGTKEISKARQVAMFLMRELSPISLQSI
FT                   GSRFGGKDHSTVVHAIKSVKKEMETDPSFARLIESLKNTIHD"
FT   gene            complement(448128..449111)
FT                   /locus_tag="FSU_0395"
FT   CDS_pept        complement(448128..449111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0395"
FT                   /product="diaminopimelate dehydrogenase"
FT                   /EC_number="1.4.1.16"
FT                   /note="identified by similarity to SP:P04964; match to
FT                   protein family HMM TIGR01921"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26572"
FT                   /db_xref="GOA:C9RIX3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR010190"
FT                   /db_xref="InterPro:IPR032094"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX3"
FT                   /protein_id="ADL26572.1"
FT                   /translation="MAKIAILGYGNLGRGVECAVKQAPDMELVAVFTRRDPLTVKIQTA
FT                   GVPVLNVSEMEAWKDKVDVLIICGGSATDLPVLTPKYASMFNVIDSFDTHAKIPQHFAA
FT                   VDAAAKGANKIAMISVGWDPGMFSLNRVYAQSILPEGKDYTFWGKGVSQGHSDAVRRIK
FT                   GVKNAKQYTCPVESALEAVRSGSMPELTTRQKHTRLVYVVAEEGADKAYIENAIKTMPN
FT                   YFDEYDTTVNFISEEEFNKNHSGLAHGGFVIRTGKTGMNKEHTHVIEYSLKLDSNPEFT
FT                   TSVLVAYARAALRMKANGQTGCKTVLDVPPAYLSTLSDEDLRAHCL"
FT   gene            449371..450159
FT                   /locus_tag="FSU_0396"
FT   CDS_pept        449371..450159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ66279.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24778"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX4"
FT                   /protein_id="ADL24778.1"
FT                   /translation="MKNHFLSALSAGFLLFTTCFAQSANEIAKKVHDLPSGKTSSGLVS
FT                   VTLIDKNGKTRNRELVSYTMKDGSTDKTVLMFKTPRDVAGISYLTYDYPDKADGSTVDS
FT                   DSWIYIPAMKKVRRVSGSNKDDDFQGTDFTYDDLGTRSLSKDNFALLGEEKVNGIDCWI
FT                   LEAKAKDPKAKVSRRVTWVNKKTFVVQKGEYYDKQNRLQKTLTADDIKQVNGYWTTLKQ
FT                   TMTNVQTNHKTIYEVKNLKYDEKVNESYFTVSALEREQIK"
FT   gene            450180..452579
FT                   /locus_tag="FSU_0397"
FT   CDS_pept        450180..452579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0397"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27115"
FT                   /db_xref="GOA:C9RIX5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX5"
FT                   /protein_id="ADL27115.1"
FT                   /translation="MKVEKFNKFFGKIGQAQIRNRWKILAGLLIVTVICCLGLSNFSLA
FT                   LGEEGWFGNSDEITINTKKYEETFGNLNGIGVLVVKQGEGDVFSEDMLKVIEKIGNRMR
FT                   DEIPFADRLTSIVEVDIPVGNDEGFSIVKPYENGIPSDSEGLAKARALVMRGSEKTNAL
FT                   INSLVSDDGKETWISLSLHPFTGKELEEKYGGDNTEVSTDIGYKLMNIIESEEFQNKGF
FT                   KLYGGGMPYDSANEDRYEVPEYGVRVLCSIVVMLLFLAICLRNVFGVIVPAVATISAIA
FT                   TVFGAMSFFGEKADSALVTLPVVLGMALAVGYSVHYIKMFKLHFRRTGKRKESAIKCVE
FT                   ECGWPVLFTVLTTMASFISFLFVNMKPLEWMGKTSAFIVLAIYIYVTVLIPILLSFGKD
FT                   RAPRATQVNGATKLDLSFSRWSKFVHDRKKSFIVISALVIAAFIPGMFKITAQLDYLTI
FT                   TGDKMPYIQEVKKMLAQKLGNQYSYTVMISYDEEGAFKKPENMKALVQLEDYLGTLSLT
FT                   KWSGGKARITSATSILKEMNRALNEGKDSMYTVPEDEYVLAQLMELSSIEMHNDFSDVM
FT                   DDDFKTTVVSVDMTQFATEEALANMDALKAKLAELFPGAKCTLLGDMIRYSEMSNRIIF
FT                   GGLKSFGFSLVIIAIMLVFAFSSLKLGLIGMIPNVAPVILVGGVMGYFNYALDFSTITV
FT                   MPMILGIAVDDTIHLTTHLKMKHEQMGSSEKAMEATFREIGATMFLTTIILCSMFSVYL
FT                   FSPMHFLEVLGVLIIVGLSSALIADYTITPALLHVAKPFGKEKEEV"
FT   gene            452576..453979
FT                   /locus_tag="FSU_0398"
FT   CDS_pept        452576..453979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS12525.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25682"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX6"
FT                   /protein_id="ADL25682.1"
FT                   /translation="MNKHSFLTAITPAIALAAITLFSAPTLYAQETTFNGSLTTKAGVS
FT                   LANSHDLKHDFVLGQTIFDGTIKTFFDEGMVYVNGQLVHDAIGTQASNGMSGFVADDGS
FT                   FALKLREAYIDWKTGIFALRIGRQIVSWGKADDIQITDVVSPFDESSVVANDYNESKLG
FT                   VDAVRLSVLTDKAQVDAYYIPFFTPSILPIASKNPLRSRVFPSNVDGLDVYSPYYYDNF
FT                   DLPKKRLSNSEYALRASLYTSVMDLSLYGFYGWDDTPFFKYSPLMYEDANDDPNLEGFT
FT                   VSGKYRRMAMVGADAAIPVGDFVFRLETAYFPKRHIQTSADYQIEKSLNEEHSYTSRRR
FT                   DQLLSLVGVDWTYSFPIIGSLTITAQYISDYVFNYKNYLDRKRYEHQVTLSVEKSFLNE
FT                   TLTVSGSGALEFCACSAAGEVEVDYQLNDAITLSMIGDIYIKGTQGRDGTYGLYRDFSS
FT                   LTLKGKVSF"
FT   gene            complement(455014..455448)
FT                   /gene="dut"
FT                   /locus_tag="FSU_0400"
FT   CDS_pept        complement(455014..455448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="FSU_0400"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24695"
FT                   /db_xref="GOA:C9RIX8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX8"
FT                   /protein_id="ADL24695.1"
FT                   /translation="MASQTIKIQYLDESIPKLTYVGGKSDWIDLAAAETVTLKAGEFRL
FT                   IHLGVAMKLPEGYEAHIAPRSSTFKNYGILQANSVGVVDSSYCGANDWWKMPVYATRDV
FT                   IIEKGSRIAQFRIMEIQPTLTFVEGALDGADRGGFGSTGI"
FT   gene            complement(455464..456336)
FT                   /locus_tag="FSU_0401"
FT   CDS_pept        complement(455464..456336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0401"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26090"
FT                   /db_xref="GOA:C9RIX9"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIX9"
FT                   /protein_id="ADL26090.1"
FT                   /translation="MELREKPGKVQKLLELSLRFRLIFVLLMIGFAAAFLVTGWQQMAS
FT                   LPLGASEALGMWIAKFTNVVSAWHSTQYLFVAGLSMLVLYFVFGGVRGGFAGLIALVAF
FT                   LGALYALGGDEDMLLMFFAVIAGLALLFVAFVKWSVACALFPFVLSWLLLTGFVSWFPM
FT                   MIGKAWLMWAVLSAIAFSGVMACALVAGKELGDGSPKAGALVKAGKKLLVPVLISSLLA
FT                   ISALVVDMSVVVDAKRIGCAAFLWVAFNVWFFGFTFSTLSFAPWDRIRSGSRRVKMGDK
FT                   KKKPAKKKK"
FT   gene            complement(456341..460453)
FT                   /locus_tag="FSU_0402"
FT   CDS_pept        complement(456341..460453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0402"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:T07884"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27286"
FT                   /db_xref="GOA:D9S5Z5"
FT                   /db_xref="InterPro:IPR001769"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5Z5"
FT                   /protein_id="ADL27286.1"
FT                   /translation="MNSIIKKFQILLVACATVSSWASSVIEDSNKRFVLDDEVLDSSTR
FT                   SCEDGLGMRFAPENAFYVDEGDVPVRHYRLALPSNVKPSVSVTNSKLVSLGASPCKSIP
FT                   AKIQSIDVSSPFFKDNLWMVDVFVPLYVKEGGSIALRKNFRLSVDFGAATSGGRNPGAR
FT                   ALMQVVNAKSAAKFGSAASRKSLRRSASAEIDDVAQLVELVVGDENIATFSEDGMYAVS
FT                   YEMLRTALRKVGREDTLLHGVPVEKVCVYGASPDTLPDMGPGEKLRNPNQLFELPIKVD
FT                   DRNSNGIFDDGDSLFFVGYGNAFWKRTDSEPTQVPDVPKTNMGYFHSYSPYSFYQHFIL
FT                   GYKQTGSGLRLKTIEPPKSTAKSIEWLRYVRAEKDELLRDGYYGRVVDWEKTTGKEYFW
FT                   KWREFGDTLSLSSADLDFKTTTRLPGLVSGGKGFVALSFFPLRSQSASMMFSDSTYEKR
FT                   INPIVFNLKVNGISYSKLKSDSFYWASGDILPGGNFGIPTSDLKSDGNKFELTIYDNSY
FT                   QHDRFDGYSVAYQWEPAKVSIDSSEWLLPGFATGVIRIPVGTDSDLRVMKFKDFAPVGL
FT                   LKITDGEAIDSIGANEDVRYLLFNNGNRRKALSLKGVAAPSKNAVQKLSQISSKTEYLI
FT                   ITPDVFLAQAESLAVFRSSEKSASQLVTAVVSAENIYRHYTGGALSPIAIRNYIAYARS
FT                   VCPDLRFVLLAGGGNYDYRGKANIGENYIPPFEKEASVTEDFFAVLDSGEVVRSGKTYD
FT                   VDLALGRLPVTTVQEFEDYIDKAKDYDYIGRFDHGEWKSTLLLAADDDRNAGSADPMDH
FT                   TIYQENLANLIDTTAESQGFRMNMKKVYLLNYEADAAEQKQEAANDFLNMLNQGALMTV
FT                   FYGHGSKVAWASEGLMKLSYLPKLSNEKRYTVLNSFSCTVGRFDEGGSKSMTEAFVLLP
FT                   NAGAIAAVGAARETYAKPNEVFAKNFIGPALLKDGNYLGVAYMQAKDNVFLHSKSVPTY
FT                   TNNVYNSEHYVYMGEPVIRMPLAELKVSMDSPLDSIKALEKIKLSGKVSGMSSGNIALT
FT                   LREGRFTKRLDMISTSNYADVKYDGPLIYSEVVPVVGGRFETEFVTPKKLNIGDSLAEL
FT                   RGWAYSSNDVAVGRYFEKNIKITGISNYADSLNDKAPPTIKIQLCNANESTSFADNQFV
FT                   KLLTPACLQVVVEDETALDYREQADEGITFEMFGLENSYHPTLFLEQSSKRAVVRKSFT
FT                   TETYPPGNYTFKVRAMDVLGNVSIKILNIEITEAMQAGLADVFNVPNPMGKKGTTFYFK
FT                   NLAVGVESDVNIFIYNQHGRLVKVIKNAKSGVTQWDGRDNYGRLLANGLYHYVVRSKTR
FT                   IVNSSSDTKMKSKTQTWTKKQKLLISR"
FT   gene            complement(460494..461375)
FT                   /pseudo
FT                   /locus_tag="FSU_0403"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(461403..462122)
FT                   /locus_tag="FSU_0404"
FT   CDS_pept        complement(461403..462122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0404"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26477"
FT                   /db_xref="UniProtKB/TrEMBL:D9S5Z6"
FT                   /protein_id="ADL26477.1"
FT                   /translation="MHVLKNKIVLALLVSVFAIMAGCAGSSNGSTNEPAETAAVRDAKV
FT                   KAQESQKLAMLEEMYDLFKKSVENRAPSDILLDFLTDPSEAWLDELESHAKSYDATAMD
FT                   TCQFYEAYAIVLYRLYEREHLWTVPDYRMLYLLLYDSGFLDLANHVKMGPFEVKNDRGS
FT                   VGLASSPKVPIMLFNWDDTKWKLDLIETLPLITKGVEATAAKKNWTGAKLALYWLDKKY
FT                   HLQYSRLDESLLEPIGF"
FT   gene            462117..462608
FT                   /locus_tag="FSU_0405"
FT   CDS_pept        462117..462608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0405"
FT                   /product="putative peptide chain release factor"
FT                   /note="identified by similarity to GB:AAP04114.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26649"
FT                   /db_xref="GOA:C9RIY3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIY3"
FT                   /protein_id="ADL26649.1"
FT                   /translation="MHRDTYLKMNLDELLRACTLKGYQGSGPGGQHRNKTNTGVHLSLQ
FT                   QYNLEIKSSESRSAKENKIHALHHMQMALALNVREEPPAVEMKFPGSNGHIQPSNPQFP
FT                   LFVAHVFDIMATKNGDTKAAAAAFGLSPSALVKILRQDKSCAAKLQGNRVENGKSKLHL
FT                   "
FT   gene            462724..463965
FT                   /locus_tag="FSU_0406"
FT   CDS_pept        462724..463965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0406"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26631"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIY4"
FT                   /protein_id="ADL26631.1"
FT                   /translation="MSPTTKKHVCRYAATALTALAFWNCSSDSRAESPIDSIQIGESAN
FT                   IALNLDYTGTPLLDSLVLDCYGSDTLHLVHSIEKKSFNLDLFPGEEWIFNAKLYANGAL
FT                   MQEGEVTTSLEAGSAVSLKIPMHALVGFVYVKIPIGFGNPAGIKKGEMKLTSGDETFTY
FT                   PMEFDSDNVTFTSDDLKLDREYHISISMQDESEKTIFSMEDDFTLDENTPIPSFQIESL
FT                   RSKIALAIDLAKDVNLQVSLRLPAMKRAPAANDIVVSEFFVQPKDSTQFTFVEFYNGST
FT                   DTLVLDKCTLGKTSNVSGAAEISTVTLPPNEVLVVGTSETADIAGIYKYAESMPQFGKT
FT                   SGSIVLQCNGNVLDSLYYGKADTLHVTPLPIGSSSAAVRKSTQLNIGLWNKRSEPDSWC
FT                   TDTPTPGMISACGN"
FT   gene            complement(464726..465139)
FT                   /pseudo
FT                   /locus_tag="FSU_0408"
FT                   /note="conserved hypothetical protein TIGR00250; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by similarity to
FT                   GB:AAQ61571.1; match to protein family HMM PF03652; match
FT                   to protein family HMM TIGR00250"
FT   gene            465231..467066
FT                   /gene="typA"
FT                   /locus_tag="FSU_0409"
FT   CDS_pept        465231..467066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="FSU_0409"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF01926; match to protein family HMM PF03144;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25766"
FT                   /db_xref="GOA:C9RIY7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIY7"
FT                   /protein_id="ADL25766.1"
FT                   /translation="MDQSKIRNVAIIAHVDHGKTTLVNQLLKQCGTFHEGEEIVDRVMD
FT                   SDNLERERGITILSKNTSVMYKGYRVNIVDTPGHADFGGQVERVLGTVDGVLLVVDAFE
FT                   GPMAQTRFVTKKALELGLTPIIVVNKIDRDGCNPLLALDKVFDLFCELDATEEQLDFDR
FT                   VFGSGRKGICRAELEDPDGDFSILMDKIIERIPAPKGDPNAEPLLQIASLEYSSFLGRL
FT                   AVGRVQQGVFKPNQTYAQAFPDGTVKNVRPQKLLRYEGLTPKPIEEAGPGEIILIAGLD
FT                   YFDIGDTLSSTNNPVHLPRIHIDPPTISMLFTVNTSPLAGKYGGKFMTGNQLQERLERA
FT                   HMADPALLVEKAEGASTFKVSGRGILHLTILVENMRRELYEFTIGSPQVIFQKDESGKL
FT                   LEPVEDFKVEVPNEFSGACIQEIQQRKGEMVNMTTDENDRVSLEFIVPSRGLIGIRPKL
FT                   LSLSKGYAVTQSFFKEYQPYKGEIPSRINGVLIAKEPGEAASYALSNLEDRGYLIIGPG
FT                   AEVYPGMIVGEHNRDVDITVNVTKGKHLTNMRSKSADDMIQLTPYRRMTLEECVTFINE
FT                   DECIEVTPEVLRIRKTELDPIKRKQMSKKPAEDDD"
FT   gene            complement(467127..467867)
FT                   /gene="thiD"
FT                   /locus_tag="FSU_0410"
FT   CDS_pept        complement(467127..467867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="FSU_0410"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by similarity to SP:P76422; match to
FT                   protein family HMM PF08543"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27287"
FT                   /db_xref="GOA:D9S600"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9S600"
FT                   /protein_id="ADL27287.1"
FT                   /translation="MNFALTIAGFDGSAGAGILADVKTMAHFGVFCESVCTALTQQNED
FT                   EFVAPGWVIWERIEAQLETLFAKRQFKFVKIGLVEKAKVLQRIVEFVREKSPDAYIVWD
FT                   PIASASAGFHFMRSAERDEFMPVMKQIDLVTPNLDEFGFLGFEQAASRGKFEFGKDFAL
FT                   LLKGGHSTDDEAVDTLWDRDGKQYKFTSPRIPGNGKHGTGCHLSSAILANLALGHTLPE
FT                   SCQIAKNYLTELLQSGEGRLAKDF"
FT   gene            complement(467881..469167)
FT                   /pseudo
FT                   /locus_tag="FSU_0411"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(469262..470953)
FT                   /locus_tag="FSU_0412"
FT   CDS_pept        complement(469262..470953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0412"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26833"
FT                   /db_xref="GOA:C9RIZ0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ0"
FT                   /protein_id="ADL26833.1"
FT                   /translation="MLLRNGKKILRLLIAVVAAVIVVLFVVSFNGMCRHGSCNNVIALN
FT                   DGWSISFGGIHLPPMEHVSDFRVPSNIQPGDTIIYERDMRNDSIPLPTTLRFHAYHVAV
FT                   AVYVDSVCYYRYGFERFKAGKLVGSGIHLVNMPEFLDDHVIRVVTIVTEKAAAKSVTQI
FT                   ELLRSNSMTDYFSQNSDSITIGIFLMFFGMIAFITGCCAVGFDRAYYRLVLIGLFAGLM
FT                   GLWTLNYAKGIQIVSTNYALDTTLEYVSLYLAAIPFGLLIINMRAGKISTWKLNVLKVI
FT                   VGFGVLFFLVTTILHVTDIAHYPTFLLIYHSYIFVSFLFMVFFKVLYDRGAGMQEKILA
FT                   SGTVVFVLFGIADLFRYNVQNLFGLEKSFLDATCLPVGTLLFILFLMVGYLVYMYEELM
FT                   DKTEKEVLRQIAYRDALTGIYNRAKCEHIFEVLNRDDSDYAIVSIDVNGLKYVNDHFGH
FT                   STGDKLLCAFADVFKNAFNGIGTTIRMGGDEFVAIVRAEHLSDLNTALKTMVLLEKDAK
FT                   LPIELNVAYGYSVRRRGDAVTAMDVYRMADANMYAMKLASKQQRMA"
FT   gene            complement(470993..471484)
FT                   /gene="folA"
FT                   /locus_tag="FSU_0413"
FT   CDS_pept        complement(470993..471484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="FSU_0413"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by similarity to SP:P11045; match to
FT                   protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25243"
FT                   /db_xref="GOA:C9RIZ1"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ1"
FT                   /protein_id="ADL25243.1"
FT                   /translation="MLISAIVAVSENNVIGRDGHLPWHLSADLKRFKAITTGHAIILGR
FT                   KNYDDIGRPLPNRTNYVLTRNKDFQAPGCIVCSSLGEAIEAARAAGETECFIIGGAAVY
FT                   REAMPLVEKLYLTRVLSHVEGDVFFPEWNDKFQKESAESFPADEKNDFPTTFEIWVRKK
FT                   "
FT   gene            complement(471493..471954)
FT                   /locus_tag="FSU_0414"
FT   CDS_pept        complement(471493..471954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q9CDS7; match to
FT                   protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25596"
FT                   /db_xref="GOA:C9RIZ2"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ2"
FT                   /protein_id="ADL25596.1"
FT                   /translation="MKWVLAVFGKAGSPFIADEVEKYVKRLRGSAMPLEVVELKESKID
FT                   DHAQALAQEAALFEKKFPRNEFRRVILSEEGKLMTTVKLADTLQARFTGNIVFLIGSAY
FT                   GIDENLKKSADLLLSLSPLTFTHDHARIITVEQLYRVQMVMQNHPYHHR"
FT   gene            complement(471955..472683)
FT                   /locus_tag="FSU_0415"
FT   CDS_pept        complement(471955..472683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0415"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26243"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ3"
FT                   /protein_id="ADL26243.1"
FT                   /translation="MLYGICSDIHSNATAFEAVLQSMRENGVERRVCLGDIVGYGVDTD
FT                   ECVNLVKENMDVCLIGNHDSVAVRYESSAGFNPYAKQAIEWTQKNLSKESVTYIRSLPY
FT                   IQEENDICFVHASPLSPADWVYVTDLEDALNAFDHFSERYCFVGHTHSPVIIASRPLAI
FT                   PKILDEYEYVIANTERLLVNVGSVGQPRDRDPRACWCLLDTETKCVRLIRVEYDIRETQ
FT                   NRMKKQGMPSFLIDRLSVGR"
FT   gene            472753..473385
FT                   /locus_tag="FSU_0416"
FT   CDS_pept        472753..473385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0416"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27050"
FT                   /db_xref="GOA:C9RIZ4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ4"
FT                   /protein_id="ADL27050.1"
FT                   /translation="MVVIQDKMKVSIAYTLREGKRILEEVPASQPFVYIHGYNNIIPGL
FT                   EDALTGRRLGEKFTVSIPANLGYGEYRKDLILTVPKEELRDVGELWLGMELEMYQDNDM
FT                   REFQLPDTAEEFVNDLNLDGDDDQCDGIYTIKEILEDTVIVDGNHPFAGKDLIFNVEVV
FT                   DIVEASFTEQESGFPDEDEFNDGYDNYDSYDNRMGDDNFDSNERRWR"
FT   gene            473376..474074
FT                   /gene="rpiA"
FT                   /locus_tag="FSU_0417"
FT   CDS_pept        473376..474074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="FSU_0417"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25681"
FT                   /db_xref="GOA:D9S606"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9S606"
FT                   /protein_id="ADL25681.1"
FT                   /translation="MALMASMDELKKAAGVRAADMIKDGMIVGLGTGSTAAHMVNRLAE
FT                   RIKTEGIHVTGVSTSWSTTLQCRSLGIPLKEMGEVSHLDMVIDGADEIDPNRNLIKGRG
FT                   AAHLLEKIVASMTDNYVIIADSGKAVQQLGTKFAVPLEIIPGAIAVVTERVKKLGGEVK
FT                   VRMGAPGKDGPVISDSGNLIADAKFAPIADPDKLARDLEHIVGIVGHGLFINMATKVIL
FT                   ADEAKGLIEF"
FT   gene            474213..475067
FT                   /locus_tag="FSU_0418"
FT   CDS_pept        474213..475067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0418"
FT                   /product="GDXG family protein"
FT                   /note="identified by similarity to SP:P18773; match to
FT                   protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27358"
FT                   /db_xref="GOA:C9RIZ6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ6"
FT                   /protein_id="ADL27358.1"
FT                   /translation="MKFAKIFLPCLLLALVAIVSLVSVDKRPVKEYQIKGMHVYEMAAA
FT                   DETKPVILYLHGGGYRQGITPSHWKILSEISKATGCGFVMPDYPLLPEHTALEAHTLVL
FT                   KLYSELLKRFPASKIIIMGDSAGGGFSLALAEEILEQSLPSPMHLILISPWVDITGGDE
FT                   SIAEYDNWLHIDELHQFGLSWANGMDAHAPMVSPIYGNMQGLPPTDIFVGTWEIFYPDI
FT                   INCSEKMKAAGVSVTLHVGEELGHVFPLYPAPEGEEARQTIADIVKSSTERTTALSLTS
FT                   LMQ"
FT   gene            475105..476424
FT                   /locus_tag="FSU_0419"
FT   CDS_pept        475105..476424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC95865.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26537"
FT                   /db_xref="GOA:C9RIZ7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ7"
FT                   /protein_id="ADL26537.1"
FT                   /translation="METESKLQPKVQPKFQLPKKNYTKAIIVAVIVVIALILLKCNIGY
FT                   NSATQLLVKQSPFGTLSCIDHAGFYFKGFASIYSYDRTKDFYFNSSTDKVKGEGWEGGD
FT                   DDEDDISVTLSRNANAEISGYLKYQLPTDCEDLVKIHREQRSDKKLKHDLVRNSVLSAV
FT                   RKTAPLFTAEEAKVTKIAEFRRIAEDQLTEGEYLTTIEVLTEKAGEDDYDSEGKIIKKA
FT                   ETQEYKVTKLKLDKNGNRILTKPSALRLYGIRVVQFEIQNVRLDQKAQQQLDIVKDREM
FT                   KRVSNATAAETAKQAAITAEAEGKARIAQAKADQEVEKIKAVTQAEKERDVAVLQAQKE
FT                   QEVARLEALRALEVAKKIKAEKEAEAAANRALVSAGLTPQERAEWDYKTKVGVAEALAK
FT                   SAHPLVPEIMMTGDSKGGASTAMDAVGLNMLMGLTEKLSK"
FT   gene            complement(476556..477209)
FT                   /locus_tag="FSU_0420"
FT   CDS_pept        complement(476556..477209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25947"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ8"
FT                   /protein_id="ADL25947.1"
FT                   /translation="MVDNFKIIRSMLKFESPGDCYYVQLLRRQSDDPKIGGVPDPAYHG
FT                   NMHSRSIKDYFISSLAHFDDVEKEIKTICEVFNVRAYIRLNKRTFKDISMIIFKHITEE
FT                   ICSGETFAPPLHLVARAAGRANAAGKSKTWIVDVDAEFVPYKQAVREMIEKCEPFQSAN
FT                   DIVEIQTKNGFHLIAKPFNTSRMDELWQSFCSENNINLPRFDIHKDNPTILYVK"
FT   gene            complement(477202..477951)
FT                   /locus_tag="FSU_0421"
FT   CDS_pept        complement(477202..477951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0421"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAO35282.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25666"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C9RIZ9"
FT                   /protein_id="ADL25666.1"
FT                   /translation="MQNNFRQIENILSSSNPIAEIQLHKDEFFEFIDRYMVGCEHKNFH
FT                   SEGDVWEHTKLVIQNVVAEEHDWMDVLVALLHDVGKKDALQRNNGKNMQGHEIEGARIA
FT                   LEWLVKMNFDRKIREQVLWLICNHMKALDLKVMRSKYDIWQLVKHPLFGRLRHLACADC
FT                   KATLDAEGKPHDDFEEILKRPIVAECLENEMPVAIVEADDFASQKWDDIRVENALVFCH
FT                   KMQINGGVLSKESLIRAAIKTIGGSNG"
FT   gene            complement(478020..479300)
FT                   /locus_tag="FSU_0422"
FT   CDS_pept        complement(478020..479300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26432"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ00"
FT                   /protein_id="ADL26432.1"
FT                   /translation="MAAKIIVRNKHELQNIIIQTINQEGDKCSLNFIDVSNVTDMSYLF
FT                   MNLSFKGDISQWDVSKVTNMRGMFWEADFNADISNWDVSHVTDMKDMFLYSSFNGNISN
FT                   WDISNVTNMRGMFWKCDFNGDISHWNVSNVKDMGYMFFKSQFIGDISCWNVSNVEDMSH
FT                   MFEDSAFNDDLSRWNVSNVKKMSEMFSCSPFNGDISNWDVSHVTDMSGMFSGTTFNTSI
FT                   SNWDVSNVQNMYAMFCGSCFNGDISNWNVSRVTNMRRMFYKSKFDGDISQWNVANVTNM
FT                   FEMFCGSYFDGNLSSWDVSHVTDMSKMFQDSKFTGDISQWNVGNVTNMAEMFSGSCFDG
FT                   DLSSWNVSHVTDMSGMFSNSKFNGDISRWNVANVTNMVEMFSGSCFDGDLSSWDIASLE
FT                   YNIDMFKNSKFTGDISHWDVPNEYDEW"
FT   gene            479409..480725
FT                   /locus_tag="FSU_0423"
FT   CDS_pept        479409..480725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24867"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ01"
FT                   /protein_id="ADL24867.1"
FT                   /translation="MIERIQDLSEVIAGQGSYPRKPFLSCQNISYDELVAILDDAPESH
FT                   SANFIFQPKNLTFAFPYNRGKQWLREIKDILLLNSAEVGQSLFPKLYRFVKGSEVKIRG
FT                   KIFIKTKCANRFSLEELTEISRKILSNYIILPQKFCSLDISCKRNEDITVEIGRIQIPN
FT                   YSGIGFYIHFSLSCQLHRVQTAKPLEYFSEMHEIRIGGFGHNTCGRNGIFFVLVQLFEY
FT                   GNTLTEIPKDIENSLLGSENPCENYWSKFHKQYIATDFLPAFIKQKSKIFSARQSNETS
FT                   TSGDFIYHDKFGYGQILKKYEEKGDKRIDVLFSDTITRTLILKYANEHLKFTTNQYHNQ
FT                   EFNEDVHISSENPIYVNCTFNNGVFIEGNVYPIFISCSFYGYDSAGVQLLNGSQGFFYN
FT                   CRFNHTFPYISPNMKNCSFEPNATKDEFRIGGCNIDTNK"
FT   gene            480839..481120
FT                   /locus_tag="FSU_0424"
FT   CDS_pept        480839..481120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0424"
FT                   /product="RelB antitoxin family protein"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26490"
FT                   /db_xref="GOA:C9RJ02"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ02"
FT                   /protein_id="ADL26490.1"
FT                   /translation="MAQATVSARIDSKDKERFDEFCNNVGLSASAAINMFIKSVINEHR
FT                   IPFEVREPIARYNAKANDIEALKKGIEQLNAGKGIVKTLEELEAMENG"
FT   gene            481113..481379
FT                   /locus_tag="FSU_0425"
FT   CDS_pept        481113..481379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0425"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="identified by similarity to GB:AAO52832.1; match to
FT                   protein family HMM PF06769; match to protein family HMM
FT                   TIGR02116"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24657"
FT                   /db_xref="GOA:C9RJ03"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ03"
FT                   /protein_id="ADL24657.1"
FT                   /translation="MAKIAFSEQAWQEYLYWQLQDKKTLKRVNQLLKDIERNHFEGLGK
FT                   PEALKGNLSGFWSRRIDDGNRLIYRINGEFIDILSCKGHYENV"
FT   gene            complement(481437..482066)
FT                   /locus_tag="FSU_0426"
FT   CDS_pept        complement(481437..482066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25296"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ04"
FT                   /protein_id="ADL25296.1"
FT                   /translation="MEIIALALSLLAVILCIVILVKVNKLLTMLRTPIFKKLTPDMNLK
FT                   PSARRPISAQEMAQRGGNNKENRQNKERPNNNNKDNRNQQQAQAHAPATRDRNEQQQRP
FT                   ERGPRRERRPERPHREANAEAPVAAAEQAAPVAPAAEAPVAEARRPLAPRIPVETPAAP
FT                   AVEAAPVAPVAEAPAEAAAETAFDPSKVRYGRRNVIKKAPELSEEA"
FT   gene            complement(482360..482578)
FT                   /locus_tag="FSU_0427"
FT   CDS_pept        complement(482360..482578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0427"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24721"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ05"
FT                   /protein_id="ADL24721.1"
FT                   /translation="MFKKSLILSSLVCISMFGFSGCSNQEAEYKIATLTEENARLARQV
FT                   LVLKATLDSLNAHNKAVDHSLKSLDMK"
FT   gene            482611..482958
FT                   /locus_tag="FSU_0428"
FT   CDS_pept        482611..482958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25713"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ06"
FT                   /protein_id="ADL25713.1"
FT                   /translation="MTVGQKWLKFKQDGYCGSLTIRSRSEQSFESDTGYNDKHIHNAVL
FT                   EMDPEYTYVKVIHEGYKGSQDIPTIELGNDAAQNQDTLDNAILDGLAHLRIFREANTGA
FT                   IVQFGYNLDEV"
FT   gene            482976..485570
FT                   /locus_tag="FSU_0429"
FT   CDS_pept        482976..485570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0429"
FT                   /product="peptidase, U32 family"
FT                   /note="identified by match to protein family HMM PF01136"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24897"
FT                   /db_xref="GOA:D9S618"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:D9S618"
FT                   /protein_id="ADL24897.1"
FT                   /translation="MNNPELLLPVGTRDMLESAINNGADAVYYGVPHWNARGRTEDFSF
FT                   EDVEEMIRYARLRGVKTYLAMNILIFEREIQELPEFLERLIALKPDAFIIQDIGLARLI
FT                   KAISPEQEIHASTQMTLASSEAVNLVKDIGFSRAVLARELSTKQIAQIKSLTDLELEVF
FT                   IHGALCVSYSGQCLTSENFGGRSANRGQCAQSCRLPYRIFVDGKEWKDPKARYLFSTRD
FT                   LCALPKLEELREIGVESLKVERRLKSPEYVAAVSHAYRKALEILSEKGYKENAECANGN
FT                   AAELTAQDLEPLEVLFSRGLNTGWLDGVNHQELVDGSFSNHHGEFIGTVVQVDRNGVIV
FT                   ELEDKPVPCTLLPGDGILFEEYRAEPEPRQTGSRLYKATFANRAGKSQVRLEFGREFNL
FT                   RKVSYGMKAYRNDSPALEKELHKTFTDKSFAKHIPVCMTLEGKIGEPLKLTICESTKAV
FT                   ADETRTVTVEGAILEASRNEVAPDALQAIAKKELSGLSATAYILDKLEIKLPANAFLPG
FT                   KVLRTLRQEAVQAFDEKRLQWKELAPSADNGRAFLHSVASSTSMVAGNPDKATGTPKNR
FT                   RTITVLVRRPEQIDALQGLDIDKVIMDFDWGVKYDEPLERIHKLGFEAGIATLRIHKPS
FT                   ENHYIKQILTLMPEFALVRNLGSLALLKDSGIPMVGDYSLNATNSASYDWLLAQGLEKL
FT                   HPSWDLNSTQLFDLLKNIDGSKLELALHQYMPAFHSEYCAFARALTTGRRFPECKKICT
FT                   QHKVEILDHKGERHFLQSDAECRNTLFVGKPQSALKLLPRLIAQNVSSYRLELLDEEPE
FT                   SVRRKIDIYTQAIRGKLDIDTAISKAGVEEKYGLSEGQLFNQSVWQDRKKGC"
FT   gene            complement(485573..485917)
FT                   /locus_tag="FSU_0430"
FT   CDS_pept        complement(485573..485917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0430"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:CAE18578.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27411"
FT                   /db_xref="GOA:C9RJ08"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ08"
FT                   /protein_id="ADL27411.1"
FT                   /translation="MKKNFPFTLRVLVFFIAYLLFAVVAIAIGVTFKFGYAEAALWLYL
FT                   PLAVPMLYLLVAVFVIELIRMFWNKRNTPNSEVEWRQMHYNAIVVKVLNTVAVVFFTLV
FT                   VAFTVVCSFK"
FT   gene            complement(485918..486961)
FT                   /locus_tag="FSU_0431"
FT   CDS_pept        complement(485918..486961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0431"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26731"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ09"
FT                   /protein_id="ADL26731.1"
FT                   /translation="MLSRLDNRTELCSYRRKTKEKSLVSRLSSLVLVFLLALPLHAADD
FT                   FFFKANELYDQGRYKESVKYYRAAIDDGRYEPFAWFNLGNALVQLGKKEVAMVAYKRTV
FT                   ELLPDFVKAWMLLGDLYYLAESPSDAIVAYNRAIELGTETDHIHFALAECYMKGSDWTL
FT                   AQKHFERALALNPDRMDAWYGLAEVYEKLGDYEYAVKTLKNALQMTATAGADVHYTLSY
FT                   YYRSMDSTRLALNEMENGVMMDPENVSARRYLAQMYVKNESPWMAIFTLEEGLRHKKGI
FT                   ADLNLDLGQIYFTQKRYDEAFECYMKAWRAGNSQGRIGAENVGHIFSNAGDTEKAETLY
FT                   ARIRDKK"
FT   gene            complement(486951..487592)
FT                   /locus_tag="FSU_0432"
FT   CDS_pept        complement(486951..487592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0432"
FT                   /product="TonB family protein"
FT                   /note="identified by match to protein family HMM PF03544;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26102"
FT                   /db_xref="GOA:C9RJ10"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ10"
FT                   /protein_id="ADL26102.1"
FT                   /translation="MLDFCAKYFRFPVAFVLSFVVGAVFFLAIPVINVLFFDKGVKSEK
FT                   VLEEVTEVEVLVSEKKPEVKQKVIRTVATPNTFKVSAHMGVSRSQNFQMDLSLARGAAG
FT                   DGVAVDAGSMENVIYEAGEVDEQAQVLREIQPKFPERAKKMGVSGYVKVFIVIDVNGDV
FT                   AQAQVLTQDPAGYGFDIEALKAIRQWKFSPAQLRGFPVAQKATKEFRFVK"
FT   gene            complement(487604..488008)
FT                   /locus_tag="FSU_0433"
FT   CDS_pept        complement(487604..488008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0433"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by similarity to SP:Q9ZHV9; match to
FT                   protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26132"
FT                   /db_xref="GOA:C9RJ11"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ11"
FT                   /protein_id="ADL26132.1"
FT                   /translation="MSFIRKRSRSGGGIDVSPMLDMVFILLIFFIVTSTFTRETGVDVT
FT                   KPKASTAKELAKESILIGVTRQGTIHINETQVNLSTLQTVLRQMMAEAPDRPVIIVSDR
FT                   DAPNGVVVDILDECNLAKVRKVSISANKEE"
FT   gene            complement(488005..488607)
FT                   /locus_tag="FSU_0434"
FT   CDS_pept        complement(488005..488607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0434"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by similarity to OMNI:VC1547; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24883"
FT                   /db_xref="GOA:D9S623"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D9S623"
FT                   /protein_id="ADL24883.1"
FT                   /translation="MSILLRGGWVLLPLFLIGWLGWFLMFERYGYYFMLKGTSTSKFFK
FT                   DLDTVGEEAAFAKLRKRRFGYFLALVENVRKYRNDGPVAVRNAMLATRHELDVSLSKSL
FT                   KTIVTCASIAPLLGLLGTVSGMVHTFETIKQFGFGNPVLLADGISEALLTTQAGLLVAF
FT                   PLMLVYNYLESRVDSIGDFAWGEALKFEERCFAKEVE"
FT   gene            complement(488637..490205)
FT                   /locus_tag="FSU_0435"
FT   CDS_pept        complement(488637..490205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0435"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27342"
FT                   /db_xref="GOA:C9RJ13"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ13"
FT                   /protein_id="ADL27342.1"
FT                   /translation="MFRRKNGASPLQTKDERVSSSSGFLRRLSLVSRLSPLVLVLLLAP
FT                   ASNAQQNTTVDAVKKRAELNSAKADLEEARRKRDMAVAARWKDRETFNKERELFNEKYQ
FT                   LGKERVDALMSERTRLLEDVRVAREDLAQVKLQAEKARAEYLSLAAGPERLEMLAKFQE
FT                   QGVPFKVADRVEAQNKVKKEMGLYRDDPLRIARAMLDVAKKEMKFTREVRTEKADLMFG
FT                   SSVAEGDRMRLGGLFAMQMAKVTDINGFHPSALMLPVAGEKKRVYSWQENLSPETRKDV
FT                   AKAFAGANDSAFVMVPVDVLLSTELSSELANHQETTWKEDFAEFFHNGGILMYPIATLF
FT                   ILGLIIFLVRLVWLLVLGFGGRGARNAVKALANRDLRLATAESQSAHGEVGKVLRSVLG
FT                   KNFKDRASAEKSLEVLFAGEVPKLEMGLSWISVFASTAPLLGLLGTVMGMIELFNVITM
FT                   HGTSDPKLLAGGISIALVTTEAGLIVAIPLQLLHTLLVNISDSVRTRMEKTGLAVLNAI
FT                   WIKEK"
FT   gene            complement(490205..490969)
FT                   /locus_tag="FSU_0436"
FT   CDS_pept        complement(490205..490969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC58430.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26326"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6F4"
FT                   /protein_id="ADL26326.1"
FT                   /translation="MLCLGLSGVFAVAQETVESVRRQIKTVEAETAREKSMHEAEKKRH
FT                   AEFVEVGRKKVQNLSAQNKSLKAEIDSLKVELKKISAARSKTNGSIRYFENRKTKYADS
FT                   LATVIDSLVPFFESDFPYRTDEAVKNILEIASMLHKGLIETDDALNRTMEVFYDRIRLG
FT                   YTTEVWKGFLQVDARNVAGTYLRYGAVASIFVSNDGNDVLFLTRNGLGYSWKNVSEDLT
FT                   MRTVLKDVMKVAEGKTAPRLVTIPVSFPKEAN"
FT   gene            complement(491093..492058)
FT                   /locus_tag="FSU_0438"
FT   CDS_pept        complement(491093..492058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0438"
FT                   /product="putative pseudouridine synthase, RluD family"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25910"
FT                   /db_xref="GOA:C9RJ15"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ15"
FT                   /protein_id="ADL25910.1"
FT                   /translation="MGKAPSDMFFESEVRLEYEGRLLLDSLCDRFTYHSREDWIDRLTR
FT                   GLVTINGATANVETVAHRGDKVVYHVENYSEPEVPTDFETVFEDDEFILVAKPAGVPVH
FT                   HTGRIFYNTFAAIIRREFDSETATPMHRLDRDTGGLILFARYGETAARFQKNLDRILLR
FT                   KFYLAVVRGKFPEGEVECHMPLREDPEDPIRLRMHHREGGKECFTRFKLVRHLDCPEIA
FT                   PELSLVEAELITGRKHQIRAHLAEMGYPIVGDRLYYRDGEFYQKLAQGGELTDEDIKVL
FT                   GAHNQMLFAYKVELQLPYWKEPRTFESHAYPADMAKLLAE"
FT   gene            complement(492060..492689)
FT                   /locus_tag="FSU_0439"
FT   CDS_pept        complement(492060..492689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0439"
FT                   /product="putative nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25109"
FT                   /db_xref="GOA:D9S6F6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6F6"
FT                   /protein_id="ADL25109.1"
FT                   /translation="MKNVAVLGGAFDPVHKDHMRVARTCLDRGFCDEVWFMPSPDRWDK
FT                   QLNTSPEDRFAMLELAFSGDKRLFLSDLEIQQGDYRGSYVFLMSLKEKFPEINFRLLTG
FT                   ADTYEGIPHWRDPLNFYGTNYNGHLLLRDIELIVFARNGYPQPDMEQHKRNGYAPLYWL
FT                   GPEQGFNGVYSSTAIRRSLLLNRSVCPQGLEPSVYDYIIKHDLYRE"
FT   gene            complement(492715..493374)
FT                   /locus_tag="FSU_0440"
FT   CDS_pept        complement(492715..493374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25955"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6F7"
FT                   /protein_id="ADL25955.1"
FT                   /translation="MPLHWFWCYNMKFSMNFVKRIVLSLAFVLAGATSSLAQGFSGSSP
FT                   AVSSPFGGASAGAGTSMRWPLFLGGTFGLGSGAGVGDGNGVGICQIKPMIGAWMPGLAF
FT                   VRLGYGFSSYEEKDDEGRKSEVESSDLSIDLGVHLLSEFFVKGSYSRVNALSEKGDVAW
FT                   NEWSAGFGTFWIVFSRTFLTLDIGYHWVLEHYDPLIDRDVSGGRWQMNLGFSVFVY"
FT   gene            complement(493346..493756)
FT                   /locus_tag="FSU_0441"
FT   CDS_pept        complement(493346..493756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25150"
FT                   /db_xref="GOA:C9RJ18"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ18"
FT                   /protein_id="ADL25150.1"
FT                   /translation="MSDYVVKIALIASIILMGYNISEFVASYNVVSEKASQFLQMAKDN
FT                   AASDADLRRSNLLLSSVLSIGYSVLIYFSDIVIWLVAIVVSKLIITLLLSDKVLIQILH
FT                   DRTLSQKSFLVSKYDAFFNAVMGLAFALVLVL"
FT   gene            complement(493761..494993)
FT                   /pseudo
FT                   /locus_tag="FSU_0442"
FT                   /note="putative ribosome-associated GTPase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF03193; match to protein family HMM TIGR00157"
FT   gene            495450..496415
FT                   /locus_tag="FSU_0444"
FT   CDS_pept        495450..496415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0444"
FT                   /product="prenyltransferase, UbiA family"
FT                   /note="identified by match to protein family HMM PF01040"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26866"
FT                   /db_xref="GOA:C9RJ21"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ21"
FT                   /protein_id="ADL26866.1"
FT                   /translation="MISTLFTLFKMSRPVNIVIATITLLVGYTLLQHNPTTPVLILQII
FT                   GFSAAIGFANIQNDILDLESDKLNRPERPLVTGEVSVKTAKITWIILMIVTLLCGIGDS
FT                   TIQIVKFINIVKDWDHALDFGWMGALILAFPMLFFAFLVFLLIGYNHYLKRSPAFKNIT
FT                   VAFLCTTPLLYAVQHFFNFANHDYPEEHMWTIIPAIPFAFLLTIAREIYKDLEDKNGDL
FT                   QAGIMTFPIIAGDKVARRLAGDIIIFTWISLPVPVFFLDKLFDHNYPPLFLALTALTLT
FT                   PTFAIVMVSASSQNYRRAQTFTKFAMFLGLITLLICSVVQ"
FT   gene            496640..498025
FT                   /gene="purF"
FT                   /locus_tag="FSU_0445"
FT   CDS_pept        496640..498025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="FSU_0445"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by similarity to SP:P00497; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   PF00310; match to protein family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25346"
FT                   /db_xref="GOA:C9RJ22"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ22"
FT                   /protein_id="ADL25346.1"
FT                   /translation="MLDELHEECGVIGIYNGDAVVRNITMGLYALQHRGQESAGFAISD
FT                   GDKIRVRKSMGLVSTLLREHNIDEFDGFAGIGHVRYSTTGASTLANAQPILVSCKWGQI
FT                   AVAHNGNITNANELRAEMEADGHIFQTTSDSEILLHEIARTQADDLGEAIKKAITKFTG
FT                   SFCLVFISKDSMYVARDGFGFRPLSIARMGKAWCVASETCAFDLLGANYVRDIQPGEFL
FT                   TITKNGLHSERFTQKDRLAHCIFEYIYFSRPDSKIFEQSCDKIRRKMGKQLAKECPVDA
FT                   DIVISVPDSATTAALGYAQASGIRFEIGLLRNHYVGRTFIDPTQNVREQKVKLKFNPIV
FT                   GVLKNKRVCVVEDSIVRGTTLKILSKMLRDAGALEVHIRIASPPVAHPCFFGMDFPSQG
FT                   ELAASSMTPNEIAQMLGVESLGYLSVEGMKECTGEGENYCAACFDNDYPDYIGTDAQKT
FT                   RCG"
FT   gene            complement(498142..499062)
FT                   /locus_tag="FSU_0446"
FT   CDS_pept        complement(498142..499062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0446"
FT                   /product="oxidoreductase domain protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25748"
FT                   /db_xref="GOA:C9RJ23"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ23"
FT                   /protein_id="ADL25748.1"
FT                   /translation="MRVFVTGGTGFIGHYVVKALLDRGHEVVVATRHPNKVPTLRANPN
FT                   VSFVEAALTDFEKMGEGLVGCDACIHVALGWGDTPSAMLMNDTRATIALLEMAARAGCD
FT                   KFIYTSSTSAMGRVRSEMHEMTSNLPIDLYGATKAAGEAFVLGFSHGYGSQFPEVKMKR
FT                   NIIRPGYTFGNPAFPDGCSQPDRRFFEMAYAVKEDRDINIIKNDGTQFIHASQQAQIYM
FT                   KLLESDLNEEIFLGLGSEWISWKEIAEKMIALKPGCKSKIVETDMGWGDEPMLYSVQKI
FT                   KDSFDLAFDAHEFLDEHIRWTFENA"
FT   gene            499176..500210
FT                   /gene="ddlA"
FT                   /locus_tag="FSU_0447"
FT   CDS_pept        499176..500210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="FSU_0447"
FT                   /product="D-alanyl D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by similarity to SP:P96612; match to
FT                   protein family HMM PF01071; match to protein family HMM
FT                   PF01820; match to protein family HMM PF02222; match to
FT                   protein family HMM PF02655; match to protein family HMM
FT                   PF07478; match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26573"
FT                   /db_xref="GOA:C9RJ24"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ24"
FT                   /protein_id="ADL26573.1"
FT                   /translation="MSRLRVLVLMGGPSTEHDVSVVSGTGVVRAMDPEKYNIHPVLIDK
FT                   DGTWHWSSRELSPYQKANFSENYFHSLEGTAANKKKSPALSELPSADIAFLALHGKWGE
FT                   DGHIQAMLENWNIPYTGCGLLASALAMDKIKSKEIYRANGIPTPPYRVIWKHDFTGDTL
FT                   VSVADELGYPLVIKDPLGGSSIGIGIAKNLDEAGKIAQDLFKDSNRLLCEKFIAGGEAS
FT                   CGYIEGEKPLPPTEMRMTTREYFDFEAKYNGECQEVTPAEFAPELTARIQELVKNAHYA
FT                   LGGAGYSRTDVRITKDGELFAIETNTLPGMTPTSLLPQQAACVGITYSQLIDLIIDKSL
FT                   EIKR"
FT   gene            500335..500964
FT                   /locus_tag="FSU_0448"
FT   CDS_pept        500335..500964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0448"
FT                   /product="peptidase, M22 family"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR03725"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24858"
FT                   /db_xref="GOA:D9S6G3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6G3"
FT                   /protein_id="ADL24858.1"
FT                   /translation="MNYNLIVDTSRKGISMALSADSVYEEMVDPSAKGEILSASLDNLL
FT                   AKVGATLDDVKRVMVTVGPGSFSGLRTGVAFCQGLCFSGKRNLYGVTTLQALACFAGVP
FT                   DESVAVVIRARNGFWYLRLNNEESFIETADVVARLQASSVKNAVVDAAALTDEALVAVF
FT                   KDKGIATTLDTDKKLNMWSPLFDTVKPSLIQEANYIQPSYFEKLKV"
FT   gene            500970..501398
FT                   /gene="rimI"
FT                   /locus_tag="FSU_0449"
FT   CDS_pept        500970..501398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="FSU_0449"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by similarity to SP:P09453; match to
FT                   protein family HMM PF00583; match to protein family HMM
FT                   TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25675"
FT                   /db_xref="GOA:C9RJ26"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ26"
FT                   /protein_id="ADL25675.1"
FT                   /translation="MLLREMTENDLPQVLELQRELAFQDWNEKQFLSEIRASYAYCVVC
FT                   EDEAKLLGYAIFHLLGPDSELLSIATRASEQRKGIGSQLLKAGLDKLTENGDQCFLEVR
FT                   DGNAKARAFYEKHGFKLYSVRKKYYSDGEDAALYKFCR"
FT   gene            complement(502456..504123)
FT                   /locus_tag="FSU_0451"
FT   CDS_pept        complement(502456..504123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0451"
FT                   /product="cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by similarity to GB:AAA68129.1; match to
FT                   protein family HMM PF00759"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25229"
FT                   /db_xref="GOA:C9RJ28"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ28"
FT                   /protein_id="ADL25229.1"
FT                   /translation="MNAKIHYCHPGYVPSGAKSFLVAFSEGSSLPSVKFNILDSENRVV
FT                   YEGLAENLQRCEYTGETLFKGDFSAVKTPGRYQIALVDFDAKSHLFEVSDEWVLRELKS
FT                   NIKSFYYQRSGVELPERLAGIWARPAAHLDDKLEFHPTMERAGLWNAHGGWYDAGDYGK
FT                   YIVNGGVSVATLMLGCELMQVHSQKSSIVGGADFKESYELPVSLLDEVRFELEFFLRMQ
FT                   DDDGGVFFKVTPYRWDGFVTPTESDASQKRYILGKSTSSTLNFVGALAQAHHVYANVDS
FT                   EFAEKCLFAAVRAYLWSEKNPEVDWPHNTEGSGGYGDSDLGDDFFWARAMLYRELKNVE
FT                   SIADVNVAGLLERLESQLPVDMDTYLPTYGLQWRSTQNLAWFALATMDCKWTERARMAF
FT                   KYTAEEILHLQKEDPYGLSICKFIWGSNGDIANHALTLYLAYEWFNDSKYRDAAMEQIE
FT                   FIYGKNPVDVSFVTGSAWSSPKFPHHRISHSDGVDEPVPGLVVGGINEDRQDLHRKPHY
FT                   MGEARGMSYADEQCSFASNEVAINWSAPLTAALLLLSA"
FT   gene            504232..506571
FT                   /locus_tag="FSU_0452"
FT   CDS_pept        504232..506571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0452"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25631"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ29"
FT                   /protein_id="ADL25631.1"
FT                   /translation="MKKPLKITLIVLGSLILLYFVTLLVAPKIARSYIEEHSKEMIGRS
FT                   ITIKNISLNPFTYVLDVDTLAVMEADDKTRFVAFDKFSMNINPLKLFTRTLDISDIYMK
FT                   ALYVRTTQHGERFNFSDILDFLAQKDSIYYAEHPEEKKVESDSSKSAAEIAAGLPVKLS
FT                   LRNIVFDKGNIIYQDTKVGSKFHLKDFSINIPAIYLEDNSTGVDVSLKFADGGDLNVKV
FT                   DANMATYDFNIFLNLNRFALSCIKPYLNDSINYKDFAGYLSAQISISGNINSILASNVK
FT                   GKVSLDKIDLTEVSGSKMGAENVTVGINKANLVDNEYLIDSVIVDGAFAHIDLYKDGKT
FT                   NIDVLLTPKNKAGSVTDTTAADSTQVEPVAEAAKQEPADTTKVVADSTSATTTAEKPAA
FT                   AKKLKAKINKLLVKNTYITITDHTIIRPFNYKVSAITVTGQNINYDTPCNVNVSAAFPE
FT                   GGSLSLKYHGALSNLNTMDIYISVKNLVLKHFSNYSLHYTAYPLKAGTLAFASENKIVD
FT                   RNLDSKNTIDIYNITVGNKVDDIDPEYTVPMKIGLYILKDKDDKIQFDVPVKGNLDDPE
FT                   FSYGKIIWKTVVNLLVKVAISPFRLVGNLAMAGANALGFDLGKNNEVLIDANTETFTSE
FT                   QYAKAIKMTEMLQKDPKLMLTFTQYYNPRKTAKEYKVKQLKIDFYKQKNNKTELNELDY
FT                   RAIEEIKEKDKEFQAYVKEHSAEIDKNYMMKVLPQMATKRNNDLLKVLRAQPGVTKKNL
FT                   KVITAPRDALRGYKDKPMYKVDVDVQ"
FT   gene            complement(506697..507617)
FT                   /locus_tag="FSU_0453"
FT   CDS_pept        complement(506697..507617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0453"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by similarity to PIR:T48866; match to
FT                   protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25142"
FT                   /db_xref="GOA:C9RJ30"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ30"
FT                   /protein_id="ADL25142.1"
FT                   /translation="MKIVLPVAGNGIRLRPYTENLPKCLLPVAGKTILDWIVDDALFLN
FT                   PSETIFITGYKASAVDDFLKQKPEWGAVRTVVQSNPQGLGEAISLALPYVNDDEPLLII
FT                   LGDTLFEADLSILKNASENILYTFKVADPKRFGVAVTDKNGHIERLVEKPQEFVSDEAI
FT                   VGIYYIKDVKALKEALNYLMQNDIRTKGEFQLTDALERMIQGGCKFRTAPVEKWLDCGL
FT                   VETLLATNAHVLNRNATTESPVDGAEIIMPCHIGKNVVIKNSKVGPNVSVGDNCVIENS
FT                   EVSDAILWNGVKVVNQKLADAVIHE"
FT   gene            complement(507705..507821)
FT                   /locus_tag="FSU_0454"
FT   CDS_pept        complement(507705..507821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25732"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6G8"
FT                   /protein_id="ADL25732.1"
FT                   /translation="MFAVKCRYYRECLKMKLLRGFTDGLKFENRMVLKRFQK"
FT   gene            508011..508292
FT                   /gene="groES"
FT                   /locus_tag="FSU_0455"
FT   CDS_pept        508011..508292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="FSU_0455"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="identified by similarity to SP:P28599; match to
FT                   protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26051"
FT                   /db_xref="GOA:C9RJ31"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ31"
FT                   /protein_id="ADL26051.1"
FT                   /translation="MIKPLADRIVVKPAEAEQKTSSGLFIPDNAKEKPMQGKVVAVGPG
FT                   RKNDKGEVVAMEVKVGDVVLYGKYSGTEVTVDGENFLIVKESDVIATL"
FT   gene            508428..510062
FT                   /gene="groEL"
FT                   /locus_tag="FSU_0456"
FT   CDS_pept        508428..510062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="FSU_0456"
FT                   /product="chaperonin, 60 kDa"
FT                   /note="identified by similarity to SP:P20110; match to
FT                   protein family HMM PF00118; match to protein family HMM
FT                   TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24559"
FT                   /db_xref="GOA:C9RJ32"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ32"
FT                   /protein_id="ADL24559.1"
FT                   /translation="MAKQLKFDVAARESLMKGVDKLANAVKVTLGPKGRNVMIARSFGA
FT                   PNVTKDGVSVAKEVELEDAYENLGAQMAKEVANKTSDAAGDGTTTATVLAQAITREGLK
FT                   NVAAGANPMDIKRGMDAAVEAVIKEVGKMAVKINGKEHIAQVATISANNDPEIGELLAN
FT                   AMEKVGNDGVITIEESKTAETVLDVVEGMQFDRGYLSPYFVTNTDSMEVALENPYILLY
FT                   DKKISTMKDLLPMLEHVAKQGKSLLIIAEDVDGEALATLVVNKMRGTLKVAAVKAPGFG
FT                   DRRKAMLEDIAILTGGMLVSEDTGAKLEDAPVTVLGKAKSITITKDNTTIVEGAGDAAS
FT                   IKGRIAQIKKQIEATTSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKDRVDDAM
FT                   HATRAAVEEGIVPGGGVALIRAEKAIDALQFDNADQKTGAAIIRRAIEEPLRQIVQNAG
FT                   LEGSVVVNKVKEGKDGFGYNAKTDTYEDLIKAGVIDPAKVTRTALKNASSIASMILTTD
FT                   CVITEKKEPKAPAAPAMDPSMGMGGMM"
FT   gene            complement(510293..512686)
FT                   /gene="mrcA"
FT                   /locus_tag="FSU_0457"
FT   CDS_pept        complement(510293..512686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="FSU_0457"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="identified by similarity to SP:P02918; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26790"
FT                   /db_xref="GOA:C9RJ33"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ33"
FT                   /protein_id="ADL26790.1"
FT                   /translation="MDKFKSFMKILGAAIVKYGSIVWQKIWSLVKIAFANKIFRWFFIF
FT                   MCPIFVAFIAALAVYIHYSPELPSLSQLEQINPRLVTNIYDKDGQIAHEYFVERREWTS
FT                   IDSIPVNAIHAVMATEDRAFYKHWGMNVWAIPSALIESAVSGNKLRGASTLTQQLTKLL
FT                   FLTPERSLSRKIKEMMTAIRIEQTYTKEEILEFYMNEVYLAGGNYGFQAAGKFYFGKPL
FT                   DSLSIPEYAVLAGMLQRPETYRPDRHPKASKRRRNTVLYAMRDAGYITNEEYRKYIEEP
FT                   IVLAKKEDVTGTGLYFFEEIRKYMEKKYGENSLYADGVSVYSTIDPEIQAFLDSVAYAQ
FT                   VERVRRRIKYRATRRLQLTKKYDMPEDSVVAHFDSVYTLFKKEYLAADTVRNKRGQFIR
FT                   FPDSIRYHHAEVAAIIIENETGAIRAMVGGSDFNKSKWNRAVQSLRQPGSSFKPIVYST
FT                   AMDNGASPCDSVNDQPVTIPDPDDKNPNKVWRPGNFEHDFEGMMTLRRALYKSKNLPAI
FT                   LTGMKYGLSNVVNYARKFGIKRAPLQAVPSLALGSVGATLMEMTSAYTVFPNGGNRIEP
FT                   YMIESIVDRNGEVVEKNSKVEHEVLRPASAYLMVDMLKDVNVRGTAGRVWASGFRHPSG
FT                   GKTGTTNDYTDTWYIGFTKQYTMGVWVGSDNPGTMGAGHTGTEDALPIWMATMAKLHKD
FT                   LPKLPFPVPPGVISRGICNHTGLIAGEFCSEKTYCLYTAGYGPTERCDGNHFSSQTKSA
FT                   DNATLFSNKGVVENNRYEAPQPKKKKGKGKDEPQQPKRSTRKMF"
FT   gene            512954..513030
FT                   /locus_tag="FSU_0458"
FT   tRNA            512954..513030
FT                   /locus_tag="FSU_0458"
FT                   /product="tRNA-Arg"
FT   gene            complement(513178..519558)
FT                   /locus_tag="FSU_0459"
FT   CDS_pept        complement(513178..519558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25540"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6H2"
FT                   /protein_id="ADL25540.1"
FT                   /translation="MATLIASASVIATSSFAQNPASAAPAPQAAPAPVSEPAPEPAPAN
FT                   EPPQVGGIPGESILEGGTFTKFKLDNFVTDDTDQPSQIRWKVSGNKALKVNIAPDHTVE
FT                   IATPDALWNGSEDLTFTATDSKGASASETVNFSVESVNNPPVVSQIPSQVITEGQQFTK
FT                   IRLDDFVNDPDHKKNLITWDTEVVPAGGPQADGDLSVTIDANRVATIVVPDKHWYGAAR
FT                   IKFIANDPDYGSDNKTAAFTVTPVNDPPTFTKKIPDQVIDEKNQFDMISLADYVTDPDD
FT                   DPMKLKWTVTGNKDLKIEIDNYGSAIVTIPNEFWNGQERVTFTATDAAGASVKQDVLFK
FT                   VNSINDPPEFVQNIPDQTIDEKQEFAPIQLGQYVKDPDHRIEMLKWAVAGAKDLKVSVS
FT                   GGVATIRIPNKMWNGSESIKFKATDPEGASADCEAVFTVNSVNDLPKFIRPIPNQNINE
FT                   KQQFTKIKLDDFVKDEDHKNSELSWDVEVKHQGQMPELGTLNVNIDDQHVATVEIPDPS
FT                   WFGNTIATFTVTDPEGGSAKQEVALNVRSVNDPPVFKKIPDQVIEEKNEFTSFIMDDYL
FT                   SDADHDFSKLKIEVTGNKDLKVNIDNRSHEVSVKIPHDQWNGTETLMFTATDPEGARAS
FT                   TSAKFTVKAINDPPVMKDIREQTIKEKGEFQPIELDNFVEDLDHAKNRLKWTITGNKEL
FT                   KVAMDGAHVVRITPPSPQWHGAETLTFKVCDPDNACDERTANFTVESVNDVPMFVKQVM
FT                   PQTIREKGQFQPIKLADMVKDLDNKLSDLSFSVSSKPAAGSKKRESELKVNIDANKVAT
FT                   IVIPNKYWNGAEEITFTVTDPEGAKASSTALFTVESVNDLPEIKQVADQTIQEKGEFTP
FT                   FNVSELVSDPDDRFESLKIDFTGNRDLKVDMSKTGIVTVKTPNKMWNGSEKVTFTVTDP
FT                   SGAKARTTATFTVVSVNDPPVMKEIASQTVKEKESFKPIELDNFVEDLDHPKNRLKWKM
FT                   EGNKELRVAMDATHKVTVTPPNASWNGSEKIRFTVTDPDGASDSKEVTFTVLSVNDAPE
FT                   FVRDLRDQSIDEKKQFQPIKLADFVKDPDHKISDLKWTFKVNPISQGSSKKKGKDDGEE
FT                   TSASGLRVTVDPTGVATVNIPNKYWHGAANITFTATDPEGASASKTARFEVRSVNDAPV
FT                   ISSSAPTGETILEGGRFKTIDLSTLAEDPDHPASSLKWEVSGNRDLKVDIRKDNTVIVS
FT                   VPDKQWSGKESLTFSVTDPEGAYARHKMVFEVTRVNDPPTFVKRIPDQKIKEKETFKQI
FT                   KLDEFVKDPDNKPNELRWRITGAKQLKAEISPSRVLTVTAPNKDFWCAPELMMLEVSDP
FT                   DGAKTSQTITFEIVSVNDPPVLRDIPPQKIREKGTFKDIDLSKFVRDPDNTMEQLSWSV
FT                   KVKKPESEQPKKSKKGKKGKKDDDDEEEEVVKDPFSVVIYKGGLAHINIADQYWHGERN
FT                   VVFTVKDPDGATDSKTVNFVVESVNDAPVIRPILAQTIKEKEHFEPIDLLKFVSDPDHP
FT                   TSSLKFEVAPTRALKTTINAKKQLVVTTPDKYWNGSEKIRLDVTDPEGARASQQIEFEV
FT                   TPVNDPPVITKEIGNQKIKEKERFTPVDLARIVHDPDNKPNELKWSVAGNNQLVVDIKN
FT                   GRATVTTPNPNWFGKETLTFTVMDPAGDKQSAKATFEVIPVNDPPKFKPIPPQVIEEKK
FT                   TFPAIDLTKFVTDPDNSVDELKWSIDGENPFASAAPVKAKHNKKDKKKKKAKKQEEAPA
FT                   PTFSKHELKYNISEKGILTVEIPNKYWNGTETVTINVFDPSKEKASVEVRFTVKSVNDP
FT                   PIVKEIPGQTTLEGKAFKSVNLDEFVSDPDHKKNEIRWSVSGAKNIDVRINANHVAEIK
FT                   PRRDNWFGDETIIFTATDPAGGTDKSVVKFIVKHVNAAPVMRDIPDYTIRENQNEGVIA
FT                   TIKLDQYARDKDHNFEDLKWKFTGQKQLQVTYDKSKKTVIVAQPYSHWKGKPERITFTV
FT                   TDPEGATAHKTATFTVIAVNNAPETKPLSYQTREGETLKVPAATGLMSAAKDPDGDKLE
FT                   SVKTVMKPRNGRIVLNEKNGSFEYTPNKGFSGIDEFTYKVFDPSGLGSKVTNVEISVQF
FT                   KPKDVRSNSANNKKKK"
FT   gene            519993..520400
FT                   /pseudo
FT                   /locus_tag="FSU_0462"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            520404..521936
FT                   /locus_tag="FSU_0463"
FT   CDS_pept        520404..521936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0463"
FT                   /product="M23/M37 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25452"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ36"
FT                   /protein_id="ADL25452.1"
FT                   /translation="MQRKVLESLYNQGGLSLFAISDEETLPTEALHKFALALNAGARFI
FT                   VIDFTGKRPFEGNAPFQTSHLSQKLLSAEDIQKITASSTEDGCISFTGTKAIPTSDIEF
FT                   RTLYHNLKNLEKIAPQVIGIVSTEQVENVGKLVAMARLLIMHVTPLSMKSAASFIEDVK
FT                   EAQKIEILWLSKERPARRAYPKARKAISRNASATKEAFNLDFQKNPEELAKVIQKLHKV
FT                   SILVKNPLDGFPRLIRNLFPLLLIAVIIAPFLFVTDIDRSDSNLRDRIQERNQLSVAPS
FT                   FEYTFDGNESMQRIARYAIGRFDAIITNEKMIKNYVAKTLEDNGYGVTAWEKGCHNIPP
FT                   KGTTIRFSRPDEIKRPASADTIGAAWKFWTSVISDSIAYITEFYHETATATQRKHNGID
FT                   VASRQGARILAPYGAKAWTSRDERGGVIIALVRKQDVILFMHCDKLLYLNGQEVMPGDP
FT                   IATVGTTGHTTGPHAHIVTGLVSKKGKKRIGNVRYDVIDPIKWFYKFKPTSK"
FT   gene            522104..522556
FT                   /locus_tag="FSU_0464"
FT   CDS_pept        522104..522556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0464"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25842"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ37"
FT                   /protein_id="ADL25842.1"
FT                   /translation="MKHSIIGASLFIAVALITGCSSVVTPKAELAVHNDSVHDIPAIDS
FT                   LIVSMKQDYIKQCYMPVASHLPPENSCQSDLFQMVERRYHMEYNQNHVAAASNELFFKD
FT                   VVPEINKKVKREPALRDPLRRAFSNSNEMLAYYKDKYKFNTQIEQF"
FT   gene            522700..524109
FT                   /gene="leuC"
FT                   /locus_tag="FSU_0466"
FT   CDS_pept        522700..524109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="FSU_0466"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26585"
FT                   /db_xref="GOA:C9RJ38"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ38"
FT                   /protein_id="ADL26585.1"
FT                   /translation="MGKSLYQKIFESHTVAKLPSGQCQLFIGLHLCHEVTSPQAFAQLR
FT                   EEGQKVLFPERTFATVDHIIPTTFPERNRPLQDGISEEMFSHIENNTKNNGIKFFGPST
FT                   CEQGVIHIVGPEEGVTQPGMTVACGDSHTATHGAFGAIAFGIGTSQVADVLATQTLAMS
FT                   PLKTRRIKFTGKLKPGVTAKDVALAYIAKLGVNGGVGYAYEFAGPVIEEMGMEGRMTVC
FT                   NMAIEGGARVGYCNPDEKTFEYLKGRPYAPKADKWDEAVAYWKSVATDADAQFDDEVEI
FT                   NCDNLEPMVTWGITPAQAIPLNGNMPKIDEFEGSEKKVISEAYEYMGWEEGSKMIGRPI
FT                   DIAFVGSCTNGRLSDLQAAAEIIKGHKVAPTVKMWVVPGSMKIKVEAEQLGLDKIFKEA
FT                   GAEWREAGCSLCLAMNPDKLKGRQVSASSSNRNFKGRQGSPTGRTILMSPAMVAAAAIE
FT                   GKITDVRKYIK"
FT   gene            524128..524736
FT                   /gene="leuD"
FT                   /locus_tag="FSU_0467"
FT   CDS_pept        524128..524736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="FSU_0467"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by similarity to SP:P30126; match to
FT                   protein family HMM PF00694; match to protein family HMM
FT                   TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24989"
FT                   /db_xref="GOA:C9RJ39"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ39"
FT                   /protein_id="ADL24989.1"
FT                   /translation="MNSIDIVKGSGVPVRGNDIDTDRIIPARFLKCVTFEGLGANAFAD
FT                   DIAGLAAQGKVHPFRDPAYKNGSILVSNQNFGCGSSREHAPQALKRWGIRAIIAESYSE
FT                   IFFGNCVAIGVPCYKVSHEVADKILSWIEAHPSEELVTSTESRTLKMGDETIELTLADG
FT                   PRGQFLDGSWHARSALMANADKVQELAKKLPYMQFLKNA"
FT   gene            525037..525915
FT                   /locus_tag="FSU_0468"
FT   CDS_pept        525037..525915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0468"
FT                   /product="putative type II DNA modification
FT                   methyltransferase"
FT                   /note="Possibly an isoschizomer of M.AatII found in
FT                   Acetobacter aceti.; identified by match to protein family
FT                   HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26726"
FT                   /db_xref="GOA:C9RJ40"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ40"
FT                   /protein_id="ADL26726.1"
FT                   /translation="MCYKVFNEDCFDWMENQSENTITAIVTDPPYGVKEYTEKELVKKR
FT                   AGSGGIWRIPQKFDGCTRQPVPRFSVINDDPEERKNVYLFFERWARLAKKILVPGGHIF
FT                   LASTPLLSDIVGSALRSAGLEKRGEIIRSVCTLRGGDRPKNAEDEFPELSVIPKALWEP
FT                   WCLYRKPLAEKTVAENLRVWKAGALRRPAIDRPFSDFIQSEKTPKIERDIVNHPSIKPQ
FT                   SFLRQIVRAALPLGEGIVLDPFSGSGSTLAAADYLGYDSIGVEKDTEFFRQSLHAIPKL
FT                   SKLYGQTTLQI"
FT   gene            complement(526512..526748)
FT                   /locus_tag="FSU_0469"
FT   CDS_pept        complement(526512..526748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0469"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to GB:AAA96335.1; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27109"
FT                   /db_xref="GOA:C9RJ42"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ42"
FT                   /protein_id="ADL27109.1"
FT                   /translation="MSKSNKNPLLKKFGNLVHDARVKKGLSQEELGFELDLHRTYIGMI
FT                   ERAERNISFFHAIKLIQYLDINIKELYVKQKKS"
FT   gene            527004..527528
FT                   /locus_tag="FSU_0470"
FT   CDS_pept        527004..527528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0470"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25225"
FT                   /db_xref="GOA:C9RJ43"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ43"
FT                   /protein_id="ADL25225.1"
FT                   /translation="MTINRILLLLLLTFLLFSCSSEKESPKVMLTSPVDNILVEKAKRQ
FT                   MHLRSGENIVKTYKISLGKNPVGAKVKSGDNKTPEGNYTIERHNPKSIFHLSLKVSYPN
FT                   AEQIKAAKEGNYEPGGDIMIHGYPNKIPAFLFKFWHKWKDWTAGCIAVTNDEIEEIYDA
FT                   VKDGTPITILP"
FT   gene            527540..528226
FT                   /locus_tag="FSU_0471"
FT   CDS_pept        527540..528226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25231"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6I0"
FT                   /protein_id="ADL25231.1"
FT                   /translation="MFIMKKILITLFTICIAQTFAAKATPEQWIAKANGVLKEQPRISS
FT                   KYIYPGLEPSSVFEASAILDSATKEYPYRIDMWLGQVQLFGEINECGMQSKFFDKINTL
FT                   LKTKKDKCELAGGKKINKAEKLLEGEFTIVIRKYFDLEYDSCYEYMSRQMYKLLPNSVE
FT                   ALNAMSIHYMLQKNDSALALLERANKIAPTDCIVLSNLALYYKRKGNTKKEDEYKKKQD
FT                   LFCKEK"
FT   gene            528232..528660
FT                   /locus_tag="FSU_0472"
FT   CDS_pept        528232..528660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0472"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26827"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ45"
FT                   /protein_id="ADL26827.1"
FT                   /translation="MSFIKISLIFLVAATAFSCSDKQESSSNNVDTKAIEKIQTFYTNY
FT                   IFGDEFANDSVIAKYCTKNLAQELSKAYDNEFSDGGGYAVWKFRSDAQDGEDIREIEKI
FT                   EPLGDGKYLVHYNDMGNKGSHTITIVQQSGEIFFDKID"
FT   gene            528672..529109
FT                   /locus_tag="FSU_0473"
FT   CDS_pept        528672..529109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0473"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24744"
FT                   /db_xref="GOA:C9RJ46"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ46"
FT                   /protein_id="ADL24744.1"
FT                   /translation="MDIKVLRATEEWQRAGAYSVRIQAMNRAYHISLRDEFDEHDCDGT
FT                   KFIVLLDDEYPVATCRFYEIDAETATIGRVVVMPEYRGQKLGAMAVREAEKWIAECGYK
FT                   QIIIDSRLEATGFYEKLGYKHTGDKPHRWGVFDCTRMKKIF"
FT   gene            complement(529106..529960)
FT                   /locus_tag="FSU_0474"
FT   CDS_pept        complement(529106..529960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0474"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24939"
FT                   /db_xref="GOA:A7UG40"
FT                   /db_xref="UniProtKB/TrEMBL:A7UG40"
FT                   /protein_id="ADL24939.1"
FT                   /translation="MNLRYLICCLLFLTASFSFASDDEKREIRRYEFQSSQDAFLDFNR
FT                   SVRTTAFLLDEKQAEEAPIETILNFYWCWSKRDGSPFCKIEFLDEKGEPIMTSEINTHH
FT                   EKTCFGNQTDNCREGNLLEVVEEHKQQYCASLERDQFSKAKQVSLWEYPKKNGKKNDAS
FT                   EDICNKSKKNTQNLDYWTPLKKMQIQSDLNYRIDDVKSVHMYQDTETSIGWGIFGGLYG
FT                   AIFVALTSMVVEIPVSYALDEDYNWKHVGLASLVGFVGFSTWGVIRIAKNPDATRVDVT
FT                   IKF"
FT   gene            complement(529989..530618)
FT                   /locus_tag="FSU_0475"
FT   CDS_pept        complement(529989..530618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0475"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25120"
FT                   /db_xref="GOA:C9RJ48"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ48"
FT                   /protein_id="ADL25120.1"
FT                   /translation="MDNELKLLIGKDEKIIYAGKPNKKCFIFESIFNPLLPFALIWGVI
FT                   DFGFIGASLSSKDEHIGFFLVPFMLLHLMPVWIYLGGALLSFRRYQNTNYIVTDKAIYA
FT                   SGGVFSKHYNSKPFAELSHVDLHRGIFDQWFGVGDVITTSAQANPVTRNGRTTSTNAGI
FT                   SIDSISNYIEVYNIVKKLQQDVYADVMYPNDLRPRENHGYNTKYRG"
FT   gene            530786..531304
FT                   /locus_tag="FSU_0476"
FT   CDS_pept        530786..531304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27247"
FT                   /db_xref="GOA:C9RJ49"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ49"
FT                   /protein_id="ADL27247.1"
FT                   /translation="MEEQNIHSAEVQKQMRKVGLKIAFIMALLMSFGLSLTGQLMAEHP
FT                   PEMPTIAIVIGFLKCFALSFVISFVIGFFVPISKVNAALARKFHLQPHTPKAHFVESLA
FT                   SNLIYTPLITTAMVCFVYFTMMPEGHKPPFLAMFIFSQVVCLVVAQVLIMVFVPIIMKL
FT                   VLPKMPPQQ"
FT   gene            complement(531407..532006)
FT                   /gene="sodB"
FT                   /locus_tag="FSU_0477"
FT   CDS_pept        complement(531407..532006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="FSU_0477"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by similarity to SP:P09157; similarity to
FT                   SP:P19665; match to protein family HMM PF00081; match to
FT                   protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25322"
FT                   /db_xref="GOA:C9RJ50"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ50"
FT                   /protein_id="ADL25322.1"
FT                   /translation="MFEPVNGKFEMPVLPYGMADLAPALSQETMLFHFGKHLQTYVNNL
FT                   NAALPGSAFEGKSLEEIVKTSEGGVFNNAGQILNHAMYFLQFKAPTMSNVPTGEIAKLI
FT                   ERDFGSFEKFQEDFQTKGAGLFGSGWVWLSALDTGKLVITQEGNAQNPITKGLKPLLTF
FT                   DVWEHAYYIDYRNRRPDYLKSLWSIVNWDVVNERLG"
FT   gene            complement(532242..532733)
FT                   /locus_tag="FSU_0478"
FT   CDS_pept        complement(532242..532733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27367"
FT                   /db_xref="GOA:C9RJ51"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ51"
FT                   /protein_id="ADL27367.1"
FT                   /translation="MNLKNISIALTVLVFGVIAMLFMQKGNYVNQAREHYEATTNKSFK
FT                   GNSMVLDLVNNGIEMNKSTWAIACGALQTVRTSQDMARLEAKFFPATKGNMSLANKTRR
FT                   FEASSANVIVANFGKVEEDKKTGVKSLADLQSVDVSILLGNYAAAAAASDEGSDEGDEE
FT                   "
FT   gene            complement(532745..533305)
FT                   /locus_tag="FSU_0479"
FT   CDS_pept        complement(532745..533305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24914"
FT                   /db_xref="GOA:C9RJ52"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ52"
FT                   /protein_id="ADL24914.1"
FT                   /translation="MDKKKMKILVVADVVILVALIIILMTLKGGYEEQAKRTANEQESA
FT                   YLEKNTQVLVEQWRSVDQYSMAWKLVYTVLSGAKSEAAFKSALAAIESDKDARFKQISH
FT                   LYTGAGINDAVQNGIFQKAGLAEGTILLKNEKGSKEVACGKNCVVKFSYAKGKLKNVDY
FT                   SALVQYNLANSLKIEKPAEYHFE"
FT   gene            533937..534903
FT                   /pseudo
FT                   /locus_tag="FSU_0481"
FT                   /note="putative glycosyltransferase EpsI, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:1276882"
FT   gene            534900..535997
FT                   /locus_tag="FSU_0482"
FT   CDS_pept        534900..535997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25212"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ55"
FT                   /protein_id="ADL25212.1"
FT                   /translation="MIPLTFKEVVIRMARRILGEERVHDRLIERGIKLRHLQDGYSRNG
FT                   EILESCDGGESRDGGESRQTLIFMADGKWMHGGLTDRLRGMASAYKFATEHNLDFKIFH
FT                   TSPFLLQEILQPNKVDWIIDEHEISHNCEIAKPVLLYREDFNNDSALERQLDSRHKQFH
FT                   LYSCVDTVGEEFPKYFNELFKPSPLLENELAHYSELLGENYTAISFRFQNKLGDFKEFT
FT                   FKELSEKGKRKLLSAAINVLKKEMPHQVGHDNSDTALSCPPVSGHHHLVNETSKILVTA
FT                   DSPTFLAEAEKLPNVVTVKGKSIHIDFNSSKNATDYLKAFTEFFLISKASKAILYRNRK
FT                   YKTYPSNFPKYAAMLGHVPYEIVEE"
FT   gene            complement(536007..536366)
FT                   /locus_tag="FSU_0483"
FT   CDS_pept        complement(536007..536366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0483"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25467"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6J0"
FT                   /protein_id="ADL25467.1"
FT                   /translation="MTTEMHEGKPLQVSLTSSTKKAAVRVARSAGIVAKNVLKGLRSVQ
FT                   VGNQLQVSFDAPESLAGERSKVELLDVKGHVIATVSAKALSGTNAMTTKLPKLGVYILR
FT                   VRVGSQQLAQCIFVK"
FT   gene            complement(536363..537106)
FT                   /locus_tag="FSU_0484"
FT   CDS_pept        complement(536363..537106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26396"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ57"
FT                   /protein_id="ADL26396.1"
FT                   /translation="MRRSSFFFVFVALFVMSASFGVSFANAADPGDGLKFCFIEDKEGT
FT                   LDYPRLNFSQKPDTETPATGEVCFDKWYEANPTGAGTPDANTYLNNWLSAKQGAIAFVR
FT                   VTSDIKFAGRSIIGCAEGNNAFNGKMITLYSFQTLYSQIDPQTNEPYVISGLCHFGNVQ
FT                   IVAFIEKFSGTMYNMNFDDAYLNASATNSSAGIIAEGVTGLDGTRVFNGYIHDVKVSNS
FT                   EFQGTNVGAIVGKGNTDISSAELMV"
FT   gene            complement(537525..537644)
FT                   /locus_tag="FSU_0486"
FT   CDS_pept        complement(537525..537644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25155"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6J2"
FT                   /protein_id="ADL25155.1"
FT                   /translation="MYEIFFEKKHARLFFQACAKYVHNTSYVFFLEEPAVNAV"
FT   gene            537684..538445
FT                   /locus_tag="FSU_0487"
FT   CDS_pept        537684..538445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0487"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01CJ00181; match
FT                   to protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24784"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6J3"
FT                   /protein_id="ADL24784.1"
FT                   /translation="MKLPTRADDFSHKKKEYTMENNTAVFVDAENLTFWAYNNGVHDLM
FT                   KSLQSQGPVVIRKAYGKWTSPQLSPLQQEFNINGFELIQTYHPITGKNSADIKMVVDAM
FT                   EAATNPCLQTIVLATGDSDFSPLFRKLREMGKKVIGVGPLSKLSECVQSSCTHYIYTGS
FT                   PSPVSKMVALFPGEVQSHERAHAFATLHKILEAQDEPILLTKLKPLMLKEDNEFDHAKL
FT                   GYESFKDFLLASGEVHLSPMIAGPVYASLAS"
FT   gene            538848..539519
FT                   /locus_tag="FSU_0488"
FT   CDS_pept        538848..539519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0488"
FT                   /product="sigma-70 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25113"
FT                   /db_xref="GOA:C9RJ60"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ60"
FT                   /protein_id="ADL25113.1"
FT                   /translation="MTLKTPIDYKQRETETAILTNFFQRYPTEVLATLAAWYRPVLKQW
FT                   ASKFRSEFYRPDIPLRDYEAVAISSLADAAKNFDSTANTRFSTYLYAYARNECQRLAYN
FT                   TSNNFRVFKPCKKKNREATDAIPFEKLTVQDFNTYNDITFYHRSQLLESQRRIEQFYNM
FT                   LRHMSNSTSAVAKKQATRVQELAHHVLMGGTKKSFCDASGTNRGTLDEALMAIRAKLLK
FT                   E"
FT   gene            539571..541199
FT                   /gene="nrdD"
FT                   /locus_tag="FSU_0489"
FT   CDS_pept        539571..541199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="FSU_0489"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by similarity to SP:P07071; match to
FT                   protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25951"
FT                   /db_xref="GOA:C9RJ61"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ61"
FT                   /protein_id="ADL25951.1"
FT                   /translation="MNELANIQKNTMSSILGAGEKVCKSAVLDGIPERFAEFHRQGYIH
FT                   IHDLEFYDKTYNCIGVSVSDLVKDTDIQVSTVLRRLYRGIVSLTNNQSGGIGFLDFDGD
FT                   MAAYRMDESDEILTEAFRNFFEDLNIYSRKGCEKPYTTLNIGCRTSTKARRIAKAVLSA
FT                   ALEGNSEGKPFIFPNIVFKYSRAINGTESSPNYDIFQMALKGTASRMIPTYFNCDAPFN
FT                   RNANPNKIGIMGCRTRVVADIHGNTTGLNRGNIACVTTNLVRLAIDSNHDFQVFLKKIG
FT                   TLFEECKELLLHRFATLCKGTSPIFAIEKGLYLDSEKGREVALMHGTLSIGFIGLWDAL
FT                   SELLDTDFSDVDNLRMHHGKALAVLQVMRQKVDSFIEQSHMNFSLLASAAEATTGIFAD
FT                   RDFKEYGIQCKSAAKGFYTNSFHIPVDTSIRLFEKIQLEAPFHKLCNGGCISYVELDEQ
FT                   PCYNVGAIQKVVEFAMKNNCNYFGINFPLDQCNACGHFGRIGDTCSSCGSSDILRLRRV
FT                   SGYLSEKRAFTKGKKRELNLRKASF"
FT   gene            541298..541900
FT                   /locus_tag="FSU_0490"
FT   CDS_pept        541298..541900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24691"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ62"
FT                   /protein_id="ADL24691.1"
FT                   /translation="MRPKEFIDMFPYGYTRLRNLNGSAALRLETKCTNAYVYVKKIHRR
FT                   MPEINQDIVDDIQLECDNGVIIDWFNDNACRYFIIMRKHDELLAYKIVLNAFFQKETFE
FT                   IIGYFFENEHENHRKRVYNERYLKNVSPDALITETDFTNERYDIIFPDDALTHCRRLGN
FT                   TIAMSSICSTESCSQNHSDLNIHNNESLEDNSESDIE"
FT   gene            541893..542708
FT                   /pseudo
FT                   /locus_tag="FSU_0491"
FT                   /note="conserved domain protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            542727..543146
FT                   /pseudo
FT                   /locus_tag="FSU_0492"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            543265..543948
FT                   /pseudo
FT                   /locus_tag="FSU_0493"
FT                   /note="von Willebrand factor type A domain protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by similarity to
FT                   GB:AAO58192.1; match to protein family HMM PF00092"
FT   gene            543950..544951
FT                   /locus_tag="FSU_0494"
FT   CDS_pept        543950..544951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO58193.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26643"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ64"
FT                   /protein_id="ADL26643.1"
FT                   /translation="MNWVTIQCAVRGRGHVSSGTPCQDKTFSIVKDACSVCALADGAGS
FT                   ASHSHFGAEAVTQAICNYMAENFDLIINEDGAAVKRNILAVIGERLETLCSEKGCAIRD
FT                   LASTLLFVAEKGGKFIICHIGDGVIGYVKEGKVLVASQPENGEFANTTVFTTSSNAIAS
FT                   MRLIKGDLKQISGFILMSDGTETSFYNKRNKALSPSLARLTRLASVCTPDYMSQKLNCT
FT                   FEDLVKQQTSDDCSIVLMSRSPGSRGYMDFSEKDKCEFLGLANTRVSRKRLRSFDKALT
FT                   VLQSWGTYRAIKRRLHLRGKKLDRILKRLDNANILETREDGRYKSALRAFFV"
FT   gene            544992..545678
FT                   /locus_tag="FSU_0495"
FT   CDS_pept        544992..545678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0495"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAE18621.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27343"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ65"
FT                   /protein_id="ADL27343.1"
FT                   /translation="MRFRDYIDTAQRHLISCEAICRTIEWDKCSNEEKNEILKDLFYLT
FT                   GYILEALTIYTVYSRGHFNPNKDITELDIKFTKDTHVDYYNTREIHPNKNDPKDKFSIS
FT                   CRTPKNAESYETFNKNLEELNKLIRETTIYPIQSHKFFAIIQNVLNDSNKGLIFSSENI
FT                   PLFSNIKVSNNEREKKILTLIMSWDSSLRYSTNQWNKIKDILTKENIEYIIILCKMIKK
FT                   LVYKVG"
FT   gene            545682..548828
FT                   /locus_tag="FSU_0496"
FT   CDS_pept        545682..548828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25906"
FT                   /db_xref="GOA:C9RJ66"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ66"
FT                   /protein_id="ADL25906.1"
FT                   /translation="MTFISKYAIALQAFLHSLINEERGEKFKVFIRAGFQIDVFVFLFN
FT                   HQHHQDIEKKFDNFCKANKDLADLDPIAENDEIQIFFNIYPISELEDSFYSSIVNKPNC
FT                   IDYGPRYRFDSFYSTSKIDLTKEDQTKIPVITFYSHKGGVGRTTAMASYALHLAKLEKN
FT                   VAIIDCDLEAPGYLNFFNLSENDEHEELKEGKKNGLVEFLCDSQFLGKNIKIEDYILNV
FT                   GARNRNSNYHPALDRIWLIPAGNLNEGVTEDNALESPNRQDYIEGLAKLNLGNTQNVIK
FT                   SFNTLFEHLKTLNVDAILIDSRTGFNDIFGTATLHLSSCVVGFFGLSRQNEPGLINLLA
FT                   KHVQNENLFKLILAYSILPKNYKEDNILMEAYNRMETFIMNVYDQKNAPTRIPIHRNDD
FT                   LERIGIGDLAADKKFIDMNTSTDRNIQFSDYTQLFNEIDRNCFPEGLLSSIFGLMADNL
FT                   KSNKDNRYNSYDLRNIILQHLKKVLDESINSAEEDRINENTFFYRQCMNDLFDKDKFII
FT                   CGRKGTGKTHLCKSLQNQQISNKIKSNSRQKDNAEFIYANALPDNKDQEVALSIIIRSA
FT                   FNKDVDYLNLWRIYTWSKLFLDNGNESLSEIRSVVKQQSPLANKYSSINGELDTLEFME
FT                   LVNDIDSLLHIVEDLYRFDEELAKNNKKLLILYDKLDLYIRPSYWEKAISSLFEYWTHA
FT                   GSNLHNIAPKIFIRTDLFWQSIQGSITELSPNNIISTEWTIEEIFGYLFKLIFSDQRAS
FT                   SAYWDIAKNFGIDPQYIADTEKAFKTNNNQLKVLSQAEMEPLLQVFFGKDTQGLGKPWD
FT                   YFKKELSNADYTTNLQLFINILYHNAIDKSLAIAKSNITEIISPAIYTSTEVRAYAAKM
FT                   LFEKLAEDQFCKNLANFQHAVFFADNGLYRYKSLDTNKFDNLINTVCEQNKFLDFGSTK
FT                   ENLINAIFSNGIMTINNTTKGDIFVFAPLYWYPWGLQEVSFESKNKTIKKNDEYFEYKD
FT                   ELASNNADAAKKAIIASNAALMALGLGSIFGGPVVASVASAAVIATSIAKMISKINSKK
FT                   "
FT   gene            complement(548886..549761)
FT                   /locus_tag="FSU_0497"
FT   CDS_pept        complement(548886..549761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0497"
FT                   /product="glycosyltransferase"
FT                   /note="identified by similarity to GB:AAC44786.1; match to
FT                   protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26498"
FT                   /db_xref="GOA:C9RJ67"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ67"
FT                   /protein_id="ADL26498.1"
FT                   /translation="MTPKVSVILPSYNHELYVEAAVRSVMEQTGVDFELIVIDDGSKDR
FT                   TPEILKRLADELKFTYIHRPNKGVVPTLIEALALARGRYVCSFSSDDIMPPDRLKKQSD
FT                   FLDAHPEAASCFGQIVSLYEGDKIGSEMDVRYLRSVPQISFEESFLGQKALHGCAEMFD
FT                   REKILAIGGYDKRYYFEDYPLYLSILYHYGPQPVSKDFVCCYYREHGDNLHVDNNRIFS
FT                   EILRILAENYSKHPLYKKAVRCWKANWFSAVAAQSKLKALRLIPKVISLSPRFWMRLPK
FT                   LFIPRKLLKF"
FT   gene            complement(549758..551014)
FT                   /locus_tag="FSU_0498"
FT   CDS_pept        complement(549758..551014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0498"
FT                   /product="LPS O-antigen translocase"
FT                   /note="identified by similarity to SP:P27834"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27010"
FT                   /db_xref="GOA:D9S6K1"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6K1"
FT                   /protein_id="ADL27010.1"
FT                   /translation="MNFWKAFMGSGMVTFLNALRVFVVNKLLAMFLPPSAFACVGQFMN
FT                   FMTMGQATSSLALQNGWVSLSAQNKDNLEQLKGVWRGGFRLTTFASIATFAVALVLCFT
FT                   VPLESFFPGIHPRLVQAAIIFALPGVFATNIITITASVMNGLGHYRRWALINMVSSLWQ
FT                   MLWVAFFLYSGRLSVLSIVATQSVVAGIFAAQIASRAGFSLREIRKSALDIRAPWLSYA
FT                   LMGIVPMLLSPVVLTFMRQTVGDNLGWDAAGIWQGIWKISDFLTAFFSAILGVIILPRV
FT                   SAKMTKSEFWGMFRPIFLKTMLLALVAVLILYFGRSLLVAVMLSSSYAGAADYLPVQLL
FT                   GDFFRVGGWALGLVLIVRRETKKFLTLEICSELVLALSTYAFVKLYEFNGPMMAYALEN
FT                   FLTLVASFVLVSRLKWGEK"
FT   gene            complement(551040..552158)
FT                   /locus_tag="FSU_0499"
FT   CDS_pept        complement(551040..552158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0499"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by similarity to SP:P14290; match to
FT                   protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27098"
FT                   /db_xref="GOA:C9RJ69"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ69"
FT                   /protein_id="ADL27098.1"
FT                   /translation="MAKVPFLDLKLLNAPYMESLKEAASSVVESGWYIRGHYGEQFERA
FT                   FAEYCGVKYAVGVGNGLDALTLMLRASMELGRLRAGDEILVPSNTYIATVLAVSAVGLK
FT                   PVLVEPAENSYDMDPKRLKDACGARTRGILVVHLYGRLCAMDEICEFANEHGLLLFEDS
FT                   AQAHGARLGDGRCAGSFGSAAAYSFYPTKNLGALGDAGMVLTNDTDIANAVRSLGNYGS
FT                   EQKYVNMYKGVNSRLDEMQAALLLAKLPHLDECNDRRREIAARYCRDIKNDKVILPELP
FT                   ATPSEHVYHVFVIRLKSEEARDEMQKFLTAHGIGTLIHYPIPPHLQEAYAHEFSGEYPI
FT                   AEAMAKTILSIPMSPVMTDDEVSEVIGAINEF"
FT   gene            complement(552223..552298)
FT                   /locus_tag="FSU_0500"
FT   tRNA            complement(552223..552298)
FT                   /locus_tag="FSU_0500"
FT                   /product="tRNA-Lys"
FT   gene            552427..553440
FT                   /locus_tag="FSU_0501"
FT   CDS_pept        552427..553440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0501"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ70"
FT                   /protein_id="ADL27063.1"
FT                   /translation="MDLLKKLSAIAALAIACPASDFGYFSQHDAGQEVFSFLSTFDSPR
FT                   NAALEKSASALPTTDPTVVQLNPAAILMPEGKKRVAEAHWQTGEFADNQGTLSYTTQFE
FT                   KFILQFSYNWISYGTITGYDEYGDENGSEYKPFSQLATLSVAYPMKHIRVGATIKFASD
FT                   KLTGDNEDQTAMAAAFDWGLTWVSDSKNYGFSFVARDFGAMLRGYVKEDADDTYPLSQT
FT                   FAISGFMKPRSVPRLTLFAETDFPRYAEPDLNLGAEYALGEFFRIRAGFTRTWLDITRD
FT                   IKELANSSSRPDETNEARIFSLGLGYASDLFAVDYAFSYLAQSLGFEHRLGLRVEF"
FT   gene            553459..554253
FT                   /locus_tag="FSU_0502"
FT   CDS_pept        553459..554253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ71"
FT                   /protein_id="ADL26049.1"
FT                   /translation="MRQFDVFVFNENYDETQGNLPQPPFTDPELGWFFTRDWNKHLDEI
FT                   EGEWVVFAHPSIKIDRNFLNNVAEVTDSFPMVDAFAPRIRTNNGKFLGGYLLRPSSKGS
FT                   GFIEIDENAPLRYVAAPHPYLGIFSRRIIQRTGGFDTTLPENARLADFTLRMMHAGGKM
FT                   FSVPYLVAQATGDGAEAVTGNNRKENAHNLAEMRAGMRDLKSIAIILSKAFGAEASTPF
FT                   ALHHPSVIPTLLRNRKQRKKKRKAATLLSKLKADFLKEVTAK"
FT   gene            complement(554429..555457)
FT                   /gene="gapA"
FT                   /locus_tag="FSU_0503"
FT   CDS_pept        complement(554429..555457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="FSU_0503"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase A"
FT                   /EC_number="1.2.1.12"
FT                   /note="identified by similarity to SP:P06977; match to
FT                   protein family HMM PF00044; match to protein family HMM
FT                   PF02800; match to protein family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25838"
FT                   /db_xref="GOA:C9RJ72"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ72"
FT                   /protein_id="ADL25838.1"
FT                   /translation="MALKLGINGFGRIGRMVFRAAVENFSKDITVVGINDLLDADYLAY
FT                   MLKYDSVHGQFNHDIKVEGNFLIVDGNKIQIFAEKDPTNITWGALDVDVVVESTGFFLT
FT                   AELAEAHLKAGAKKVIMSAPSKDSTPMFVYGVNDKTYAGQKIISNASCTTNCLAPISKV
FT                   LNEKFGIVRGLMTTVHAATATQKTVDGPSKKDWRGGRGILENIIPSSTGAAKAVGKVLP
FT                   ELNGKLTGMSLRVPTSDVSFVDLTAELKNAPAADKDAAYAAICAAMKEASEGELKGILG
FT                   YTEDAVVSTDFRNNSCTSIFDAKAGIQLDPTFVKVCSWYDNEWGYSNKVCEMARVITNY
FT                   KG"
FT   gene            complement(555622..556389)
FT                   /locus_tag="FSU_0504"
FT   CDS_pept        complement(555622..556389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0504"
FT                   /product="PDZ/thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF00578; match to protein
FT                   family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26395"
FT                   /db_xref="GOA:C9RJ73"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ73"
FT                   /protein_id="ADL26395.1"
FT                   /translation="MSKIIRAICILSLFSVSAFAGPWLGLIYKKDLYQNHLALRVSGVH
FT                   PESGCLAAGVVSGDLVIGFGGKDLVNVAQMQDVLKTAKVGSKVAIEIFRDGKRIPLTVT
FT                   LTERPDDISSLTGSAIGSKMAEFGKNFYKNGEKRKDAPKATLLDFWATWCGPCRQTLPV
FT                   LEKIYNKYSSQGLEVIGISSEQTKPLLAFYKKQHASPYPLYRDADQGLWRRYGIHAVPT
FT                   LMLLDSNGYIKRVWSGAPSFEMLEKLVLEVLEK"
FT   gene            complement(556417..556971)
FT                   /locus_tag="FSU_0505"
FT   CDS_pept        complement(556417..556971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24889"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJ74"
FT                   /protein_id="ADL24889.1"
FT                   /translation="MVRCVKIFLVALLLSCVQSFAGYFIEQPYEDAPASDSLSALSFGG
FT                   ELQLVYYLSSVHPGILLSSEHRFHKHHSADLFAAFLFSGDYFEVGTDWRFFFRGTREDD
FT                   FVRLGFSMISFDRYGKNYFQPRATLGYGRDITFFKNTSFLCRIELDASYIMGKALVDKS
FT                   DDIFSREAHFSAALNIGFYLF"
FT   gene            complement(556981..558123)
FT                   /locus_tag="FSU_0506"
FT   CDS_pept        complement(556981..558123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0506"
FT                   /product="dihydroorotate oxidase"
FT                   /note="identified by similarity to SP:P45477; match to
FT                   protein family HMM PF01180"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26761"
FT                   /db_xref="GOA:D9S6K8"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6K8"
FT                   /protein_id="ADL26761.1"
FT                   /translation="MRVSDRILALIRRIFHNNPEFRHDSLKHVARFAPIIPFMGGRPDL
FT                   SKTLNRVVTFADGSNPLHFGCPIMLAAGANKTAKRICDFANMGFGGISVGTATRHVREG
FT                   NTHRPRIGFIENDRAIHNSMGLNNDGVDAVTRRVDTQITAAHRVQMCVGISVAETPGLT
FT                   DENEKLQDIVESFSIAYRVADYVEINLSCPNTGENRLDLDMTLVNKIFTAITDYRNKQP
FT                   VRKAIYAKLSPDMPENHTATIMDMLVKVGVNGVVMGNTYPTKKVTDLPVHVKYDDLTPL
FT                   RADNDRGGMSGRPLYENTVRNVKFIREHYPQMSVIACGGIDHGYKIYDLIKLGVDAVQC
FT                   YSVVAFRWMAAHAMRKELEEALSKDGFKSLADYDAKNPKG"
FT   gene            558278..559651
FT                   /locus_tag="FSU_0507"
FT   CDS_pept        558278..559651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0507"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26749"
FT                   /db_xref="GOA:C9RJK7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJK7"
FT                   /protein_id="ADL26749.1"
FT                   /translation="MQNQIKKDIHENMPRYIDMLSSLVAIPSISFDNFDQKYVLDSANA
FT                   VKAMFEKAGLTNIQFLMPPSGRPSVYAESLTSPDKPTILLYAHHDVQPPMREALWDTPP
FT                   FTATQKGDRLFGRGTADDKAGIITHLAALEQVRRELKGNGPNLKFIIEGEEESGSAGFE
FT                   RILTEHAELLKSDAVIIADLGNFAKGTPSITTTLRGMSAINVTLRATKAPLHSGSWSGP
FT                   IPDPAQALCRMIASLTDKDGKILIPHYEDDIIPPTKEELESYKSLGMTEEIFRNDGGVL
FT                   EQVKLNVPEDEILLSLWRRPSIIVSTIESGSRVNAGNVLQDSAYARIGIRLAPGMDAVR
FT                   CTDMLADFLKAQVPNNMEITIDKEDGANPFTTDTNHPFFKKMSEAMADAYASPTKFIGC
FT                   GASIPGAELFRNTLGNVPILLTGLEDPECNAHGENESLYLPDFESGIVAEALFFASIS"
FT   gene            559661..560350
FT                   /locus_tag="FSU_0508"
FT   CDS_pept        559661..560350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0508"
FT                   /product="cobB protein"
FT                   /note="identified by similarity to GB:AAC78722.1; match to
FT                   protein family HMM PF02146"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25421"
FT                   /db_xref="GOA:C9RJK8"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJK8"
FT                   /protein_id="ADL25421.1"
FT                   /translation="MKRKRLVVLTGAGISAESGLRTFRGNDGMWEHENIEDVCTPDALR
FT                   RDPKRVKDFYNFLRKGLPEHAPNAAHIALAKLEERLGDEFLLVTQNVDDLHERGGSKRV
FT                   LHMHGDLMKLRCTKNEHEFEFTGEETLDTKCPICGSPVRPDIVFFGETPLYMDEIQEAL
FT                   MNCDEFAYIGTSSVVYPAAGFKSFAKSYGAKVTCLNLEAPYGDPYTDVVIQGKATEVVP
FT                   KWCEEFK"
FT   gene            complement(560400..561341)
FT                   /locus_tag="FSU_0509"
FT   CDS_pept        complement(560400..561341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24741"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJK9"
FT                   /protein_id="ADL24741.1"
FT                   /translation="MFCKECHKNLKDFDALIDKMENCPFCGAKLVRPPVKVAQKDVNAL
FT                   CEALVQKVGDSIFANESTLEKELRDLNAPEFADAKDRLFLLVLKQIPSSMYEVRSFSDG
FT                   EQQEVLEACQRRLCVDLGLSFEPCAQMLDILQEYIWQKRFSLSPNLFESQFVDPRDGQV
FT                   YKTVRIGDQVWMKEPLKYKCVGYTGEGLYEWSSVNKYCAVRGWRVPSKKDFETLIKTAA
FT                   GLGLGDPSSVLMSRKGWEKCNVTPTDNLGFEATPVKCSTGISNNFFSHFWTSEDKFCFE
FT                   IFPGRVTFSTHSQSYVRLIKDDTPETKTPEKK"
FT   gene            561414..561506
FT                   /locus_tag="FSU_0510"
FT   CDS_pept        561414..561506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24576"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6L2"
FT                   /protein_id="ADL24576.1"
FT                   /translation="MMIILKNKNERDVKLMQKTIARINYLAQKQ"
FT   gene            complement(561485..562702)
FT                   /locus_tag="FSU_0511"
FT   CDS_pept        complement(561485..562702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0511"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26489"
FT                   /db_xref="GOA:C9RJL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL0"
FT                   /protein_id="ADL26489.1"
FT                   /translation="MFRRETRDERREERVILSEVEGSSKVPVLRVKEVSVAFGFDKNGN
FT                   SRDGRKPLQVTDRVSFDIFPGEFFALVGESGCGKSVTAMSILRLLPWPSAKIVNGEILF
FT                   DVGANDAQAQDSRDADDGNANSRDLATLPLKDLQSVRGSEIACIFQEPMQALNPVVTIK
FT                   KQLLEVFKFGAVSKNTQSKQDSAPSRGSSSSSERSGGDPVNSPLDLIREQLRLAGFNDP
FT                   DRVLNSYSHELSGGMLQRVCIVMALLPKPKLIIADEPTTALDVTVQAQVLAVLKEMAEK
FT                   TGTAVLLITHNMGIVSQYAHRVAVMYAGRIVEEGPVREVINHPMHPYTQGLLAAIPESH
FT                   SDLRTLASIPGAVPHPKDFAKGCRFADRCCKCAQASAEVREKCLSAELPTKIAEANHFA
FT                   YCFCAK"
FT   gene            complement(562695..563774)
FT                   /locus_tag="FSU_0512"
FT   CDS_pept        complement(562695..563774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0512"
FT                   /product="putative oligopeptide/dipeptide ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to GB:AAN51427.1; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26433"
FT                   /db_xref="GOA:C9RJL1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL1"
FT                   /protein_id="ADL26433.1"
FT                   /translation="MKLRLSTETLNRLKRFRKNKRAFWSLVILVVAYLLSLTSPWTVND
FT                   EPFYLRYNGKSYFPAFARYSEADFGGEYKTEQDYAKLFADVEECKQDEEDGFPRAGGCP
FT                   EMWTFMPPVPHDPLKADLSEEGTPPFAPSAKHWLGTDSNGRDVLSRLIHGFRICISFSL
FT                   LLTVLGTFLGIVIGGIQGYLGKFWDTGMQRMIEIWSSLPMLYVVILIGSIYGRSFWLLI
FT                   LIMAAFNWLSLSYYMRAEFLKLRSMTYVMSAKVLGLGHRHIFFKEILPNAMTPVVTLFP
FT                   FTLIGGIGSLTSLDFLGFGLQPPTPSWGELMSQGLNNLYAPWISVSTVVALFVTLLLTT
FT                   FVGEGVRDAMDPKSGDRYV"
FT   gene            complement(563829..564971)
FT                   /locus_tag="FSU_0513"
FT   CDS_pept        complement(563829..564971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM23515.1; match to
FT                   protein family HMM PF07075"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27080"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6L5"
FT                   /protein_id="ADL27080.1"
FT                   /translation="MKRLAFKGGFTTFKNMVTLALSHFEKSFPVVLRGKRLGAVLHPAS
FT                   VCADLSYTLDLLKDLDGKLFKLSALFGPQHGIKGHTQDNMIEWEGYEDPELHIPVYSLY
FT                   GEHREPTAEMLSHVDAMLVDLQDVGARYYTFIWTLFLCMKACEKAGIPVVVVDRPNPIN
FT                   CVDEEGPVLDLNYTSFVGLHSIRTRHAKTIGELAEQFKAERFPKCELYVMHMDGYDKRM
FT                   WFDETGLPWILPSPNMPTLDTAIVYPGMCLFEATNVSEGRGTTRPFEIFGAPFIDAVKL
FT                   CKYMNGLKLPGVYFRENYFQPTFHKGAGQICGGAQIHVTDRNKFRSFEMAVKLLQYIFN
FT                   EYPKDFAWKQPPYEYEFHKLPIDILLGNGTFRKEFIESSI"
FT   gene            complement(564952..566028)
FT                   /locus_tag="FSU_0514"
FT   CDS_pept        complement(564952..566028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0514"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26232"
FT                   /db_xref="GOA:C9RJL3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR026404"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL3"
FT                   /protein_id="ADL26232.1"
FT                   /translation="MHLGIKKFLALEAHRLYRHSQIKDHPLTYLFWECTLRCNLHCLHC
FT                   GSDCVADAIPDMPREDFMRVLDGVSPHVDPSNFIVVITGGEPLMRADLEEIGKDIKARG
FT                   YPWGMVTNGLALNPERYTKLMNAGLRALTISLDGLEENHNHFRGNAHSFERAVRAINMA
FT                   SHTDGITFDVMTCVNRKNLKELPKIYNLLLNLGVKRWRVSNVFAKGRAKDNPLFQLTNQ
FT                   EFRQVFEFIREAKKQNLMNVNYDCEGFLGSYEKAVRDNPFFCWAGVNIASVLCDGSISA
FT                   CPSLRGDYIQGNIYKDDLWDVWQNRYQVMRDRSWAKIGDCKTCKYWRYCEGSSLHLRDE
FT                   RTKELAYCHVKRLEAAGV"
FT   gene            complement(566046..566693)
FT                   /locus_tag="FSU_0515"
FT   CDS_pept        complement(566046..566693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27161"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL4"
FT                   /protein_id="ADL27161.1"
FT                   /translation="MYKHWKKFLLALTAFFWNACDNGSSPAAPVFPDSSSSTTNGQNSS
FT                   SSVEKVSSSSTVKNQFSSSSDVQPSSSAESSSSVESSSSSPIAESSSGEIEVVPLYGVY
FT                   MDRETCTAHKDDNVYECTDGVTCVESTADEEQVPVTRDPTEVTAKYGIVFKPEVTAKYG
FT                   VVYVKDKVYTCSDGKVYNEAEFQANYNTIIIDETVVLYGPPCAFEGSCKDDE"
FT   gene            complement(566853..568310)
FT                   /locus_tag="FSU_0516"
FT   CDS_pept        complement(566853..568310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25230"
FT                   /db_xref="GOA:C9RJL5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL5"
FT                   /protein_id="ADL25230.1"
FT                   /translation="MEMMRLVTLLVLVGVLSVPALAKKSDEAVQDTSSGSMSFTEVIAW
FT                   PFIHVIQPFFSSLVYPIAAPLHYAIENGVADKAVDLITFGEKRNIFIYPVFNLKPGSST
FT                   MIGLCYRHRNLFYQNDYAVFEGHYYANSDFDVKMRYSKQSLFGKKLYGLVNLNIYMDRD
FT                   NGFTLPVTKESFKQADTTINAGLRFGFPITESRNLNFSFGSELVYHLADFTDTKDSVLD
FT                   HPKFPIEDRGLYQGHFEIPFYVNLVFDNLDFPYAPSKGQRLSLSASYVLTSHYSGITAD
FT                   DMSIVGLHRSSALKDGGKNHDYVSVDAFYQIYFFIGRADKYVLSAKEGRKTRKFYTDFS
FT                   LNEVLRVWRPENLVETLFEHRVFAFQLRFQGMWEMEKGGAPYSAFPSLNARFPLRGYTG
FT                   AWVAPFVLGLSTEYRWPVDRLVDGVVFNEYAMISDKINSWSKDHLYNSWGFGVRVRKPD
FT                   MYLFRVQFAFHSWHGLSLILTIAPEFR"
FT   gene            568337..570766
FT                   /locus_tag="FSU_0517"
FT   CDS_pept        568337..570766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0517"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24553"
FT                   /db_xref="GOA:D9S6L9"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6L9"
FT                   /protein_id="ADL24553.1"
FT                   /translation="MFSLFAKIIKKLAAYPKIILTVFLAVGILSIYPIMHLRWDLQLQD
FT                   TITSAREPSNVQKIEDEFGGLGSLIVILQSEDSSANYQIAKNLAQKMQQSPAVHFADFE
FT                   TDIEFYKKNKFLYASENDIDIMVHRIEKLKHDYIMKNNPLFIDLKSAIDSITQTTSEQR
FT                   EQLLSDLEKKYFDKLAVSHSNKTGTIRIVEIYPTHSISDLQANRNLFYEVSNQLKNEKT
FT                   PSDFQVYFAGKVYESIQTGKRLLPEAKMVGCVTAGLILLLLILNFFRQPQLIFISALPI
FT                   ATPIFTTMACSYMFYGRINLFTLLLAIVLPGQALQIINHVLNRYFLEREQNLSPQLCIE
FT                   SALLGIGPSTAVSSFAFATLFASLILIPLPGLQELGVLGSTGCILNWAITLLFSAALLQ
FT                   VTQRKKPFSIRHSQIHPEYKISMLSNRLNWTIFSIIIAASLVGLYIGGTRIHIRNDFSA
FT                   TEINYKDATIDSLIAETGFMNKTPVIVMLPESAESENLLERFTELKNNGELSTVNSLFT
FT                   LAQFSPNLQQKKMEKLRQLHSLVTKEFREALSKSELENLEKVEQALEFDEADDFEPPEY
FT                   IAKKFRDKHGKQGRFAFIFTDIKENFGSECVKLHKELHQIEGIDNGKYLVAGIPITRAI
FT                   FLDRITNNISRPLQVGGILVFLFMLVYYNRFSRALFTALPSVFAASWFLAALNAFDVKI
FT                   SAYSALAFPILIGASVDGSLQFFSAYYEKQTGTALTILRDKFFTIFLSQMAAFIGTYGM
FT                   LVSSHPGLRSMGYVSLTGLICIFISQFTIFPLIAGSLDQYRLRQKRKKEAKDENAF"
FT   gene            570750..571940
FT                   /locus_tag="FSU_0518"
FT   CDS_pept        570750..571940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0518"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="identified by similarity to SP:P23034; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25390"
FT                   /db_xref="GOA:C9RJL7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL7"
FT                   /protein_id="ADL25390.1"
FT                   /translation="MKTLSDRTQNIAASLTVAIDTMAKQMIADGKDVVSLGAGEPDFGT
FT                   PTPIQDAAIDAIRAGKTRYTAPVGILDVRKAVAKKLEEENGLHYNASQIIMTSGAKHAV
FT                   FNALAALINPGDEVIIPAPYWVTYPELVKWLGGTPVFVEAGIEKNFKIDAEDLRKACTP
FT                   RTKAILLNNPCNPTGAVYSKRELEALAKEIVAQDIYCISDEVYEYFVYDTEFTSAAVFP
FT                   GMAERTIVINGFSKSHCMTGWRIGYDAAPAPIAKIIGKIQGQATHHPSNVAQYAALGAL
FT                   NMDKSNVHAMQAAFRKRRAYMLERTSFLSTKPRAPEGAFYLFAPVSDYYGKKTPDGKVI
FT                   AGSIDFCSALLESKGLAIVPGAAFGDDTCVRFSYAASDENLAKACDRFEAFVKELS"
FT   gene            571953..574016
FT                   /pseudo
FT                   /locus_tag="FSU_0519"
FT                   /note="ABC transporter, ATP-binding protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF00498; match to
FT                   protein family HMM PF01061"
FT   gene            574013..575518
FT                   /locus_tag="FSU_0520"
FT   CDS_pept        574013..575518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0520"
FT                   /product="putative protein kinase"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26325"
FT                   /db_xref="GOA:C9RJL9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJL9"
FT                   /protein_id="ADL26325.1"
FT                   /translation="MIRPEQPLNFPYPFNENYELLGTLGKGGMGYVYKALDKRLNREVA
FT                   FKILDSTSDVEAIKRFYLEAQAMKELDHQNIVHVFDFGQQGNQLFISMTYVQGISLAEI
FT                   LQNKSKLSFEAIEVIIKQIARGLLYAHSKGIVHRDVKPSNIMLTRDNRVYIMDFGISYI
FT                   QEMEKERLTRTGMTMGTPEYMSPEQCHGDEVTLQSDIYSMGVILYEMTCGRLPFEGSRP
FT                   VEIALKHVQEPPPAPELFREDIPDGLSALILKCLKKKLNERFHDMQEFLDECDQVFPQH
FT                   DTPYQNSSVGRKTGSHRSVPSIAEAAKRFGSNLTPHKLIIVAFSVLFPLIVILLMLLMF
FT                   THKPQNMLHEVEWSEVIANYETRAIEPEMKKGYPIENLTDGDLTTAWLNKMPLKPLNPV
FT                   LAMYFDQNTLITNIGIAVGYQKSVDDAFGDRFRIFKKPHTLTIETKDGFKQRIKLENIR
FT                   GMQYPNIQAVETTELRFYLEDVYEADNDDYAISEIRLLGMEVE"
FT   gene            575577..575993
FT                   /locus_tag="FSU_0521"
FT   CDS_pept        575577..575993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0521"
FT                   /product="conserved hypothetical protein TIGR00252"
FT                   /note="identified by similarity to SP:O83883; match to
FT                   protein family HMM PF02021; match to protein family HMM
FT                   TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27004"
FT                   /db_xref="GOA:C9RJM0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM0"
FT                   /protein_id="ADL27004.1"
FT                   /translation="MQKRIVQRSCNRAKGNFIETQAVAFLMREGYQVVTRNYAYHGGEL
FT                   DIVARDNGTLVFVEVKSVWNNQEGNPAARVNALKQKKIWQTACHFLATQKTIAPKGFDT
FT                   PCRFDVLSARAYQEPLQFAHIKNAFEGNQVIPNI"
FT   gene            576177..579974
FT                   /locus_tag="FSU_0522"
FT   CDS_pept        576177..579974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0522"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25814"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6M3"
FT                   /protein_id="ADL25814.1"
FT                   /translation="MKTVKISRSSLCASLFGLFFLVSCAGNNTPEVNPSPTPEISESTD
FT                   AYYDDESSTDYVTEEAPATVATGGTIETSGYTFTAPDNGWTIIGGEDNAPYEFYNPKTG
FT                   RRAVLVEVMLPEGEPLRLMDRAQIEMQSFESSGKKATLAETYPEEAFGTTGAFFDVAGK
FT                   RYDTPYEAVGLVIGAGNRIFTLTLAATDTQLPAGTLKQEWKDFYASFKLKEVVQEAVSE
FT                   LSEERIMQYSSADLGYSWSTSDTLWHNWTGVARQNEDPDLVLSNKKEDISLFVYGAIVP
FT                   SDEVSQQDMFKVLLSRLGLSMNEPSFEVQRVKVGDRYAQEFTLTHVVNKFDFYYTGRFY
FT                   YDNGRGILIATWTQGINKKKYASVMKNAVNSLKVGAMPKMASDEEARKKQNKFNAAVMS
FT                   QVGILRLLEDQPFVALSYFERANKMDPEEPLYLINCGFVYQMKELYGPGISYFTSQIDL
FT                   VRKNGKLLSILGEMYEALFDYGHARECAEAALRYTPNNPEYVINLSDALWGLGQRHQSL
FT                   IVVQRLYDTQPSSRLGVYLAKTYMGLDQYAEAVDILYAIRGRFGMSKELGETLMDALMF
FT                   LGRYEEARAISDETLAKAKNDYKVWTMHGKILFYSRNYRDAEKALTKALALKPDNEDAK
FT                   SFLSATKAYLGKADNRTLQKPITPVEDRTADLKTLLRPQAKQNAIEGDFPAVIHYQKES
FT                   LKAEKNANWVRSEEMLLEVLDQRGAAIYREFTFDFLPGYDRIFLNALEVYDSNWKLKQK
FT                   ATLNGAYITYATEIGGGNESQTAHFPLSELAPGDFIYMQFSRTNLENKGMIPYTNYESS
FT                   RDVPVGESVFRIYADTTRFVTEEYGPLEKTAIKGGIEWKIENPVIVRKELYMPVYRDFG
FT                   AGLMLTGKQEWRDVGDDYQNLISHQFKKAVKVREQAFEVRGNKIGDEAVKAIINFVRQD
FT                   IRYRDVRFGGHSLIPQTAEVTLKEHRGDCKDMALLLKDMLDAIGVKSYLTAIHLTEEGF
FT                   SHLPTIQQFNHMILYIPKQGKISERWVDATDKTGNDRPVPLDMEGKVALVIDGDQSHVV
FT                   TTPILEDNQEHQIAIQHDLFIAEDGKCEFRDSVQLQGKFASAIRNKFFGRDVKDQEKLL
FT                   EQFLAAGVPDVSIGNIRIKNLDQFNKPLIIVNTYASKGYFGQGGSELKGRFPNVWERSL
FT                   FKLPKVAKRHHPIRMPHETQFSFKLNIKTASGHTVTLTEAKPLNRAPDYVSFEKQPKSK
FT                   TSSGIKWTTFALYADPTEYDKIREEWNYLLSETSPMITVK"
FT   gene            580116..580775
FT                   /locus_tag="FSU_0523"
FT   CDS_pept        580116..580775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0523"
FT                   /product="putative phosphatase/phosphoesterase"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00040"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26447"
FT                   /db_xref="GOA:C9RJM2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM2"
FT                   /protein_id="ADL26447.1"
FT                   /translation="MRALILSDIHGSALAARQALTFFEKFNCDKIFLLGDTLYHGPRNP
FT                   LPAGHGPMQVVEALAPYKDRIVAVRGNCDADVDLMMLDFPIENEYKVVKDCGLHLFMSH
FT                   GHIFMPECFPRDALNAIESTGAAQSSAQSTQPEAEVPQKPQIDVYLYGHTHIWKLEKNF
FT                   RNVLLVNPGSTSLPKGGNPPTFGFYESTPATANEHAHAKFSIHTLEDGMEIAAVSI"
FT   gene            580818..582065
FT                   /gene="spmAB"
FT                   /locus_tag="FSU_0524"
FT   CDS_pept        580818..582065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmAB"
FT                   /locus_tag="FSU_0524"
FT                   /product="spore maturation protein AB"
FT                   /note="identified by similarity to SP:P35157; similarity to
FT                   SP:P35158; match to protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25816"
FT                   /db_xref="GOA:C9RJM3"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM3"
FT                   /protein_id="ADL25816.1"
FT                   /translation="MVLNVIWLVFFFGAFIACIVQWLAFGDTGIFNKAILGAFDMSKTA
FT                   FEIALGLTGILSLWLGILKIGEKAGAVQILAKIVQPLFSRLFPEIPKGHPVVGTMLMNI
FT                   SANMLGLDNAATPMGLKAMKQLQDLNPNDDKTVASDSQIMFLVLNASGLTLIPVSIMTY
FT                   RAQLGAANPSDVFLPLLLSTFFSTIAGIFALSFFQKIKLKDPVTVMWLGGISACVIAVM
FT                   FYFSHLTAEALGTTSLFISGLVLFGVIVAFLGLACYKKVQAYEAFVEGAKEGFNTAVMI
FT                   IPNLVAILVGVAVFRASGAMDLVMNGISALLGLIGVGNDVVPALPTALMKPLSGSGARG
FT                   MMIDAMKNLGPDSFAGRLSCMFQGAADTTFYIIAVYFGSVGVKKTRHAVTCALIADAVG
FT                   VIAAIVIAYIFFPPFH"
FT   gene            582206..583900
FT                   /locus_tag="FSU_0525"
FT   CDS_pept        582206..583900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0525"
FT                   /product="EAL/GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26503"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM4"
FT                   /protein_id="ADL26503.1"
FT                   /translation="MDYVIFSSVYKDFRDAILDNIPDMSAMSKRISAAIPPICNILNIG
FT                   FIKLKLIAPSSIIAKEGLNDEKIIYEDTNGYESMPLIQTYRTGENGMATIEIRAKKSHK
FT                   FSNPELQAVKLISDDMFIILGRSRLMSAIHYASQTDTMTGAPNTAKLVHHSIELKSKNK
FT                   LHNFSGLFLNLKNYKYINQSKSPAIGDKGIALFTHTIMAMCHDDEMIARLGGDNFFVLV
FT                   KKENRDQFVKNLSSIKVNVPTPQGQVIPLTIQSRIGVYDIQPQDTMNEIMHCSSVALNE
FT                   SRVHPGNDIVYFTRKMLEDVYHEKEISSIFREALRRKEFIVYYQPKVSVKEQKLCGCEA
FT                   LVRWNRNGQVIPPSEFLPILEKEASICLLDFYVFRKVCEDIRNWLDTGIEPVRVSSNFS
FT                   RHHLSNPHLTEDILDIMKEFNIDSKFIEIELTESSNFEDKIAMQKFVNGLRQHGISVSI
FT                   DDFGTGYSTFAAIKDLNVNVIKLDKSLLDHIGDEKYHDEVVIKNMVNMINELNLEVVAE
FT                   GVENSKQLDFLQNAKCSIIQGFLFDKPLTKEEFEKRLSKEVTYTNIS"
FT   gene            complement(583897..584340)
FT                   /locus_tag="FSU_0526"
FT   CDS_pept        complement(583897..584340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27102"
FT                   /db_xref="GOA:C9RJM5"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM5"
FT                   /protein_id="ADL27102.1"
FT                   /translation="MSMFANAVACLLCLIFAAFLWKIKGMFRITLVMFFIVMTSCLYTA
FT                   FAGNLAIPTLENYPFRMVALTFCVFTTGLRDNRRRFMVLAQTFWLWVELLGIISLYQAG
FT                   EEAPWIRLAAIAEIALGCCFMARISREIEFGLIVLWMAIWMFF"
FT   gene            complement(584337..585560)
FT                   /pseudo
FT                   /locus_tag="FSU_0527"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            585645..586193
FT                   /locus_tag="FSU_0528"
FT   CDS_pept        585645..586193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0528"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02659"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26518"
FT                   /db_xref="GOA:C9RJM7"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM7"
FT                   /protein_id="ADL26518.1"
FT                   /translation="MTTLEIIIIAIVEAMDCFAVAISTGLCKSGIKRSRAVLQAISFGF
FT                   FQGGMTLLGYFLGSFAERWFNAVGTPIACAILCILGSRMIWGAIRGGEATASCAHLSLM
FT                   NILLLSVATSIDAFAVGISFAFLNANMVFATSAIAIASFVMGVLGFEIGRHASKRFKTK
FT                   IPEIIAGIILIAIGVKMFV"
FT   gene            586238..588385
FT                   /gene="ligA"
FT                   /locus_tag="FSU_0529"
FT   CDS_pept        586238..588385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="FSU_0529"
FT                   /product="DNA ligase (NAD+)"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03119;
FT                   match to protein family HMM PF03120; match to protein
FT                   family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25202"
FT                   /db_xref="GOA:C9RJM8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJM8"
FT                   /protein_id="ADL25202.1"
FT                   /translation="MSEQKDIDRTRYFELKKQLEEASRLYYKDGVSPMSDQDFDFGLKE
FT                   MEALEAKYPELRGKGSLTQKVGSDLTNDFAKVAHAVPMLSIANVYSEEEMREFVKAAEE
FT                   GLSSFVSRLSSKKWICERKIDGVSLSVIYENGRLKQAATRGDGAQGDDVTLNALTIADI
FT                   PEYFDAKKLKIDPSEIPQGTFEVRGEVYMEREAFERLNEQFILENKKTFQNCRNTVSGS
FT                   LKLKSVAECKTRPMRFFAYHIPQSNNKTHEENLKQLKRLGFHTNDYWTADTVDEIMAIS
FT                   EKIGASRDSLPFDIDGMVVKLNDLQQQRELGSTSKSPRWAIAYKFKAERAYTPLLSVEF
FT                   QVGRTGAVTPVANLAPVRLAGTTVKRATLHNFDEVARLDLHYGDTVGVEKGGEIIPKIT
FT                   DVKRELRPAGASPVVAPEKCPVCGEQLTHIDGEVILRCENLHCKAQVQCLFEHFVSREA
FT                   MNIENLGPALIASLLATGKIKRIPDLYRLTLEDLESQERMAKKSAKNVFDAIQASKQRS
FT                   LENLLHGLGIRFVGRTSARNIAKHFRTLEKIRTATVEELQNVTDVGERIGKSVYEFFHT
FT                   PLYTNEIDELVALGLPTEFKGVVKTLFQGQTAVITGTLPNMDRDEARKLIEENGGKVSG
FT                   SVSKKTSWVLAGEAAGSKLTKANELGIPVHDEAWLMAQIANADESGDAPDENAGSSAGN
FT                   FANEKASVSATPAEDQMSLNL"
FT   gene            complement(588382..589236)
FT                   /locus_tag="FSU_0530"
FT   CDS_pept        complement(588382..589236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0530"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM72904.1; match to
FT                   protein family HMM PF09603; match to protein family HMM
FT                   TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24885"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6N0"
FT                   /protein_id="ADL24885.1"
FT                   /translation="MCVDGIFRKATDIDKTGSVLELEKIANPCGEKEEVRRGKTDSTLY
FT                   FYCNNGEMGYSNEMEYTLGYGCNANHVGYHQYQNSIYYCNKFTWKYSTDSLVKGVLVDS
FT                   RDNSEYKTIGIGNQVWMAENLNYEVEPSWCYGDSLEYCEKYGRLYQWDGILGASAKVEN
FT                   VCPEGFHVPSNKEWDELNAFVNLWFHGNSYSARKVLLSSDPKEFDNIVHVGDDLVGFTG
FT                   IYAGHRTANGFFTGRLTSAYFCSADMNEEGSAYIYMLRQDEFDLTKYAQKTTSNCNVRC
FT                   VKD"
FT   gene            complement(589303..590499)
FT                   /locus_tag="FSU_0531"
FT   CDS_pept        complement(589303..590499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0531"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25515"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6N1"
FT                   /protein_id="ADL25515.1"
FT                   /translation="MNMKLNVLGIVLCLLALMGCSEVSKGVNIESEDNAPEYELNKLVG
FT                   VASFISSEDYNSIDRGGTKYEVTLYELDSSASWTGREFTTYVTYPNVFKFENLKLQSSN
FT                   VVMCVRNKMSKSGYWSFADLSRVDSVYVNFMTNMEYNRILYLMKKGIPSDSAERTAQHE
FT                   IMEYMLSTSLDIKLSNQIEGNEKDAELQAVWQMLSRIPYTRLSSQLSSDTAVFWMLETD
FT                   SAKIDTFKTKYADMIEGNLWVKSIPKTDYLVTKLSGYVFGQTNGLGECSDKNDGEVKKV
FT                   TNPLSRYVERPYMCSKDTGWICPNGTFQELYGIEKGHDGEVIKANFTSFSYAYDSLQGK
FT                   WVSAHVEQGFACVSSRFGMVLVSETMGKSSYLVCKAEDNAPDYLHWAATGSEEDYIAY"
FT   gene            complement(590505..591773)
FT                   /locus_tag="FSU_0532"
FT   CDS_pept        complement(590505..591773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0532"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26885"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN0"
FT                   /protein_id="ADL26885.1"
FT                   /translation="MIFSAKNKLIPIIVSVFGVNALLCSCSDDNLTSSNFPQIENSKET
FT                   THNIVGYVDRTRGYSMTEVVLREVDSTLSQTGVAYHGFVDDYSGHFSLENVKLTQPYVY
FT                   LEVNGNFYSNCYDANETEPMTNWKVLEAYADVRKGDSISVNLLTHMQAKRLKHYVDRGL
FT                   SFDSSMALLQKEISDLFLLDSLHEDFSKMNLSTLRDYNYYLLGVNVLNETYVWRSGGLD
FT                   DLLKEDVLTDSLFSTYWSYAYYFNHNSSCDKFDDFVPGFGYKTDAYKVKEYLNNIWQKK
FT                   YNLGNCSAENYHEIKATESNKTQFLYCDTLGWTLPRNGCYDLDMIVLNSSVGDTLPGHL
FT                   TKGTYCTDDYYKWGRMYDGSVGWTKASAAESGVGFACTKETLNRYGKSGRKCYRCEYSY
FT                   GYYLPDVDMSECDENLPKQEPLK"
FT   gene            592122..593441
FT                   /locus_tag="FSU_0533"
FT   CDS_pept        592122..593441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0533"
FT                   /product="CobW/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25831"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN1"
FT                   /protein_id="ADL25831.1"
FT                   /translation="MKSVPITLLTGYLGAGKTTLLNYVLNNQQGYHVAVIVNDIGEVNI
FT                   DQTLIEKGGNITKEDSGKVVPLSNGCICCSLKTDLIEQIAELLEMGKFDYILIEASGIC
FT                   EPIPIAQTISFAGSQLRSKDGRPLPCHLDNIVAVVDVLRLADEFAGGEKLLEEDLEEED
FT                   IANLLIQQIEFCNTIIMNKVDALSKHDLEHVKAVVKALQPTAKMIETNYGKVDMKDILD
FT                   TKQFDFNKVAESSTWAIKLNEEGHDNDDDDDDDHDEHEHHHHDHDDDHDEHEHHHHDHD
FT                   EHEHHHDHDDEDHSHCDHEHGVCHCGHHHDKDHPHGDEYGISTFVFEDHRPLNREKFEA
FT                   FLDDYPTSIIRTKGLLWFSDERSESYLFEQAGKQASAQNFGRWFAAESKAEQQRILEEN
FT                   PQLQKIWDEKYGDRIIRLVFIGQHMDKKKIIQVMKDCLDD"
FT   gene            complement(593541..594989)
FT                   /locus_tag="FSU_0534"
FT   CDS_pept        complement(593541..594989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0534"
FT                   /product="RmuC domain protein"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26660"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN2"
FT                   /protein_id="ADL26660.1"
FT                   /translation="MTIAVAIICAVLGIVIGVLFARNGNSQREAAARQANVEMEKEVAV
FT                   LRSQLATETVKNAELKENTEKQLEMVKADAEKRIADERAAAAKSLADEKEASAKRLESM
FT                   KLDMERVHQSSLNEQNARFTEMSQRLYAQAKNSTEEMLKQREKQISESGHATMEQLVSP
FT                   LKETIAKMEKTMNDTTRAQTEANSSLKEVLKQSIDANDKTKNAANELVRAFKHDSKIQG
FT                   DWGERVLEEVLESLGLEEGKHFDVQATLRDANGNVVRAEGNNAMLRPDVIVHLDPYKEV
FT                   VVDSKVSMAAFMDYMQAENPDERKVLLKKHIESLRKHVNELSVKDYSSYVKAPKKTMDF
FT                   VVMFVPRAAALWTALAEDHALWRDAFEKNVYIADEQSLYAMLRMVKMTWRQVQQAQNQQ
FT                   KVFELANEVLKRVGIFVKNMDEIGAALGKAQEAYNKGMAKLDDKGQSIVQSCRKLERLG
FT                   AKQDSKNPLPPDVDAIEMQEIEEM"
FT   gene            complement(595077..597389)
FT                   /pseudo
FT                   /locus_tag="FSU_0535"
FT                   /note="ankyrin repeat family protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00023"
FT   gene            complement(597390..598367)
FT                   /pseudo
FT                   /locus_tag="FSU_0536"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(598384..599154)
FT                   /locus_tag="FSU_0537"
FT   CDS_pept        complement(598384..599154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0537"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AC0074; match to
FT                   protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25275"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN5"
FT                   /protein_id="ADL25275.1"
FT                   /translation="MATKDPFALEPIPRRVTHLIFMVDTSGSMSGSKIASLNTAVRDAL
FT                   DDVGDISKNCGDSQIKIAVLEFSSAVNWMYEQPLEAEKFQWQDLSASGTTSFGSACAEL
FT                   DAKLSRSNGFMGEKTGCRAPAIVLLSDGAPTDGYVRKLEKLKGNRWFKAGVKVAIAIGD
FT                   DANNDVLREFTGSSESVITVHNVDQLKKMIHTVSVSATTVASQSASVGAAMVTQNQLVA
FT                   QSISNTVANDASLSGVDVGSSTANSGSNDWSGWN"
FT   gene            complement(599169..600482)
FT                   /locus_tag="FSU_0538"
FT   CDS_pept        complement(599169..600482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC08528.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26303"
FT                   /db_xref="GOA:D9S6N6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6N6"
FT                   /protein_id="ADL26303.1"
FT                   /translation="MKKKFLGGFMSELKKGDVVALAGGDTCQVVRELGRGGQGIVYAVN
FT                   YNGSEYALKWYTQKVSERFRENLKRNANRQTPNEHFIWPMAVAEDPNGGFGYLMKIRPA
FT                   GYVDMSKFILVTARFADVNAQLNACMQLVKSFLDLHRDGYSYQDMNDGNFFINPKTGDV
FT                   LICDNDNVAPDGTDDLGILGKAGYMAPEIVEGKSRPRKVTDYHSLAVCLFILIYMNRPF
FT                   EGRRYLSCPCDNDPEMARQLLGYNAVFIMDPNDKSNAPDPSLHKNVMRRWDIYPKVLRD
FT                   AFCKTFSKEALQNGDLRVKDKEWRDILLQVRADFVKCPKCGKFSFADPDSVDKKCAYCD
FT                   KSFGDYRMLRVGKFKIPLMMEQKLHECLVHCSTDYDKVVGRTVVKNNEVGLCNNSGESW
FT                   TVTCLDGTQRVVADGQGMPARKGYKIKFGNQGETAVIE"
FT   gene            600704..601444
FT                   /locus_tag="FSU_0539"
FT   CDS_pept        600704..601444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26914"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN7"
FT                   /protein_id="ADL26914.1"
FT                   /translation="MMNTHTTANEVMNLIDLAQHTKNGKEGSDAINKLWDIFGDKVTGI
FT                   TIKKSFSHDSDHSMHGMSVYERRNQLQEQAFDTFRNAVLTYDASTNVPFMAYVSKKINW
FT                   QQLDFKRKNAKHTHNEKATDFSIEGGSSISMDDPKNAEMLETMNHIDLESPMAGRFVED
FT                   FEKQSYLDDMVHVLFGKLQNEKKLLEFATTYYEVCQEEDKDTDAEVAKRMGCTRSYASQ
FT                   LHKKLIAFLSNTDFADDCRMALAA"
FT   gene            601788..603233
FT                   /gene="trpE"
FT                   /locus_tag="FSU_0540"
FT   CDS_pept        601788..603233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="FSU_0540"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by similarity to PIR:A39128; match to
FT                   protein family HMM PF00425; match to protein family HMM
FT                   PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24893"
FT                   /db_xref="GOA:C9RJN8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN8"
FT                   /protein_id="ADL24893.1"
FT                   /translation="MTKITHITERPGYAPRTDSIYVALPGERYTPFSLAKKLGAKAIFE
FT                   SASFDHGRSRYSTLMVDEGFRLRQNDKNVSIVVDGKESEFLAEGDGDILDALLKISAEN
FT                   TVPPNQIPIPSSGVGYLGYEFCARCDTIRLAPQVDELNIPEAEFLVGHIYIVFDHFTEK
FT                   LHLFALNYEEHQIDLKAAIEKVKARLADLDFSYLAPEKQYSKGITMTDLEQSRKEYVEK
FT                   VAALQKHIVAGNIVQAVPSRRIQFASDIEALDIYRRLRTVNPSPYMFFLDYGTHQFIGA
FT                   SPESLIRVREGIATIHPIAGTRRRGKDDAEDEALMKNLKGDPKERAEHLMLVDLARNDL
FT                   GRVCDAGTVETTKYMECEKFSHVIHLVSDVQGRVSKNKKAIEVLRSSFPAGTVSGAPKI
FT                   SAIEILSGLEKIKRRFYAGAVGYIESDGDLDFCIAIRCCLKQGKTISLQAGGGIVAASN
FT                   ADREFEETNEKLGAIRAVLEGEN"
FT   gene            603235..604830
FT                   /gene="trpD"
FT                   /locus_tag="FSU_0541"
FT   CDS_pept        603235..604830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="FSU_0541"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by similarity to SP:P00904; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF00591; match to protein family HMM PF02885; match to
FT                   protein family HMM TIGR00566; match to protein family HMM
FT                   TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26038"
FT                   /db_xref="GOA:C9RJN9"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJN9"
FT                   /protein_id="ADL26038.1"
FT                   /translation="MIIIIDNYDSFTYNVYQALAKITTEEIRVLRSRECTIADIEKLNP
FT                   SRLIVSPGPGRPEDAGISVEAIKHFAGKLPILGVCLGHQAIGYAFGAKIVQAKFIKHGI
FT                   AEEIDLDGKGLFRTIGKKNIFTRYHSLVIDESTLPGDFEVTARATDGDIMGIRHKTLPI
FT                   EGVQFHPESIASGRADEFFKAFLNYRREPLDIRGILNTLTAGKDLTRETAEMFMEDLTD
FT                   GIMDERQMAAILTALSSKGPVADEIAGCAKVLSSKKRKFPYSGDELTDIVGTGGDGKGS
FT                   FNVSSLSGLIAASCGAKIAKHGNRAVSSKSGAADFYTAAGFKLDMTPEKAASVIDKTNF
FT                   VFLMAPVYHSAMRFAGPVRGALGVKTIMNLLGPLTNPAEAKYLMLGVYSKSILEPFTKA
FT                   AKFLGAKRVMVAISDDGYDEISPCVPTTIAEILEDGEYREYRIDPKEFGVPAVDPEDLA
FT                   GGTGVDNFNLALDVLNGKGRPGIKYACALNAGAALYISNKAASIKEGFDKAIKAMEDGS
FT                   VLKKIEEVKVATNA"
FT   gene            complement(604951..605889)
FT                   /locus_tag="FSU_0542"
FT   CDS_pept        complement(604951..605889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO77137.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26756"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP0"
FT                   /protein_id="ADL26756.1"
FT                   /translation="MNARKSFRDCIVKPGETSPYANLLVDLAFKKAFDPDKPTSRNNLI
FT                   NLLNDLLEPQLKRPIKNVWTRSVAKNLSGSKASRTAIFDLHCKDDLGSLIEIEVQIREV
FT                   DNFMKRLAFYASEMVANQAEPGQYWDYDIQPTYVIALTRFSVFPDERAVHRATVIDLES
FT                   GEQLVDTYNFTAIELSKVPFFIEKTSSDLSKWLFFFRYLNRLKELPEELDEGKFKNLTE
FT                   SAKVSNFNKKEFEVYRNMYHKVWDHNAMRRGIFKEFADDINAKIEERISDRNREFAKKM
FT                   IELGKLSDEEIAATTDLSLEDIVVLRSQLEA"
FT   gene            606343..610881
FT                   /gene="csn1"
FT                   /locus_tag="FSU_0543"
FT   CDS_pept        606343..610881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csn1"
FT                   /locus_tag="FSU_0543"
FT                   /product="CRISPR-associated protein, Csn1 family"
FT                   /note="identified by match to protein family HMM TIGR01865"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24757"
FT                   /db_xref="GOA:C9RJP1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR032239"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP1"
FT                   /protein_id="ADL24757.1"
FT                   /translation="MKKILGLDLGTNSIGWAVVNADEITRDDGSRYLKPNGISAAGSRI
FT                   IPMSADILGDFEKGNSISQTAERTRMRMARRLHERALLRRERLLRVLNLLDFLPKHFAD
FT                   KIDRYGKFTDDSEPKLAWRKNTEGKYEFIFQDAFNEMLAEFKDKQPEIVEEGKKIPYDW
FT                   TIYYLRKKALEKALSKEELSWILLQFNQKRGYYQLRGEEEEIPQDKKIEYLAQKVVKVE
FT                   ATDQKKGDDVWYNVYLENGMIYRRTSKAPLDWEGKVKEFIVTTEVENDGETPKKDKEGN
FT                   IKRSFRAPKEDDWTLLKKKTEADIENSHKTVGCYIYDSLLNNPKQKIIGKLVRTVERKF
FT                   YKEELTQILKKQVELIPELRDDNLYKQCIEELYPINEAHRNTIAKTDFANLFINDILFY
FT                   QRPLKSKKSQIDNCPYEERIFIDSKTGEKKKVPVKCIAKSNPLFQEFRLWQFIQNLRIY
FT                   QREKEIDGKLLTDIDITSECLKSEEDYVRLFDWLNDRETIEQEDLLKHLFNTKKSKNKE
FT                   NPYRWNYVEDKVYPCNETRATILKGFSKCGINASVLSPELEMALWHILYSVEDKKEIET
FT                   ALTHFAQKQGWNDDFAKVFSKAKPFKKDYGSYSEKAIKKLLSLMRMGKYWNQDNIDKNT
FT                   LDRIDKIINGEYDEKISNRVRDNAINLKDISDFRGLPVWLACYIVYDRHSEAKDCTKWN
FT                   SPEEIDSYLKKFKQHSLRNPIVEQVVTETLRTVRDIWIQEEQIDEIHLELGRDLKNPAD
FT                   KRKKMSENILKNENTNLRIKAMLMEFMNPSMGIENVRPYSPSQQDILRIYEENALDNLT
FT                   KDDKDFDFISKISKQAQPSKTDIIRYKCWLEQKYRSPYTGKTISLSKLFTPAYEIEHVI
FT                   PQSLYFDDSFSNKVICEAEVNKLKDRQLGYKFIAEHHGEKVQLSQGEVVEILSVDAYEK
FT                   FVKENYANNRIKMKKLLMESIPDEFIERQLNDSRYISKVVKGLLSNIVREKIDDENYEP
FT                   EAVSKNLISCNGAITDRLKKDWGMNDVWNSIILPRFIRMNQITGKDCFTTTNAEGHLIP
FT                   QMPLELQKGFNKKRIDHRHHAMDAIVIACTTRDHVNLLNNEAAHSKFNATRYQLQRKLR
FT                   RFEKAVIDGKEREVAKEFLKPWDSFSSDSKNILENIIVSFKQNQRVINKTTNAFLHFDE
FT                   NGKKTFIKQGKGDSWAIRKSMHKDTVFGEINLRKVRSVSLNEAIKVPERVLNKKIKEKI
FT                   LELKNNKIDAKNIKKYIEENHTGGYGIDSSKIDVFYFTKETKERFFATRKTLDTSFNQA
FT                   KIKDSIADSGIQKILLAHLKSKNGDAEQAFSPDGIDEMNKNIVELNNGKFHQPILKVRV
FT                   YEKADKFAVGQKGNKKVKFVEAAKGTNLFFAIFEKDGKRSYLTIPLNVMIDCQKQYGNQ
FT                   WKNNIEAYLKEKELVEKDVKLQFILSPNDLVYLPTEGSIDKKRIYKVVSFTNNRLYAIP
FT                   YAIAKSIVDKNEFTQLNKIEFTDNKESIKDACVPVIIDRLGNVIEFNGKRL"
FT   gene            610878..611774
FT                   /gene="cas1_1"
FT                   /locus_tag="FSU_0544"
FT   CDS_pept        610878..611774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1_1"
FT                   /locus_tag="FSU_0544"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="identified by match to protein family HMM TIGR00287;
FT                   match to protein family HMM TIGR03639"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24929"
FT                   /db_xref="GOA:C9RJP2"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP2"
FT                   /protein_id="ADL24929.1"
FT                   /translation="MIKRTLYFGNQAYLSLKDNQLVIKKRNDEIVTAAIEDIAYIVLDS
FT                   PQITVTNALLGALLENNCAIINCDKTHLPSGLLLPLSGNTLQSERFQAQIDASLPLKKQ
FT                   LWQQTVQQKILNQAAVLHGSHDAEIGNMTAWANSVRSGDVDNREAVAAAYYWKEMFPDI
FT                   PDFVRDRNGVPPNNMLNYGYAILRGVVARALVSSGLLPTLGIHHHNRYNAYCLADDIME
FT                   PYRPIVDKLILEVINEIEEYPTDLSTEIKAKLLRIPVLDCVIDGNRSPLMNAVSTTTAS
FT                   LAKCYLGTTRKLLYPEV"
FT   gene            611803..612111
FT                   /gene="cas2_1"
FT                   /locus_tag="FSU_0545"
FT   CDS_pept        611803..612111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas2_1"
FT                   /locus_tag="FSU_0545"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="identified by match to protein family HMM TIGR01573"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25789"
FT                   /db_xref="GOA:D9S6P3"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D9S6P3"
FT                   /protein_id="ADL25789.1"
FT                   /translation="MWILCFFDLPTETKIERQRHSEFRKNLLKDGFSRFQLSIYVRHCA
FT                   SVENAEVHIARVKSFMPPDGSVSILCITDKQFGKIQVFYGRKEKPKPKSTGQLELFL"
FT   misc_feature    612214..614730
FT                   /note="CRISPR repeat region, Nmeni subtype"
FT   repeat_region   612214..612261
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3322"
FT   misc_feature    612262..612290
FT                   /note="CRISPR spacer"
FT   repeat_region   612291..612338
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3324"
FT   misc_feature    612339..612368
FT                   /note="CRISPR spacer"
FT   repeat_region   612369..612416
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3326"
FT   misc_feature    612417..612446
FT                   /note="CRISPR spacer"
FT   repeat_region   612447..612494
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3328"
FT   misc_feature    612495..612523
FT                   /note="CRISPR spacer"
FT   repeat_region   612524..612571
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3330"
FT   misc_feature    612572..612601
FT                   /note="CRISPR spacer"
FT   repeat_region   612602..612649
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3332"
FT   misc_feature    612650..612679
FT                   /note="CRISPR spacer"
FT   repeat_region   612680..612727
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3334"
FT   misc_feature    612728..612757
FT                   /note="CRISPR spacer"
FT   repeat_region   612758..612805
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3336"
FT   misc_feature    612806..612835
FT                   /note="CRISPR spacer"
FT   repeat_region   612836..612883
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3338"
FT   misc_feature    612884..612913
FT                   /note="CRISPR spacer"
FT   repeat_region   612914..612961
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3340"
FT   misc_feature    612962..612990
FT                   /note="CRISPR spacer"
FT   repeat_region   612991..613038
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3342"
FT   misc_feature    613039..613068
FT                   /note="CRISPR spacer"
FT   repeat_region   613069..613116
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3344"
FT   misc_feature    613117..613145
FT                   /note="CRISPR spacer"
FT   repeat_region   613146..613193
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3346"
FT   misc_feature    613194..613223
FT                   /note="CRISPR spacer"
FT   repeat_region   613224..613271
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3348"
FT   misc_feature    613272..613301
FT                   /note="CRISPR spacer"
FT   repeat_region   613302..613349
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3350"
FT   misc_feature    613350..613379
FT                   /note="CRISPR spacer"
FT   repeat_region   613380..613427
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3352"
FT   misc_feature    613428..613457
FT                   /note="CRISPR spacer"
FT   repeat_region   613458..613505
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3354"
FT   misc_feature    613506..613535
FT                   /note="CRISPR spacer"
FT   repeat_region   613536..613583
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3356"
FT   misc_feature    613584..613612
FT                   /note="CRISPR spacer"
FT   repeat_region   613613..613660
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3358"
FT   misc_feature    613661..613690
FT                   /note="CRISPR spacer"
FT   repeat_region   613691..613738
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3360"
FT   misc_feature    613739..613767
FT                   /note="CRISPR spacer"
FT   repeat_region   613768..613815
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3362"
FT   misc_feature    613816..613845
FT                   /note="CRISPR spacer"
FT   repeat_region   613846..613893
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3364"
FT   misc_feature    613894..613922
FT                   /note="CRISPR spacer"
FT   repeat_region   613923..613970
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3366"
FT   misc_feature    613971..614000
FT                   /note="CRISPR spacer"
FT   repeat_region   614001..614048
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3368"
FT   misc_feature    614049..614077
FT                   /note="CRISPR spacer"
FT   repeat_region   614078..614125
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3370"
FT   misc_feature    614126..614155
FT                   /note="CRISPR spacer"
FT   repeat_region   614156..614203
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3372"
FT   misc_feature    614204..614232
FT                   /note="CRISPR spacer"
FT   repeat_region   614233..614280
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3374"
FT   misc_feature    614281..614310
FT                   /note="CRISPR spacer"
FT   repeat_region   614311..614358
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3376"
FT   misc_feature    614359..614388
FT                   /note="CRISPR spacer"
FT   repeat_region   614389..614436
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3378"
FT   misc_feature    614437..614465
FT                   /note="CRISPR spacer"
FT   repeat_region   614466..614513
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3380"
FT   misc_feature    614514..614543
FT                   /note="CRISPR spacer"
FT   repeat_region   614544..614591
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3382"
FT   misc_feature    614592..614621
FT                   /note="CRISPR spacer"
FT   repeat_region   614622..614669
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3384"
FT   misc_feature    614670..614698
FT                   /note="CRISPR spacer"
FT   repeat_region   614699..614730
FT                   /rpt_family="CRISPR"
FT                   /note="FSU_3386"
FT   gene            615189..616049
FT                   /locus_tag="FSU_0546"
FT   CDS_pept        615189..616049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0546"
FT                   /product="putative sulfite reductase"
FT                   /note="identified by similarity to SP:P26476; match to
FT                   protein family HMM PF00037; match to protein family HMM
FT                   PF01077; match to protein family HMM PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26620"
FT                   /db_xref="GOA:C9RJP4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP4"
FT                   /protein_id="ADL26620.1"
FT                   /translation="MAVDYSTLKKGGWMRQKQKNNFSLRVRVVGGNLTATQLAKIAEVA
FT                   EKYGEGYAHLTSRQSVEIPFIKLENIDDVKNALAEGGVEPGVCGARVRTITACQGEAVC
FT                   PSGCIDTYAIAKELDDRYFARELPHKFKFGVTGCQNNCLKAEENDVGIKGAIKVDWLED
FT                   KCIGCGLCAKVCRKEAIKIENKKVIFDKEKCNYCGRCYKSCPTDAWSHIHGYIVSFGGL
FT                   FGNNINKGETIIPFVEDKQKLLDICDAAIQFFADNGKSGERFKYTIDRVGRDVFAKKIQ
FT                   DVYNG"
FT   gene            616093..617856
FT                   /locus_tag="FSU_0547"
FT   CDS_pept        616093..617856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0547"
FT                   /product="putative adenylylsulfate reductase, alpha
FT                   subunit"
FT                   /note="identified by similarity to GB:CAA93322.1; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26758"
FT                   /db_xref="GOA:C9RJP5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP5"
FT                   /protein_id="ADL26758.1"
FT                   /translation="MNIEKIKTDLLIIGGGTAGCYAAITASTLGAAKDVADIKILVVEK
FT                   ANIKRSGCLAAGVNALNAYITEGRTPKDYVEYAKKDADGIVREDLLYSISEKFNEVTAH
FT                   LEKLGLVILKDKDGKYVTRGNRNIKINGENIKPILAAAVAKAPNVQVLNHVNIFDFSVH
FT                   DNRIDGAFGFGIENDTFYAIEARAVIIATGGAAGLYRPNNPGFSRHKMWYPPFNTGAGY
FT                   AMGIRHGAEMTTFEMRFIALRCKDTIAPTGTLAQGVGAKQINSLGEVYETKYGISTSER
FT                   VYGTVAENLEGRGPCYLRTVGITPAQEDSLLKAYLNMAPSQTIRWLENETPSKANVEIE
FT                   GTEPYIVGGHTASGYWVDTKRATTIDGLYAAGDVAGGAPQKYVTGALAEGEIAAKSAVE
FT                   YINAVDCRTPLQGVRNDVDADPREDVDAKATIKEAEIARHVAEIETYLSQKNSLYTTEQ
FT                   LEEAMQIAMDEYAGGIKTGYGYSEKHLNIAKEKIDEIESLTDKLSAADLQEVMYIYELK
FT                   ERLTVCKSVIAHLKARHETRWHSFAENLDYPEKDNANFRKYVNSRLENGEIKIILRDLT
FT                   AEGQKNYEHQH"
FT   gene            617840..618154
FT                   /locus_tag="FSU_0548"
FT   CDS_pept        617840..618154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0548"
FT                   /product="ferredoxin"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25418"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP6"
FT                   /protein_id="ADL25418.1"
FT                   /translation="MSISIDQSKCIGCRRCHDVCPGTLIKINEDKKAFIKYPKDCWGCT
FT                   SCIKECPVHAIQFFLGEDIGGKGSKVHTEKVNGLIRWIVEFPDGNVKSIDIDPKESNKY
FT                   "
FT   gene            618165..619064
FT                   /gene="cysD"
FT                   /locus_tag="FSU_0549"
FT   CDS_pept        618165..619064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="FSU_0549"
FT                   /product="sulfate adenylyltransferase, subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="identified by similarity to SP:P21156; match to
FT                   protein family HMM PF01507; match to protein family HMM
FT                   TIGR02039"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26074"
FT                   /db_xref="GOA:C9RJP7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP7"
FT                   /protein_id="ADL26074.1"
FT                   /translation="MSEFSHLDELEAEAIYIIREVAAECEKPVMLYSIGKDSSVMLHLA
FT                   IKAFYPEKPPFPFLHVNTTWKFREMIEFRDRTAQKLGIEMLEYINQDGVKQGINPFDHG
FT                   AAYTDIMKTQALKQALNKYGFTAAFGGGRRDEEKSRAKERIFSFRNSAHAWDPKNQRPE
FT                   MWKLYNTKINKGESIRVFPISNWTEKDIWQYIKRENIDIVPLYFAAPRPVVVRDGNIIM
FT                   VDDERFPLREGEKPEIKSVRFRTLGCYPLTGGIESTATTLDEIIDETLSAVSSERTSRV
FT                   IDNEAAGSMERRKREGYF"
FT   gene            619064..620749
FT                   /gene="cysN"
FT                   /locus_tag="FSU_0550"
FT   CDS_pept        619064..620749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="FSU_0550"
FT                   /product="sulfate adenylyltransferase, subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /note="identified by similarity to SP:P23845; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM TIGR00231; match to
FT                   protein family HMM TIGR02034"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27033"
FT                   /db_xref="GOA:C9RJP8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP8"
FT                   /protein_id="ADL27033.1"
FT                   /translation="MKGLLKFITCGSVDDGKSTLIGHILYDSKLLYTDQEKALELDSKV
FT                   GSRSGKIDYSLLLDGLMAEREQGITIDVAYRYFTTDHRSFIVADTPGHEEYTRNMAVGA
FT                   SFADLAVILVDASQGVLVQTRRHARICRLMGIRHFVFAVNKMDLVGYSEDVFNKIKVQI
FT                   AELAQTHSLSNIQVIPLSATEGDNVTIKSKNIAWYQGPALLEYLENVDTSSSALEKGFY
FT                   MPVQRVSRPDRTFRGFQGQIESGTIRVGDVIKSLPSYEKASVKSILYTNRNVEEAHAGE
FT                   PVTITLDREVDVSRGCVLARDASIGSYKKIKASLLWMDDEPLSLGKDYLVKIGTKIIPG
FT                   TLTKIDYAIDVNTGAHLETESISKNGIAVCEIVFAEAIVVDLFEKHKTLGELILIDIVT
FT                   HATAACGVVEGLYEKQLQSNEKAAFVQGERHGRGEIFEEFFYDTATLSVVKQQPVKQHY
FT                   TVGDEIPTAGESYHYPDDFDIIILRDSIAVKVRGKRIAEITTAEEYHYGNVPVINGRGF
FT                   EIKVHSDEDVKQLLNEYEKAGIAGREEFFRKWASFNTYRKVVLH"
FT   gene            620971..621990
FT                   /locus_tag="FSU_0551"
FT   CDS_pept        620971..621990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25953"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJP9"
FT                   /protein_id="ADL25953.1"
FT                   /translation="MNQTISKILITTALVSSICSAAESANESTFKLTGNVQAQAIKSLY
FT                   DNDADNTLDNSFLRANIGAKYNSENLSAVINLRIFSPAFGNTIEGKNYDKISADTYYAN
FT                   YKWDTEYGKFNVQFGRFRTDWSVGGNFGTYVDVALNKRGFLARDYQHDAFAFGFEKGIS
FT                   TFNALLGTYDAKFNTGYIRFEETLKFGDAKVSAAYRVNALDVIQHTAQLTHRAAARASY
FT                   YFQKNFGLYGEVALIATGDGENLKAANAIKPEYAQDTQYIPFFVGVEIPTAGIFNNVYA
FT                   ELEYVSHRDELQAGADGIAWTVSFIKKINDYSKIQVNVYSEKKASDVALAARFTASLK"
FT   gene            622102..623121
FT                   /locus_tag="FSU_0552"
FT   CDS_pept        622102..623121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0552"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="identified by similarity to SP:P06997; match to
FT                   protein family HMM PF01547; match to protein family HMM
FT                   TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25126"
FT                   /db_xref="GOA:C9RJQ0"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ0"
FT                   /protein_id="ADL25126.1"
FT                   /translation="MNFKKITIASIALLSIAFTACSSSDSKTESTKQTLTNVSYDPTRE
FT                   LYANYNQVFAKHWKEKTGKDVEITQSHGGSGKQALEVANGLEADVVTLALEYDVNAVRD
FT                   AGLIEDGWVKEFPLNSAPYTSTIVFLVRKGNPKNLKDWGDLVKDGIGVITPNPKTSGGA
FT                   RWNYLAAWAWAEKQYNGDEAKVKEFVKKLYKNVLVLASGARGSTTTFIENGQGDVLLAW
FT                   ENEAFLSLKDYPNDYEIVIPSVSILAEPSVAIVDKVVDKRGTRELATEYLNFLYSDEGQ
FT                   HIAAKNHYRPSNKAILDQYKEFDQNVNLIDISYFGGWDKAQKTHFSNGGIFDQIYEKK"
FT   gene            623277..624110
FT                   /gene="cysT"
FT                   /locus_tag="FSU_0553"
FT   CDS_pept        623277..624110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="FSU_0553"
FT                   /product="sulfate ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P16701; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR00969; match to protein family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25361"
FT                   /db_xref="GOA:C9RJQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ1"
FT                   /protein_id="ADL25361.1"
FT                   /translation="MKRTNRSVIPGFGLTTGITLAILGVVVLIPLASLVVFTAQMSFDE
FT                   IIETITRDRVLSSFRVSFTTAFIASFINAVMGIILAWVLVKYTFPLKRLIDGMIELPFA
FT                   LPTAVAGIALTALTADTGLVGGFFAKFGIKIAFTQIGITVALVFIGIPFVVRAVQPVLE
FT                   KLDPAYEEAAGVLGASRGRIFWKVIFPEIVPAALTGFGLAFGRCLGEYGSVVFIAGNKP
FT                   FETEIAPLIIMSELQEYDYASATTIALVMLVASFVTLFLVNLIQTRNTKILKGGA"
FT   gene            624110..624931
FT                   /gene="cysW"
FT                   /locus_tag="FSU_0554"
FT   CDS_pept        624110..624931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="FSU_0554"
FT                   /product="sulfate ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P16702; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR00969; match to protein family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27285"
FT                   /db_xref="GOA:C9RJQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ2"
FT                   /protein_id="ADL27285.1"
FT                   /translation="MYKETTSSKIVKWSLIGISIAFVVLMLLLPLITVIAEAFKQGFDI
FT                   YAKAVSDNYTIKAIWLTLEATLLAVIINTVFGLSAAWSLTKFHFKGKKILTTLIDLPVT
FT                   VSPIIAGLIFLLTFGRQSPIYPLLQSWDIKIVFAVPGIVLATIFVTFPFISRELIPVLE
FT                   ARGNDEEEAAALMGAKGWTIFRKITFPHIKWAFLYGVVLCAARAMGEFGAVSVISGHLR
FT                   GKTNTLPLHVEILFNEFQYVPAFAVSSILVMLAIAILIARSAIEYRGRKKI"
FT   gene            624943..626001
FT                   /gene="cysA"
FT                   /locus_tag="FSU_0555"
FT   CDS_pept        624943..626001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="FSU_0555"
FT                   /product="sulfate ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P14788; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF08402; match to protein family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27268"
FT                   /db_xref="GOA:C9RJQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ3"
FT                   /protein_id="ADL27268.1"
FT                   /translation="MYVELKNINKHFGNFKASDNVSFGIEKGKLIGLLGPSGSGKTTIL
FT                   RMIAGLENPDSGEIIIDGKVINNVPASKRGIGFVFQSYALFRYMTVFENIAFGLRVLKK
FT                   SENEIKERVAELVKLIGLEGLENRYPSQLSGGQRQRVAFARALAPNPQLLLLDEPFAAI
FT                   DAKVRQELRHWLKEMIAKLGVTSIFVTHDQDEAIEVADEIIITNKGRIDQIGKPLEVYS
FT                   KPKTAFVASFFGQPSIFKDYNKFHSFDTIPNVDQAIVRPEFVKVTKKNEVQKFKNSAEE
FT                   GVVTDVAFRGSGIEITVLVNGETLTARRSFDEPSISVGEKVDVFIYRLFVTVGNYAFLL
FT                   ENKSIREPIVVI"
FT   gene            626129..626425
FT                   /locus_tag="FSU_0556"
FT   CDS_pept        626129..626425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0556"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26692"
FT                   /db_xref="GOA:D9S733"
FT                   /db_xref="UniProtKB/TrEMBL:D9S733"
FT                   /protein_id="ADL26692.1"
FT                   /translation="MASGISAMKNFLVSTKDRIVKKLQSFSFRTGIIVLLLCIPFYILS
FT                   FAQMTLPISAEAKGVLWVVLFGLAKTFQYSGLSILGVEGVKRLKNFFKKKSAA"
FT   gene            complement(626441..627070)
FT                   /locus_tag="FSU_0557"
FT   CDS_pept        complement(626441..627070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25637"
FT                   /db_xref="UniProtKB/TrEMBL:D9S734"
FT                   /protein_id="ADL25637.1"
FT                   /translation="MTRKNPWTNAVNHPHKILIFRAMALSANITREGALELLKKYNKDP
FT                   FHLEHGEIVENTMRYFARELGYGEDEEFWGIVGLLHDLDFELWPEQHCIKERELMQEAG
FT                   LSEELIHATTSHGWSITVDVKPEHEMEKVLYAVDELTGLIGAVVLMRPSKSVQDLELKS
FT                   VLKKYKSPKFAAGCSREVIERGANILGWELNDLISRTIAALKTFRP"
FT   gene            627331..628686
FT                   /locus_tag="FSU_0558"
FT   CDS_pept        627331..628686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0558"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="identified by similarity to PIR:T44655; match to
FT                   protein family HMM PF01053; match to protein family HMM
FT                   TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27178"
FT                   /db_xref="GOA:C9RJQ6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ6"
FT                   /protein_id="ADL27178.1"
FT                   /translation="MTKNTSKKKIESAKNTANVTDPSKWNFATKCLQAGWKPKIGEPRV
FT                   LPIFQSTTYKYEDVDEVERLFALKQSGNKYTRTGNPTVAAFESKITELEGGVGAVATAS
FT                   GQAAVLLAISNLVKAGDHIVASKTIYGGSYTLLSVRLSKLGIETTFIDPEDSIAELRKA
FT                   FRPNTKLIFGETIGNPALGILDFEKFSKLAKEFDVPFLVDNTLATPFLVKPLKLGANVV
FT                   IHSATKYIDGHAVALGGVVIDGGNYNWENGKFPDLVEPDAQYANTSYTQKFGRAAFIAK
FT                   ARAQFLRDYGAALSPFNAFLLNLGLETLHLRMPQHSNNALALAEFLSKHPAVNWVSYPG
FT                   LKSSPYFKRIRKYFDYQGGSGVLTFGLKGGRAAIRSFVKALKVAALVVHVGDARTSVLH
FT                   PATSTHSQLSPKDRLAAGIPEDMIRVSVGIEDPRDIIADFEQAIAASTKGGK"
FT   gene            628686..629645
FT                   /locus_tag="FSU_0559"
FT   CDS_pept        628686..629645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE27786.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25125"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ7"
FT                   /protein_id="ADL25125.1"
FT                   /translation="MSIVVDVNKYLALNGATKRIKDYLSIEVADHAYLPKTEDIKSDWV
FT                   AYIAAPAFKLIREKLGHDIDSFVSIGTGSGIDVLTGIELLGAKRVGFTDLQRSVVAAAA
FT                   QNVRSNIKETSKIEFEFGNGDLLQPLQNGKRNYDVIYENLPNVPLASNTKIEDKRNSGH
FT                   YLEKREEAIPEFVHEQMLDLHYLALKQARDYLAENGAVYSTLGGRVPLNAFIKLGELAG
FT                   LRSEIFTYSWKVQAEPEDVISGYAAQEKAGLGPFRFYRAEDLQKAFANISVKDSGKRAF
FT                   EIEKTLDSVKLTATAAYEAFKKGEVIGHTVAVLKSSLK"
FT   gene            629653..630255
FT                   /locus_tag="FSU_0560"
FT   CDS_pept        629653..630255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE27785.1; match to
FT                   protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27064"
FT                   /db_xref="GOA:C9RJQ8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR031723"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ8"
FT                   /protein_id="ADL27064.1"
FT                   /translation="MKNVIQNLIEESQKFLFKRAKIDDKIGLEAANFAVRDIPKPIGKF
FT                   EKSDSPLIRYIGEAIKHGNPETADLLKALEPALPYLPWKYNYEPRPDMPDLADQMGWGE
FT                   ILGPEAPYHDEHFCFGFTLLGKNTFYPSHLHPATELYVILSGHAIWTLDGISKVRSPGE
FT                   FVLHPSNHIHSMQTEHEPMLALYTWSGKDVKTLSKYV"
FT   gene            630379..630930
FT                   /locus_tag="FSU_0561"
FT   CDS_pept        630379..630930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0561"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01CA0536"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27261"
FT                   /db_xref="GOA:C9RJQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJQ9"
FT                   /protein_id="ADL27261.1"
FT                   /translation="MYSTHYMDLLMQNSPWNLILFMAIPVILAETIAITELFLLKSPNA
FT                   HPTLSKVNRTAGILAGFAFFGIIIYFIPNVIIPLASAGEFRTWIDVVAIFSYILAGIPM
FT                   ILLALLNLKLLFRKVVEQKKTTYAILLLAAFLVLSHIAMIFGMVDPGIAGYKPKAKAVS
FT                   EVQPPAHHMDSMHEGHHYHH"
FT   gene            631050..632039
FT                   /locus_tag="FSU_0562"
FT   CDS_pept        631050..632039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0562"
FT                   /product="putative biotin synthase"
FT                   /note="identified by similarity to SP:P53557; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   PF06968"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24697"
FT                   /db_xref="GOA:C9RJR0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR0"
FT                   /protein_id="ADL24697.1"
FT                   /translation="MTITDYLTKDWDESKTLTREECLQILNFPDNQLDLLIEAAFKLRT
FT                   KYKGNRVNIQLLTNVRSGNCTQNCAYCAQSRDSQAPIEKYKSVSDDKLYGDNNLVDEFH
FT                   LSRHCIGLSGMGFTDKEIEELAERIAHMKKSGTHICCSIGFLTEHQARILKAAGLDRIN
FT                   HNLNTSRRFYPEICSTHTYERRIQNIRMLQSIGFEICCGGIIGMGESKEDVVDMLFDLV
FT                   AIHPESVPINFLLPVKGTRLANRDISGLTFEYGIKILCLARLLLPKSDIRCAAGREIYF
FT                   KGHEKELFKVADSIFASGYLTEGGQSLEATFRQIENAGFTWAIESKDE"
FT   gene            632059..632655
FT                   /locus_tag="FSU_0563"
FT   CDS_pept        632059..632655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0563"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25640"
FT                   /db_xref="GOA:D9S740"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D9S740"
FT                   /protein_id="ADL25640.1"
FT                   /translation="MSLEVALSLLLYAFVSGITPGPANLCSLSVAMGSGKSVAIKQWYG
FT                   LFTGYTIVSLVSVFIVYFISSAFENFIRVFAFVGAIYIAYLAISLLIQAFKPLEEIRNS
FT                   RTTGSFSTGLFVQLTNVKIMVFCLTAITTYILPYHQDFPHLLLFGILLPLTGPICNLAW
FT                   LFTGVLLQGLFKKHHRIFYTLMGLSLLYCAIGIVK"
FT   gene            632742..633767
FT                   /gene="sbp"
FT                   /locus_tag="FSU_0564"
FT   CDS_pept        632742..633767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="FSU_0564"
FT                   /product="sulfate-binding protein"
FT                   /note="identified by similarity to SP:P06997; match to
FT                   protein family HMM PF01547; match to protein family HMM
FT                   TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26688"
FT                   /db_xref="GOA:C9RJR2"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR2"
FT                   /protein_id="ADL26688.1"
FT                   /translation="MNLHFFKTVFAVALVAGAGCFFGCSSEKAPEVENNTLVNVSYDPT
FT                   REFYSNYNHIFMKHWKEATGKDVKITQFHGGSGKQALEVVNGLEADVVTLALEYDVNIV
FT                   RDAGLIENGWVKEFPRNSAPYTSTIVFLVRKGNPKKISDWNDLVKDGIGIITPDPKTSG
FT                   GARWNYLAAWAYAEKQFNGDEEQVKGFMKKLYQNVLDLASGARGSTNTFIEERKGDVLL
FT                   SWENEAFLSLKDYPKDYEIVMPSVSVLAEPSVAIVDKIVDKRNTRKLATEYLNYLYSDE
FT                   AQHVAARHHYRPTNKAILDEYKEFDQNVNLITIEHFGGWENAQKTHFSEYGIFDQIYEK
FT                   N"
FT   gene            633974..635203
FT                   /locus_tag="FSU_0565"
FT   CDS_pept        633974..635203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0565"
FT                   /product="Cys/Met metabolism PLP-dependent enzyme"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27092"
FT                   /db_xref="GOA:C9RJR3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR3"
FT                   /protein_id="ADL27092.1"
FT                   /translation="MDFNTTLLHHNFESERSTGSTLTPIYQVSAFSQESAEKLEAVFNN
FT                   RAPGFAYTRIGNPTTDSFERRIASLEKGIGAIACSSGMAAVTMSLLNILQSGDEVIAST
FT                   ALFGGTIDLFHDLEAFGIKTRYVTEVTAESVRSQLSDKTKAVFTELIGNPKLNVVDIQS
FT                   VADVAHEAGVPLIVDSTTATPYLVHPFDFGADIVVHSSSKYINGNGSAISGIIVDSGKF
FT                   KWDYTKYKGLEEYKRFSKFAYLAKLRNGVWRNIGCCLAPATAFLNSLGLETLGLRMERL
FT                   CDNALQLAEFLQGFEGIKVNYPALKGNPYYDLVQKQFNGKGGAIISIDAGSKEKAFKLI
FT                   NNLKYATIATNIGDLRTLVIHPDSTIFTHSTKLQKENAGVFEGSIRISVGIEDIADLKE
FT                   DFEQAIKQIS"
FT   gene            635334..635582
FT                   /locus_tag="FSU_0566"
FT   CDS_pept        635334..635582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:O29697; match to
FT                   protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26311"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR4"
FT                   /protein_id="ADL26311.1"
FT                   /translation="MSEEIKVDDTVDVTDVKCPTTFVKAKVAIEELDEGQILAIRLNDG
FT                   EPVQNVPRSLKEEGHEILKLNDNQDGTFTLFVKKVGD"
FT   gene            635655..635861
FT                   /gene="thiS_2"
FT                   /locus_tag="FSU_0567"
FT   CDS_pept        635655..635861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS_2"
FT                   /locus_tag="FSU_0567"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26177"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR5"
FT                   /protein_id="ADL26177.1"
FT                   /translation="MIITVVGNKKEVKDGLTVAELIEQEKVETPQYVTVSVNDEFVENG
FT                   NFATTALKDGDNVEFLYFMGGGQ"
FT   gene            635861..636670
FT                   /locus_tag="FSU_0568"
FT   CDS_pept        635861..636670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0568"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25239"
FT                   /db_xref="GOA:C9RJR6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012731"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR6"
FT                   /protein_id="ADL25239.1"
FT                   /translation="MAFTNEQLERYSRHIILKEVGAKGQKKLLNAKVLVIGAGGLGAPV
FT                   AMYLAAAGVGTIGIADADVVDLSNLQRQIIHATKDVGKPKVQSAKETMEAMNPDVKVIT
FT                   YHTFVTSENIMDLIKDYDFIIDGTDNFPAKFLINDACVMAKKPFSHAGIIRFQGQLMTY
FT                   VPGQGPCYRCVFKEPPPKDAVPTCKQAGVIGAMGGVIGSLQAMEAIKYILGVGNLLTGY
FT                   LLTYNALTMEFRKIKLPTHTKDCAVCGDHPTIDHLIDYEQAVCEMKH"
FT   gene            636680..637090
FT                   /locus_tag="FSU_0569"
FT   CDS_pept        636680..637090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0569"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="identified by similarity to GB:CAE10107.1; match to
FT                   protein family HMM PF01398"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24564"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR7"
FT                   /protein_id="ADL24564.1"
FT                   /translation="MITISKDDYQKILEHAQKNLPEEACGLIAGKIEGNDKHIEKVYLL
FT                   TNIDHSNEHFSLDPKEHLAAIKDMRQNGLSPLGNWHSHPESPSRPSQEDKRLAFDSKAS
FT                   YLILSLMDRENPVLNSFHIEGDNATNEGLVIG"
FT   gene            637170..637550
FT                   /locus_tag="FSU_0570"
FT   CDS_pept        637170..637550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0570"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="identified by match to protein family HMM PF01398"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27280"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJR8"
FT                   /protein_id="ADL27280.1"
FT                   /translation="MMAKYSKNIYEQMVLAAKKAYPNECCGILVGKKSEQSEIEVTEIR
FT                   EAENQFQGQKAVHFKIDPLYLYHLEQELDPRGLEIVGIYHSHPDCPAILSKEDEKYMVP
FT                   GLEYVIMSVQNGEVVDVKSYRK"
FT   gene            637633..637989
FT                   /locus_tag="FSU_0571"
FT   CDS_pept        637633..637989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24730"
FT                   /db_xref="UniProtKB/TrEMBL:D9S748"
FT                   /protein_id="ADL24730.1"
FT                   /translation="MIIVCRFTSNIKMRSKRIMSSNTKVHTQGKKYILMESVFPEAFMT
FT                   YSEIEEKIRKVPEEYLAIIDAFIDGLMIQHQMKKKPSDELTAAIKESEAMLNDPNAKKF
FT                   DSVDALFADLDAEE"
FT   gene            637990..638265
FT                   /locus_tag="FSU_0572"
FT   CDS_pept        637990..638265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0572"
FT                   /product="conserved hypothetical protein TIGR00053"
FT                   /note="identified by similarity to GB:AAM75239.1; match to
FT                   protein family HMM PF05016; match to protein family HMM
FT                   TIGR00053; match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25503"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJS0"
FT                   /protein_id="ADL25503.1"
FT                   /translation="MAYQIEYTSRFKKEYKLAKKRGRDINLLRTVIEILAKGEPLPEKY
FT                   KDHPLVSNWSGYRECHIQSDWLLIYKYKDNELILSLTATGSHSDLF"
FT   gene            638781..639953
FT                   /locus_tag="FSU_0573"
FT   CDS_pept        638781..639953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0573"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00581;
FT                   match to protein family HMM PF00899; match to protein
FT                   family HMM PF05237; match to protein family HMM TIGR02356"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26009"
FT                   /db_xref="GOA:D9S750"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR012731"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9S750"
FT                   /protein_id="ADL26009.1"
FT                   /translation="MISDERRKEVAFDDSEIERFGKHLMLKDIGVKGQKRIKAAKVVVI
FT                   GVGALGSPVIQYLAAAGVGTIKAIDFDEVSLENLQSQVLHGTRDVKRPKVASAKDKVKN
FT                   INKNIVFEAVKEQLDASNIEAEIEGYDLVIDCTDNYKARYLINDACALHGIPLVFGAIY
FT                   QFEGQVGIFNLDGGPCLRCQYPSPPPAGLIPSCAEGGAISPLPGIIGSIQANEALKLIL
FT                   GIGEHLNGKILHVDSLYLSSRIFKVERDCHCPICGNNPTITNVEDIDYEDLCGLKTTNE
FT                   TPVEGFTPEELAKRIDNGDDITIVDVREPHERAILRFPNAIVIPIGQLVRRQKELDPNK
FT                   DTIFICKQGKRSELAINTLREAGYTGPLYNLKGGIDAMKDIMFSHEGAWL"
FT   gene            640109..641071
FT                   /locus_tag="FSU_0574"
FT   CDS_pept        640109..641071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE26866.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24803"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJS2"
FT                   /protein_id="ADL24803.1"
FT                   /translation="MANEAEKNTGINALGAKAAYNLANVTKTKPQFGALTPKWLTKFLE
FT                   FKGLETGLFRVNKVVEGQTPLDVLCSATKKSDIIPEGYVEYETEPREYKLNSISTIINV
FT                   NTAIEDVYSSPYDQVQEQLGLAIESLRERQESQLINNDDYGLLKNIADSQRIQPLRADG
FT                   RPTPDDLDELISKVWKEPSFFLAHPRAIAAFARECTRRGVPPVVVDLAGSRFLTWRGIP
FT                   LVPTDKLLVDGVKNPKSQGGKTNILLVRTGEAKRGVIGLFQAGLKNEHSRGLSVRFRGI
FT                   DNKGVASYLLSLYCSAAILADDAIAVLEDVEVGEYYDYE"
FT   gene            641535..642800
FT                   /locus_tag="FSU_0575"
FT   CDS_pept        641535..642800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0575"
FT                   /product="cysteine desulfurase SufS"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24940"
FT                   /db_xref="GOA:D9S752"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9S752"
FT                   /protein_id="ADL24940.1"
FT                   /translation="MKTGSANSGANSRNDSIRIGSKTLAQIRSDFPILSKQINGHPLVW
FT                   LDNGATTQRPQVVIDRLKYYYENENSNVHRGAHTLAAASTDAYENARNIVRDFIGAPSS
FT                   QEVVFVRGTTEAINLVANAYVKPTLQPGDEIIVSILEHHANIVPWQLIAEETGAIIKVI
FT                   PCDSTGQLKLHDYEALFTKRTKFVSVTHVSNVLGTVTPIEELIAIAHRHGVRILIDGAQ
FT                   SIAHIPVNVAALDADFFVFSGHKVFAPTGIGVVYGKKELLEAARPYHGGGNMIADVTFE
FT                   RTIYNGIPNKFEAGTGSIADAVGLGAALQYLTEIGMPCVFRWEHELLQYGLKELKTVKG
FT                   IHLVGTALNKASALAFKLDGYSDEEVGKRLDAYGVAVRTGHHCAQPVLRHFGYESTVRP
FT                   TLALYNSPDDIDALVRALKTFA"
FT   gene            642949..643911
FT                   /locus_tag="FSU_0576"
FT   CDS_pept        642949..643911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0576"
FT                   /product="putative serine acetyltransferase"
FT                   /note="identified by similarity to SP:Q59967; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27124"
FT                   /db_xref="GOA:C9RJS4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJS4"
FT                   /protein_id="ADL27124.1"
FT                   /translation="MHELIQESEVEKAVQIIFDDYNRGKHIDNIDIYNRPDQAEIQTIL
FT                   QNLIRVVYPGHFRDRSHKIYNPKNSFAVLIEDTFYHLHKQVAIALDYCKLRGSMTSDER
FT                   KIESYRICKEFFAKIPQIREFLETDLHAAFDGDPAAGCLDEIILAYPGLMATTIYRIAH
FT                   ELYLLHVPVLPRLMTEYAHSKTGIDIHPGATIGKYFFIDHGTGIVIGETAVIGKNVKIY
FT                   QGVTLGALSTRGGQKLSGKKRHPTIQDNVTIYAGASILGGDTVVGENAIIGGNAFITRS
FT                   IEANTRVSLKNLEMDYVSTTNSKHKTEELQQSDEWYYII"
FT   gene            complement(644028..645797)
FT                   /locus_tag="FSU_0577"
FT   CDS_pept        complement(644028..645797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0577"
FT                   /product="putative pectate lyase"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26594"
FT                   /db_xref="GOA:C9RJS5"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJS5"
FT                   /protein_id="ADL26594.1"
FT                   /translation="MNYLLSKTMRVAATFAALAVTTAAVPAFAVTSPDFPMAGFATQNG
FT                   GTTGGKGYSEVTVDNVNDLKSYAKAGNKIIYVKPGTYMGPVEVGSNVTIYGYQGAIIAQ
FT                   PASGSAMKLSGSKNVIIRNLKFKGVGAHDDDDEDCLQVNHESKNVWIDHVDVYDGHDGN
FT                   LDITNASDYVTISWTKFSYTSASTGHQFSNLIGNSKTKTSDRGHLNVTIHHTWWADGVV
FT                   ERMPRVRFGKVHVANNLFDSKNASYCVRAAVEADIRIERNVFIGVQKALDLYTSDGTIT
FT                   AAQMIENYEENVKKPQAGTGTAFKPSYSMSLTDVSTQAKAYALRDSIKLYAGATLPDPG
FT                   KSQTVTPASSSSEVQSSSSVAVSSSSVAKSSSSVAQSSSSQAVSSSSQGEAVSGTATLT
FT                   KHGSGSAKQEVKQGESIEEFYFTVAGATGATVTGLPEGVSGTMKGSDFYISGTVAQNAA
FT                   VGAYNFTVTTTGATTNATKNGTITVVGANGAVAESSSSSVESSSSKVDSSSSSEQGTTS
FT                   LDVATVASHFNVSVNGRVLTVQGATQTAYLLDAQGRLITKVQSLGRESLITVPRAGMYL
FT                   LRVGNEARRITVR"
FT   gene            complement(645991..647847)
FT                   /locus_tag="FSU_0578"
FT   CDS_pept        complement(645991..647847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0578"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26747"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:D9S755"
FT                   /protein_id="ADL26747.1"
FT                   /translation="MKLSNIVWCAALTLCACGDSSVDSTGVVAPNAAESDSAGETTEVS
FT                   NPEISSDNQGSTAENQSSVSTEQSSSTEEVIIEQVASDPVMVSEISGDPVITFTNASVS
FT                   VSNDNGCIAQNEKTITISCQGNYQLTGSSNDNQIIVNAGSTDNVYLYLNGLQLASASDA
FT                   PIYVQNANKVFLLLVDGTKNTLEDASTRTKAYTKSNGSSDTTNATIYAKDDLTIKGSGA
FT                   LTVTGNYNNGIHCSNDLRIRDLPEITVKAKNHAIKGKGSVNIEGGYFELTATNGDGIKS
FT                   DEGDDEGVVTEEKGIVIITGGEFNINAGDDGIQAYNYILIADSTSTPLITVNSKGKGIA
FT                   TDNRLYVNGGVTSVTSGDDGLHSNMNIYFNGGRTTISAGDDGIHADSTLRISDGSINIT
FT                   KAVEGIEAFYIRAEGGKTATVASDDAWNAAGGSADANSTSGSQWGGRGGPTGMMSGSKG
FT                   YIIISGGYHYLYAAGNDIDVLDANGTATMSGGVLLLEIGSSGRSSAMFASGNQGGNQGG
FT                   SWGGSSSCSTNTAGGLIDTDNGFSINGGVLLGFGSQTEEYPYCTATSYTAGTAYGSSKA
FT                   AFKPSSSGSMIIYGGEVSSVSQVDVSGMTEVTLPNGMTYYEK"
FT   gene            complement(647792..647974)
FT                   /locus_tag="FSU_0579"
FT   CDS_pept        complement(647792..647974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26253"
FT                   /db_xref="UniProtKB/TrEMBL:D9S756"
FT                   /protein_id="ADL26253.1"
FT                   /translation="MFRMELFVPKENCAYFKNMLVSLFLRLCRSYFYRKNGVIYENIEI
FT                   IKHRLVRSSNALRLW"
FT   gene            648060..649619
FT                   /gene="trpCF"
FT                   /locus_tag="FSU_0580"
FT   CDS_pept        648060..649619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpCF"
FT                   /locus_tag="FSU_0580"
FT                   /product="indole-3-glycerol phosphate
FT                   synthase/N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="4.1.1.48"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by similarity to SP:O25867; match to
FT                   protein family HMM PF00218; match to protein family HMM
FT                   PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25178"
FT                   /db_xref="GOA:C9RJS7"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJS7"
FT                   /protein_id="ADL25178.1"
FT                   /translation="MSEDILQKIVRMRREDIDRLGLNFNIDIPEARRVGHTEFLGNAGA
FT                   ILEVKRASPSKGDIAPNLNPVELATTYAEAHAQAVSVLTEMNFFKGSLRDLIAVADLME
FT                   RRRQQGLHTCAVLRKDFLLFEDEIDIAYRCGADAVLLIARILDDAQLVKMAQRAQKFGI
FT                   QAFVEVREADDFRKLAVVTAALGDAAAKTIVAGVNSRDLATFHTDPLIPASVRSKLPAK
FT                   AVFESGILSAADATYARNLGFTGILVGEAVAKNPPLAKDVVSAFESGCENARGLFWKKF
FT                   AERKFANNETRAASSQDARRPLVKICGITREEDGLLAAELGADMLGFVFSTTKRLTTEE
FT                   FVRSFKTRLLRSACNDVAPLLVGVITDPNSVEGKTAIKLAQEGVLDAVQFHGVNPHNSD
FT                   ALAESCSAALPYYCAARVGAPEDFDYIASLRKNGEPRILLDAKVEGIPGGTGKTIPESL
FT                   LREKANGAPLWLAGGITPENVATICEKFHPELIDISSGIEDAPGIKNHDKMKALFAEFA
FT                   AK"
FT   gene            650114..651136
FT                   /locus_tag="FSU_0582"
FT   CDS_pept        650114..651136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0582"
FT                   /product="putative inorganic pyrophosphatase,
FT                   manganese-dependent"
FT                   /note="identified by similarity to SP:P37487; match to
FT                   protein family HMM PF01368"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26922"
FT                   /db_xref="GOA:D9S758"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D9S758"
FT                   /protein_id="ADL26922.1"
FT                   /translation="MDWGSDTTFVIGHKTPDVDAVTSAMSYAALMRALGHNAVAKIISP
FT                   INRETAYIAEKFGFKVPEEMKSVEAGTRLILTDHAESAQSVEGVKEAKILQIIDHHIPG
FT                   DLDEKVTSDTYVNRQIIGSTCTIIWDLYKKADVKIDNDMAKILLAGILSDTRNLTKVAS
FT                   SALDSSAWKSLIEQLKISPDSVAKLSREMDDASHDYYGMTDKEIFLSDYKDYEIEGVKI
FT                   GIASNDWYVDSTKSDFFKRLAAVMPEIAKEKKRDILFAKVDGHDPNPDPETAAETPFIE
FT                   SGSYTIIYASDDYEATAKEIAESAFGELFSEGVYFSAEKISRKSLMVPKITEYLEGKKK
FT                   "
FT   gene            complement(651166..651264)
FT                   /locus_tag="FSU_0583"
FT   CDS_pept        complement(651166..651264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26361"
FT                   /db_xref="UniProtKB/TrEMBL:D9S759"
FT                   /protein_id="ADL26361.1"
FT                   /translation="MFDYNDNSCFRLKALFDTKKLGFRQIPEAILL"
FT   gene            complement(651273..652196)
FT                   /locus_tag="FSU_0584"
FT   CDS_pept        complement(651273..652196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26282"
FT                   /db_xref="UniProtKB/TrEMBL:D9S760"
FT                   /protein_id="ADL26282.1"
FT                   /translation="MCESKTLLRDEVGSIVGFLTNGEKMKSKQVKWTSLVGVFALVGMS
FT                   LLSACGDDSASPLAPQVSEKESSSSMQKSSSSVQRTSVKTTFELGKCSYDNESEKIFVS
FT                   DEGEFYTCSYKNGDYTWVKPNNVKSSNSVAKVSSSSVLDEKIYYSSSSVRSEYNAERET
FT                   FLYKEFFVEIDLTLFKQVSDNWEKQNSHKENYTDGDPRISFVIKTYSDDSLIDSVKTNV
FT                   FNPGDNVGKWTGHEYFTKKFSGGVNVIYVCPVVYEYNVIESNVLHSSNYCYIIHDAGDK
FT                   VDVPILQSDSKATDLKLEWAVTISYK"
FT   gene            652718..653995
FT                   /gene="trpB"
FT                   /locus_tag="FSU_0586"
FT   CDS_pept        652718..653995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="FSU_0586"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by similarity to SP:Q9YGB0; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26805"
FT                   /db_xref="GOA:C9RJT0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJT0"
FT                   /protein_id="ADL26805.1"
FT                   /translation="MTSTTSNNGFFDKFGGKYVAEIIRRPLDDLEAAFNKYIHDPEFLE
FT                   ELRIIQRDYIGRETPLYFAPTATKLLGGAQIYIKLEGLANTGAHKINNAIGQCLLAKKM
FT                   GKTRIIAETGAGQHGLATAAACAKLGLECVVYMGEVDVRRQQPNVATMEMYGAKVVPVT
FT                   SGSRTLKDAVNEAMRDWATNFQNTHYVLGSALGPAPFPDIVRTFQSIIGEEVKRQAAER
FT                   NIDIAAVVACVGGGSNSIGVFTPFIEDKNVRLIGAEAGGVGPNVGENAARMTGNASREG
FT                   IVQGYKSRFLIDEDGQSMPTRSISAGLDYMGIGPQLAALGESGRVEFTAILDKEALEAV
FT                   KFFARNEGILFALESAHAGAAAMKIAKELPKDKALVINMSGRGDKDIFITSPVFRPEKW
FT                   KEFLKAELVRLENNEDIHDAEIMTRK"
FT   gene            654001..654753
FT                   /gene="trpA"
FT                   /locus_tag="FSU_0587"
FT   CDS_pept        654001..654753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="FSU_0587"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by similarity to SP:P00930; match to
FT                   protein family HMM PF00290; match to protein family HMM
FT                   TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26377"
FT                   /db_xref="GOA:C9RJT1"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJT1"
FT                   /protein_id="ADL26377.1"
FT                   /translation="MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADG
FT                   PAIQTASTIALEKGYSTKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKD
FT                   AGVSACIIPDLPFDHDEGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALR
FT                   AGTTGSETTIDQATLDFIDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNI
FT                   VLANADTAEGRAKAIAAIEAKAKEIAGK"
FT   gene            655079..657352
FT                   /gene="acn"
FT                   /locus_tag="FSU_0588"
FT   CDS_pept        655079..657352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acn"
FT                   /locus_tag="FSU_0588"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="identified by similarity to GB:AAM10631.1; match to
FT                   protein family HMM PF00330; match to protein family HMM
FT                   PF00694; match to protein family HMM TIGR01340"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26657"
FT                   /db_xref="GOA:C9RJT2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJT2"
FT                   /protein_id="ADL26657.1"
FT                   /translation="MLFNFDMIQATYARIPARVAVARKQLGRPLTLAEKILYSHLIDGA
FT                   ENRTYKRGADFAEFHPDRVAMQDATAQMALLQFTTAGKSRVAVPSSVHCDHLIIAREGV
FT                   EKDLPRAKEESKEVYDFLQSVSAKYGIDCWLPGAGIIHQVVLENYAFPGGMMIGTDSHT
FT                   VNAGGLGMLAIGVGGADAVDAMVGLPWELKYPKMIGVKLTGKLQGFATAKDIILKLAGI
FT                   LTVKGGTNAIIEYFGEGARSLSATGKATIANMGAEVGATCSTFSYDDSMSRYLRATGRA
FT                   DVADAADKIAADLKADPEVEAEPEKYFDRVVEIDLNTLIPHYNGPFSPDRAFAVTDMAE
FT                   SLKATETKPESTPVVSAALIGSCTNSSYEDLYMAANMIKQALAKGLTPKCPLLINPGSE
FT                   QVRYTAERDGLIDLFKQFGATIMTNACGPCIGRWDRAGADKKELNTIVHSFNRNFAKRA
FT                   DGNPNTHAFVASPLMAVIAALSGDIRFNPMTDTLVNNEGKAVKLDPPEQCELPPKGFDV
FT                   KDAGYQAPAADGSNITVSINPTSKRLQALAPFAAWDGKDIAGAPLLIKAKGKCTTDHIS
FT                   MAGPWLNYRGHLENISNNMLIGAVNAFNGETNKVLANDGSYKEVPELAKIYKAKGTGSI
FT                   VIGDENYGEGSSREHAAMEPRFLGVKAVIVKSFARIHETNLKKQGMLALTFKNAADYDK
FT                   IQEQDVFDIVGLTKFAPGSEFTLVAHHKDGSVDNIALSHTYNEQQWAWFKAGSALNLIR
FT                   ANNK"
FT   gene            657394..658893
FT                   /locus_tag="FSU_0589"
FT   CDS_pept        657394..658893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0589"
FT                   /product="GGDEF domain/HAMP domain protein"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26541"
FT                   /db_xref="GOA:D9S764"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9S764"
FT                   /protein_id="ADL26541.1"
FT                   /translation="MRHITFHKTQTLRGLRFFVFLFSVFCKKILFFSAKENEMTHKKTI
FT                   HRSLILGSAVFIAFMCFLLSIQAYLTYSQSLYKRYDDKLSNILNYATNRIDMDDLYQNT
FT                   ITGQKTEKYNDVQQLLNGMVDDFELFYLYSLFVRNDSMYNICSATSKAERERGEEDMKL
FT                   LEPTDAYELSEIRKFAKAMTKNEISYFEEDSDWGPAYTACKPYVNSLGVHFGVICADVS
FT                   IAELHKTVNNYVLYNVILTLGLGLLFALILLVWLRHNVTGPILALEKSARHFAEKSRGK
FT                   KTPDELIFDAPEIHTHNEVESLSNAISQMSKDMRTYVQGLLEAEEQARSAQEQAEDMTQ
FT                   LAFKDALTHVNSKVAYDKMKESLQEQIDKGGATFGFVMIDLNNLKEVNDHYGHDCGDKY
FT                   ILGCCHIFCTIYKQSPIYRFGGDEFVVLLQNSDYKNRDKLFKVIESEFKKTRNNTSRPA
FT                   WERYSVAYGMATYQLGDNVEDVFKRADDSMYQKKMEIKGMA"
FT   gene            658980..660647
FT                   /locus_tag="FSU_0590"
FT   CDS_pept        658980..660647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0590"
FT                   /product="sodium:neurotransmitter symporter family protein"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24706"
FT                   /db_xref="GOA:C9RJT4"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJT4"
FT                   /protein_id="ADL24706.1"
FT                   /translation="MANNRENWGSKLGVILAVAGSAVGLGNFLRFPVQAATNGGGAFII
FT                   PYLIAFVFLGIPLAWIEWTLGRYAGYHNYGTSPSTYHVIFQKKKKWAKYLGSLGLLPPI
FT                   FIIFYYGFIQSWILAFAFYSATGTLMDVVAQGPEKMTEFFGNYIMLKTCVGGIPVAIIF
FT                   FLITFIANMIVLSFGVRKGIERANKICMPILLILGLVLVVRVLTLPGIGKGLAFMWNPD
FT                   FSQLTSPKVWMAAAGQVFFTMSLGMAIIFCYASYLKPKEDLVLSSLTASATNGFAEVII
FT                   GGTVVIPMAVLIAGANIEECAKLGTFGLGFQTMPYVFGTLPFGGVLQTVWFTMLFFAGI
FT                   TSAISIIQPLISFCEDDLKFTRKKSVTTVSTITFIGSLAAGTVDELDFWGGTYLIVFVG
FT                   MIQAVLFSLVLGRRNAKKAQENGDLPAEVVVEPGENEAFATMNDGSLLKLPRFLRPIIL
FT                   YVCPIYLIVLLVSFTATDGLPFITLSNVDPSATVDFLGHTFPKIGFTWAFRGFLLVLFL
FT                   LLNLAIAYAWRKGGPAEKGRSKSIKKMEIGNSDENMEG"
FT   gene            660651..660755
FT                   /locus_tag="FSU_0591"
FT   CDS_pept        660651..660755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25119"
FT                   /db_xref="GOA:D9S766"
FT                   /db_xref="UniProtKB/TrEMBL:D9S766"
FT                   /protein_id="ADL25119.1"
FT                   /translation="MDAEFTTGGLVFMICAWGAIIGLCAFCFYKVFKK"
FT   gene            660779..664279
FT                   /locus_tag="FSU_0592"
FT   CDS_pept        660779..664279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0592"
FT                   /product="acyltransferase/AMP-binding enzyme"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF01553; match to protein
FT                   family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26874"
FT                   /db_xref="GOA:D9S767"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9S767"
FT                   /protein_id="ADL26874.1"
FT                   /translation="MSCPPPCGHFLFYPHQSLLYLPRNFEQFLYKTTYMKRTTCPGEVP
FT                   YYISVFLTSFMQLGLFIHFQRWITFNSEGARFFWLSLLLQFAMFSPSIIMMHVASYFAG
FT                   RFPKSKVMGWTSIGMAISVLLIAFFFGDRLDFGAFAFLFLYGIFLSIFNPAKIGLMKEI
FT                   TDGNDLVKINAKHLIFMALGITIISFLTFDYSPNDSSTISYSLLPFILSAVGLFAAISS
FT                   FCIRICKQNKFVKLRSPRRNFASTWSNPMLKLSMLGIAAFWSVTQFLIMISQNMTGTQS
FT                   TTLFQWTFIFTGIGYVIGAISAAKSSKNFVETGLIPLAAIASSITMIITPFINNQYVLA
FT                   FLYAFIAFWAGSAFVILRTVIQNVTRPDTSGRIHAVSFMIQMSFLFILLGFQVILFLMT
FT                   ELSLHKQLFFLAVILALTFVFTLKRTPMTLLRAGLRFAFSYVFRYKVKVHGIQNMPESG
FT                   PLLLVGPHYSFIDWAVLQMASPRPLLIASNRNTFADWYLRWFAHGKSVIDINRRDPSEA
FT                   MEKIHEALLKGEAVVIFPEGEVSKTPFVSKFSLDYTKAIEGTEAQIVPFYIQGLWGSRY
FT                   SHASECVNRPQYFNRVISVGFGKALPATTPENVIRKDLQNLGTDIWNMAMDHSASIIPL
FT                   WYRAMRKRRSRPILIDPAGRHVNGYEMIRLCHHFSKKIKSLTKNDQNVGFMLPTSRDAA
FT                   LGIMSILGCGKTTVNLNYTSPVDTLIGCIDKAELSTIVTSRAFFDKLCGKNADFKQLAE
FT                   KCQMFYIDEEEQKISTFCRLLESFIVLTFPKKLLRDLWFTTAKLSDDAVILFSSGSEGT
FT                   PKGVELTHKNVISNAQQGDHVIRLCRTDVMTSLLPLFHSFGFTMTFMMPLLDGVPMVLC
FT                   PDPTDIKTLARVCAEYKATILMGTPTFLRAIAINRWVHPMCLDSLRYVIAGAEKLRPEM
FT                   RETFKLKFGKDIYEGYGCTELTPLATLNAPNVLLDDFLTMEKCCDHSSIGMVVPGSTGA
FT                   IIDPETNQFLAPGEEGMLVITGPQVMKGYLRDEAKTDAVIFEVDGRRWYKTGDKCTITE
FT                   DGFVKILGRYSRFAKLGGEMISLTAVELRIAETGIMGEHEFAITAVPDSVKGERIVLLV
FT                   KGDATLDTEEISRSLRKSGIPPLMQPGSVFCVEAIPKLGSGKWDFNGMKKLATELVEKK
FT                   "
FT   gene            664406..664873
FT                   /locus_tag="FSU_0593"
FT   CDS_pept        664406..664873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0593"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27167"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJT6"
FT                   /protein_id="ADL27167.1"
FT                   /translation="MSQIVSKFQELGLTLPACPAPVAAYVPATRFGDTIIVSGQLPSVK
FT                   GDFSAFTGIVPNQISVEKAKEAAQICFLNNIAAALTQLKAGETLRLVQIQGFVQSANDF
FT                   HDQPIVLNGASELAVQILGENGKHARTAVGVSTLPKNVAVEISCTFQAIKE"
FT   gene            complement(664874..665356)
FT                   /locus_tag="FSU_0594"
FT   CDS_pept        complement(664874..665356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0594"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAL80348.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25072"
FT                   /db_xref="UniProtKB/TrEMBL:D9S769"
FT                   /protein_id="ADL25072.1"
FT                   /translation="MNFAFENRLYESEVHGIEHWHQVEYNGLLLAKKTGADIDVVRLFA
FT                   IFHDSQRLDDAYDREHGARGAEFAKRCREEKRFELDDERFGWLYDACRLHTIQPRTGIV
FT                   TIDTCFDADRLDLGRVGFPLDPKKMATEWGAKIAQKSLTSGCSVFHMREWIRKLVL"
FT   gene            complement(665537..668176)
FT                   /pseudo
FT                   /gene="mutS"
FT                   /locus_tag="FSU_0595"
FT                   /note="DNA mismatch repair protein MutS, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAR35199.1"
FT   gene            complement(668176..668880)
FT                   /gene="scpB"
FT                   /locus_tag="FSU_0596"
FT   CDS_pept        complement(668176..668880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="FSU_0596"
FT                   /product="segregation and condensation protein B"
FT                   /note="identified by similarity to GB:AAM71720.1; match to
FT                   protein family HMM PF04079; match to protein family HMM
FT                   TIGR00281"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26182"
FT                   /db_xref="GOA:C9RJT9"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJT9"
FT                   /protein_id="ADL26182.1"
FT                   /translation="MAEDQNVEELAEESAELPKVESREDLARIIQALVFASPDVVTLKK
FT                   LREILGDFLDARSVADALITANDSLNKIQSPFEIVEQAGGYRFRTRAKYYPWVRKLFPE
FT                   ANARRLSQAALETLAVIAYQQPITKAAIEQVRGVSSADGPIRNLLDKGFITLGARAETV
FT                   GNPYTYVTTQEFLKYFGINRIPEDLPRLREFSELLEAGALVPQYSKPDNAPEEPTPLEE
FT                   STDQIELSMGDA"
FT   gene            complement(668922..670061)
FT                   /gene="proB"
FT                   /locus_tag="FSU_0597"
FT   CDS_pept        complement(668922..670061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="FSU_0597"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by similarity to SP:O07509; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01472; match to protein family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26982"
FT                   /db_xref="GOA:C9RJU0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJU0"
FT                   /protein_id="ADL26982.1"
FT                   /translation="MSELRKNILDEARRVVVKIGSRILVDSERGGVRTRYIQKLADSVA
FT                   RLMDAGKEVVIVTSGAVGTGMAELGYAQKPTVLAEKQACAAVGQIDLMYAYREMFRWVQ
FT                   LSVGQILLSAEDFRDRARYKNLQNTIKAMLARKIVPIINENDSLAVAEIKVGDNDKLSS
FT                   DVALFLDADLLLIFTDEDGLFDDNPKKNPNARLLNFVPEITPAILALAGKPGEAGSAVS
FT                   TGGMRSKLEAIRNVTKSGANAFLASGMKVLPHQVFFENATGTLFAGSKKKLNSRQRWLS
FT                   FITTPRGSVIVDEGGVKALRENHSSLLPVGVIAVQKHFDKGDLIEVQDEKKNPVARGVA
FT                   GFDSETLKLVLRKKTAQVHEILGKNVPDELIHKNDLVVF"
FT   gene            complement(670091..673081)
FT                   /gene="hepA"
FT                   /locus_tag="FSU_0598"
FT   CDS_pept        complement(670091..673081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="FSU_0598"
FT                   /product="RNA polymerase-associated protein HepA"
FT                   /note="identified by similarity to SP:P23852; match to
FT                   protein family HMM PF00176; match to protein family HMM
FT                   PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27093"
FT                   /db_xref="GOA:D9S772"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:D9S772"
FT                   /protein_id="ADL27093.1"
FT                   /translation="MMMFKIGQRYVSQAEPTLGLGIVSEVQGRTVKILFPSIGQARIYR
FT                   TDEAPIERFVLQVGETVKSEKGVSFVVDSVREDAGIMVYVGRNGKEMKESELSAKISTA
FT                   RPAVLFKALADDEVCSSRDFLRHEDAMEMYYKWISSPVRGMIGPRVNMIPHQYYLCYRA
FT                   CSSSTLPRLMLSDEVGLGKTIEAGMIWHALKSRGRIQRTLVIVPETLKHQWMIEMKRRF
FT                   NQLFTLVDEGYIRGLFVGVAKDETKPNPFMQSNDIIVSIDFLMAQPALIEDLLKTNWDM
FT                   TIIDEAHHLVCEDGFTSHEYMLANRVIGRSKGVLLLTGTPLQLHPESQFNRLKMLDPVR
FT                   FADYNDFIKDQEAYLKLVRDLNKLPTDPNHHMSWDDLYECVPKNSQIRPWLEQENSKSM
FT                   TAGEWMRCIVDGMGTGSVVFRNTRKGVGGFPKRVLDEIPLEPNPAYREMVDVAADRDLE
FT                   ASTDIQENGLLCTRFSDAWAMDERFVWLKGFLKEYKNEKVLLICESIQVVQALETLLLE
FT                   FLGEGAFVMFHEDMSIMARDKAAANFSKPDGANLLIASEIGSEGRNFQFSHHLVLFDLP
FT                   LDAALVEQRIGRLDRIGQDKDIIIHVPYVKGSGQEVMFRWYNEGLNSFGAPLMSGGELF
FT                   LKYTESLIEALATPRASLENFVENVIPQVKKDCEQMRKHIENGRDRLLEFNSRNPEKAK
FT                   EITDEIRELDAEPELKNLVFDSLMNRGLDVEKSSVQDCFLITMGPQVEAGSVPGMPDLA
FT                   MAAATAGGGRVNSQTDLCGEGGGDGDGDGRVSGGTCMTVTFDRDVAMTHDDIEFISLDH
FT                   PLAQGVFDYETSFGRGTVSCAIWPNSGLRGLMMQYNFAVELPVSEEWGCADIAGPKYFK
FT                   VLVNAKGENMSEHFEDLSDAALKDVGVPQGNAAVDMTLRYFAKDGLAKARLIVSEQAKK
FT                   YAEEAANAVEARSEQEYQRMNHLLSMRGKAGTSEALKQLRKNVQERKKIVANPQLRLDA
FT                   IRLVVCK"
FT   gene            673148..673912
FT                   /locus_tag="FSU_0599"
FT   CDS_pept        673148..673912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0599"
FT                   /product="RDD family protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27396"
FT                   /db_xref="GOA:C9RJU2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJU2"
FT                   /protein_id="ADL27396.1"
FT                   /translation="MKWFYIDTSITDGDRRQGPYSIDEIRDFVNEGKIKDETLVWHTGE
FT                   ANWKAWKDFPEASEPPEPTEEELLKQTIETLLQSKMNRKRYAGFFVRANAFIIDNIILS
FT                   IVGALFLYVMSLAGMLDLNAVSEIVNQYIDNPGSTDLVSKALDLPGMSTFFTIWSIVQA
FT                   IYFIVFHAVWGATPGKKLLRIHVEMANGEKLSWAFSFFRFVASIVTQATLIFYGLGYLI
FT                   VLIDPQKRALHDFVAQTRVVHNAIEQKEKKEV"
FT   gene            673918..675198
FT                   /gene="murA"
FT                   /locus_tag="FSU_0600"
FT   CDS_pept        673918..675198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="FSU_0600"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25773"
FT                   /db_xref="GOA:C9RJU3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJU3"
FT                   /protein_id="ADL25773.1"
FT                   /translation="MDQFIVPQVKAPVNGEVEISGAKNAVLAVMAAALLADGVSEITNV
FT                   PHLKDMKTMSDVLRVIGCHINGGSHVLRIDTRGVDHLEAPYELVKTMRASFYVLGPLVA
FT                   RFGRCRVSLPGGCAWGPRPVDLHLKGLEALGAKITVTHGYVEATCQGRLPGGNFNFPIS
FT                   SVGATVNVLMAATLAKGVSVLQNAALEPEIDNLIDFLTSMGAKIQGRGTRTLTVQGVES
FT                   LRPGTGVTIPDRIEAGTFLCAAAITRGRVKVTRIIPEHIASTLDAFREIGCKVNVGADW
FT                   AEVDARQQELKPMSLVTLPFPGFPTDMQAPFMATLLSIPGNSLVQDTVYNDRFKHVAEL
FT                   ERLGASIQLNGNTATIKGGLPLEGADIMGSDLRASAALVLAGLIAEGETTISRIYHLDR
FT                   GYEDFEAKMAKIGATVKRFNPDARDAE"
FT   gene            complement(675280..675996)
FT                   /locus_tag="FSU_0601"
FT   CDS_pept        complement(675280..675996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0601"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P15031; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26410"
FT                   /db_xref="GOA:D9S775"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9S775"
FT                   /protein_id="ADL26410.1"
FT                   /translation="MLECRNLLVGYGRALESMKNPFDFRLSAGTVVALMGENGCGKSSL
FT                   LKTLAGLLPPVSGEVSLEGRMLSEWSPRHRSQKISLVRMSNVVPPRMSVREFVRLGRSP
FT                   YSGIFDSRTAEDNRIVEESMVLLDVAVFAERPVAELSDGERSRVFLAEAVAQRVNVLLL
FT                   DEPNAFLDIPRSHALFRLLKKIAVERQMGIVISTHSVEYAERYCDRIMVVDGGTVKNAL
FT                   ASEARKCGLLDWTEAF"
FT   gene            complement(676033..677004)
FT                   /locus_tag="FSU_0602"
FT   CDS_pept        complement(676033..677004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0602"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24870"
FT                   /db_xref="GOA:D9S776"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9S776"
FT                   /protein_id="ADL24870.1"
FT                   /translation="MRRRLFGFIALAVLIVLLCVATLCYGVVDIPFASVVQSLFSPGDD
FT                   VSSNILWNLRIPKMIAAVLAGASLAVSGLSLQTVFRNPLAGPFVLGISSGASLGVALAL
FT                   LAGVGFGSVGVLGSAALGALLVTFIVMFVATRFAQTGVLLIVGLLTGYFIDAIVSVLIA
FT                   GNSSESLRVYVAWGMGSFGRVTLGDVWIFTCAILVGLVLIGGSLRYLNAALLGDDFAHG
FT                   LGLNVKRSKICVLLGASLLAGTTTAFCGPVAFIGIAVPHLAYMLFKTTNHRLLLPGAAL
FT                   CGVALALLAGLFPASVPLNAVLSLVGVPVILWVLVRGSGARF"
FT   gene            complement(677013..677879)
FT                   /locus_tag="FSU_0603"
FT   CDS_pept        complement(677013..677879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0603"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25523"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9S777"
FT                   /protein_id="ADL25523.1"
FT                   /translation="MIVNLKTLSLGFVLASFMLSGCSSITMLRTKEMRAVGDDVIAKND
FT                   SAYKALSAENAALRAELDSVKAQLDASAVAQKRLQAEVTVLSNRMSEETVRRDTRQEEI
FT                   IYRLDLLLGKSDKILAKKVVVNNGVASAVMEPDANAEKMVEAETMFNAAHSDYHRGEYK
FT                   LAYNGFKQVYELVKKGEMAEGALYWMSLCLMEANQPAKAKTLLTNLVDSNPNGMKACAG
FT                   MYKLASIYGNECNLDRKKQYLQMILSNNTCASTPELEQAAISLQEMLDFKSSDGRSATE
FT                   ICREQMR"
FT   gene            complement(677891..678469)
FT                   /locus_tag="FSU_0604"
FT   CDS_pept        complement(677891..678469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0604"
FT                   /product="putative peptidoglycan-associated lipoprotein"
FT                   /note="identified by similarity to SP:P07176; match to
FT                   protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26280"
FT                   /db_xref="GOA:C9RJU7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJU7"
FT                   /protein_id="ADL26280.1"
FT                   /translation="MGKVFKLALMGTAVALFAWGCSKEKPETDPQPQTAPEAPADSTLN
FT                   LDALVADTLDADSLARLEAERLEAERARLEELINRIMLEDVYFDYDRSELTENAKRLLA
FT                   QVAEILVNENRFIVTVEGHTDARGTEDYNISLGARRSTVVREFLIAYGVDANRLVSVSY
FT                   GKERPKVQGTDETAYSKNRRAHFRVSIDQ"
FT   gene            complement(678481..679755)
FT                   /gene="tolB"
FT                   /locus_tag="FSU_0605"
FT   CDS_pept        complement(678481..679755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="FSU_0605"
FT                   /product="tol-pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="identified by match to protein family HMM PF04052;
FT                   match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25166"
FT                   /db_xref="GOA:C9RJU8"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJU8"
FT                   /protein_id="ADL25166.1"
FT                   /translation="MNKIKLLFVFVAMALAAPAFAAIDTIAVDVGISVFQTMPIGVVPF
FT                   EEEGTIKWTNEAPHLILTRDANLSGRFEAVNSDKFDLVLFSKKRARQYVTGTATKLSNG
FT                   KIKLDCYLYAAETKDVLLGESYTVKPYDVRQAVHSFFDKVVYRLFGERGVASTKLAYVS
FT                   KIDGVKQVVISDYDGFSRRQITRDSSINMMPVWQKGNKGLVYVNFRKQRPNLYAITFGG
FT                   KETPLFTQFKQTFSPAVNPKTGELLFSVTEGAKTELYRGDMKTGSAQKFLHLKSNQVSP
FT                   SWSPFASEVLFTSDRGGSPQVYAVGKDGTDVRRITYMGHYNERASWSPEGDRIVYTSMD
FT                   DGKMNIYTCALDGTDIIQLTSNAGNNEHPTWSPDGKLIAFASDRGGNYQIYIMRKDGSG
FT                   VTRITNGSENTSPTWSWFFDEKKVK"
FT   gene            complement(679765..680643)
FT                   /locus_tag="FSU_0606"
FT   CDS_pept        complement(679765..680643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0606"
FT                   /product="TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25970"
FT                   /db_xref="UniProtKB/TrEMBL:D9S780"
FT                   /protein_id="ADL25970.1"
FT                   /translation="MFKIIVCAVVFHLAVVGTLIALNNIDLSKPAEEIPVFEMVQVDEP
FT                   VKAPAAKTALPEPEPQQAPKVEPPPPQPPEPVPETTPEPEPAPEPTPVKTLEPEAPQVP
FT                   EEPAPEVKPDTPEPVPVPEPKAEEKKPEEKVEKPKPVEKPVEKPVEKVAKKTVEKKKVE
FT                   KKPAKKPKDDDFDIDDLNLQKSFEMPSLKAVNPIDMDPLMQVFLERAKAKIMSNFNPPN
FT                   GLTIDRDAKTMVQFTVERSGAITSVFLKRSSSNSAWDHLSMRAVKISKLPELPPTYKGS
FT                   SLVLQFNFTPN"
FT   gene            complement(680684..681100)
FT                   /locus_tag="FSU_0607"
FT   CDS_pept        complement(680684..681100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0607"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27212"
FT                   /db_xref="GOA:C9RJV0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJV0"
FT                   /protein_id="ADL27212.1"
FT                   /translation="MKRSRRKDLKQELNLTNMIDIVFAILIVFILCAPLMSQGVKVNLP
FT                   QVKAPTMEQQKLLKVSITKNLEIFIADMQVDMESFESIFKSLWNGEMAVVINSDEAVSY
FT                   GFVMKVVTQVQKLGVTKLGFLTMTPKDELVNGKK"
FT   gene            complement(681097..681798)
FT                   /pseudo
FT                   /locus_tag="FSU_0608"
FT                   /note="MotA/TolQ/ExbB proton channel family protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by similarity to SP:P18783;
FT                   similarity to PIR:H71686; match to protein family HMM
FT                   PF01618"
FT   gene            681994..682533
FT                   /locus_tag="FSU_0609"
FT   CDS_pept        681994..682533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0609"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25597"
FT                   /db_xref="InterPro:IPR024952"
FT                   /db_xref="UniProtKB/TrEMBL:A7UG51"
FT                   /protein_id="ADL25597.1"
FT                   /translation="MKKLIACLALAALFAGCSSNPPQTPQEKSASLLVEMQMQKKNYLK
FT                   QHIPAGIGIGESANEQLAYEKADQNARVDLAKSIDAQTKALIKNFKEEVSDEIAEHFQS
FT                   TSKTAVDQRLNGATLNDVKVETTADGKFKVYGVMTLDSDLVSEYIKMLEQQEKKEEAEK
FT                   IRAAAEKAYAELDEMD"
FT   gene            complement(682622..683911)
FT                   /locus_tag="FSU_0610"
FT   CDS_pept        complement(682622..683911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0610"
FT                   /product="dihydrofolate synthase"
FT                   /note="identified by similarity to GB:CAC39311.1; match to
FT                   protein family HMM PF02875; match to protein family HMM
FT                   PF08245; match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27073"
FT                   /db_xref="GOA:C9RJV3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJV3"
FT                   /protein_id="ADL27073.1"
FT                   /translation="MIQNGLEYLNSRLIFGMMPGLASTRKLCEALGNPQKKFKTIHVVG
FT                   TNGKGSTSYYLSGVLQAHGLKTGLYTSPHLVSMRERIRVNDLPIDDESLDRLIMQVKAA
FT                   AEETQVEPTFFEVLTIVAFLYYAEQNIDVAVLEAGMGGRLDSTAVADGELIVLTSIGLE
FT                   HTEVLGSTESAILKEKMGVAGSAQSILSNGRSKTFVLGGLNDALIAEAKVFAASHGCSC
FT                   VVPEIRNDIELPNLGQHYIENASLSLKAAELFLNKFDDSLALKTLTTRSWAGRMQKLID
FT                   ANGVTKFILDGAHNSHAVRRLVETLDKYYPNQKFHCVFGALRDKDVGEMLKLMAPHVSA
FT                   WHITRTPYPRFRELEDLQGELEKLGLNVASAGEFSREYLNEVCASVTDGSPVLITGSLY
FT                   MIGATVQALKDDFDGLAFFRGMEPTTNEHR"
FT   gene            684164..684907
FT                   /gene="endA"
FT                   /locus_tag="FSU_0611"
FT   CDS_pept        684164..684907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="FSU_0611"
FT                   /product="endonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="identified by similarity to SP:P25736; match to
FT                   protein family HMM PF04231"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25904"
FT                   /db_xref="GOA:C9RJV4"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJV4"
FT                   /protein_id="ADL25904.1"
FT                   /translation="MKVSASAVALILCVFAAFSFAKVDPEAAPRHYNYRDAGKQMRRIY
FT                   YGELQETIYCGCRYLDKKHVDFSTCNYKPRENPNRKSLERTKRIEWEHIVTAHNMGKHL
FT                   PCWRDGGRKNCSANDTTFKIMEGDLHNLYPAIGEVNGDRNNFMFSQWTNNPAPMYGECE
FT                   TIVDFKDKKVQPRKEVRGLIARVHFYMEKTYNINISKQDRKLFEAWDKMYPVTERECER
FT                   DRRIFKVQGDHNPFVFEKCQDSVDK"
FT   gene            685005..685610
FT                   /gene="rpsD"
FT                   /locus_tag="FSU_0612"
FT   CDS_pept        685005..685610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="FSU_0612"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by similarity to PIR:A37146; match to
FT                   protein family HMM PF00163; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26828"
FT                   /db_xref="GOA:C9RJV5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJV5"
FT                   /protein_id="ADL26828.1"
FT                   /translation="MSSFRGPKGKVARSLGVAVSQKTQKALDRRNFAPGQHGQTRKKSA
FT                   SVYKQQLVEKQRLRFTYNISEAQLAKAYKEANRREGSAGDNLMILLETRLDAVVYRMGF
FT                   ARTIFAARQYVAHGHFTVNGVRSFSPSRLIKAGDVIAVREQSKEHVQIKEAIASAAAAP
FT                   EYLSVDLGKMQGTLVKLPLRDQIPVKLEEQLVVEYYSR"
FT   gene            686012..687247
FT                   /locus_tag="FSU_0613"
FT   CDS_pept        686012..687247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0613"
FT                   /product="putative endoglucanase"
FT                   /note="identified by match to protein family HMM PF01270"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24768"
FT                   /db_xref="GOA:D9S786"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D9S786"
FT                   /protein_id="ADL24768.1"
FT                   /translation="MVKFFYHLFYNSTRNTHNTFKLFHLQNRTGAQYISILDAMRNIFE
FT                   EIGKTPAEIEAKLNKAFTQLFKGDRENERICFDKGNDMAYIVDIGHNDIRSEGMSYGMT
FT                   VAALLGKQDLFDKLWKFAKTHMKNTEGDLAGYYSWQVSTADFSMMDPGAAPDGEEYFAA
FT                   ALLYAAKIFKNEQYKRDAVELINDMAHKPQAGDVYTMMDVNAGLVRFSPMKGNDYTDPS
FT                   YNTVAFYRMYGEASGDAIWNKIADNSVAYLKKACHPVTGLAADYSEFDGTPKKTPWHPE
FT                   SDCFCGDAWRVVWNIGLDAAKLQDKCERADVSEWEVSAVRKILGYLHGRRPYLADMRVD
FT                   GSAFPREARPATGGLIAMNAASTVALPAGDPLIKPFAEDLWNMEIPTGLWRYYDGLLYM
FT                   LGLLACSGKFNV"
FT   gene            complement(687290..688615)
FT                   /locus_tag="FSU_0614"
FT   CDS_pept        complement(687290..688615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0614"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27404"
FT                   /db_xref="GOA:C9RJV7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJV7"
FT                   /protein_id="ADL27404.1"
FT                   /translation="MLIEDVKKSIIDAGFHDGEKMPSVRKMAERLKLSVNTIHKAYKLL
FT                   AIEGRIQLVHGKGCFWGTAPSFEVKAEESVYSVVERLFQNDLDSGYLNAFDELPSCKEL
FT                   SNRYNVSLYIVKKFLMQKCSQGILRHVGHRFFFSEERPVEKSNFILFVHRSDEFGRLKI
FT                   ESERESDVFRTFAQIAAEQKIAVKFIGYHEASNLFYLSSGETFVVKNDTHCLGVFLSTW
FT                   LVNDAAKLFAHFASFKNPISVWWEYAPDVIPVIARNKKKWAFYNVAFGKEAGVIVGRYL
FT                   KSKDMGPVHYLSPYHASFWSKARLQGLLDAGTDVIPLVDERYASPFDLADAAEHEGVER
FT                   QVLLDNILESLLKNATLDKFVCSNDWVAASLIDYFKAKKLPAPYVVGFDDTIESYRYVF
FT                   DSFAFNVGTMVKEAIYHIVAPTIYAEQRRQMQTPLGRVVEKH"
FT   gene            complement(689100..689300)
FT                   /locus_tag="FSU_0615"
FT   CDS_pept        complement(689100..689300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0615"
FT                   /product="cytochrome c oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26916"
FT                   /db_xref="UniProtKB/TrEMBL:D9S788"
FT                   /protein_id="ADL26916.1"
FT                   /translation="MILLLDAPDRECVVLFDGAFRITFVVTANGHEVCDVGRFFGGCPE
FT                   ECGLVHVFVSEMSVAFAIRVE"
FT   gene            complement(689356..690375)
FT                   /locus_tag="FSU_0616"
FT   CDS_pept        complement(689356..690375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0616"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27195"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJV9"
FT                   /protein_id="ADL27195.1"
FT                   /translation="MKKLSFVACTAFAALMFVACSDDPVTAAVPPAGGGAGQGGGVALD
FT                   STRNISVAFKGCFDYSYNDALKKTAVENPKAYLVTDDAGYHVVIPDMAGTCGYENIVFN
FT                   NQRVLDTLKINFEGDPAECRCINDVWFNIDPLDADIKYLVYLNTVYEIVAEPLLERSSS
FT                   SELLMQSSSSDVAESSSSVVSSSSEEDPSRVIVTDANVQCEDRRTFDPMLDGNSVESFT
FT                   REKSDAALPPVAYRYVSTENVGFTIKNVTATCGSTIESLNVVALDGTLKVNVEYGSAYD
FT                   LNQNCICHSQITFSVKIDPVYSTAEYLVLNDHGSNFNNKMMIVDLDVIRTDDIPNSDF"
FT   gene            complement(690466..690561)
FT                   /locus_tag="FSU_0617"
FT   CDS_pept        complement(690466..690561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24873"
FT                   /db_xref="UniProtKB/TrEMBL:D9S790"
FT                   /protein_id="ADL24873.1"
FT                   /translation="MEPCFAISNALLHIENYFVEFFIKTFKILKI"
FT   gene            690603..691487
FT                   /gene="purC"
FT                   /locus_tag="FSU_0618"
FT   CDS_pept        690603..691487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="FSU_0618"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25281"
FT                   /db_xref="GOA:C9RJW0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW0"
FT                   /protein_id="ADL25281.1"
FT                   /translation="MSLKFETPITEVPLFHQGKVRDMYDLGDSFLMVASDRLSAFDVVL
FT                   PTPIPGKGKILNQLSLFWFKHLGMKNHLITADVNEYPAVLKKHADYLRGRSMIVKKANR
FT                   HSVECIVRGYIVGSGWKDYQKTGKICGHVLPEGLQLCQKLEKPLYTPSTKPDVGHDENI
FT                   SFEQTFDIVGEKVATTLRDMSLDIYTKARDYAASKGIILADTKFEFGEIDGETILIDEV
FT                   LTPDSSRYWPADKYQVGKNQESFDKQYVRDWLETLDWGKTYPGPEIPPEVVKNTLAKYE
FT                   EIFVRLTGKQPEL"
FT   gene            complement(691541..692350)
FT                   /locus_tag="FSU_0619"
FT   CDS_pept        complement(691541..692350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS08109.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25428"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW1"
FT                   /protein_id="ADL25428.1"
FT                   /translation="MANVLKFESIDNARQLGGIPAGGSHVKHNLLFRSSNLSKATEHDL
FT                   HRLRDDFGVHLVIDLRSDFEYMQKPDKLLDGMDSALIPVLDDSMHGDAFNKDQVVPATG
FT                   VDFMEFLFGIARHPIANTLKDKLYNYFVDSDYASSQYAKVFETVRAQKGAPVLWHCTSG
FT                   KDRCGFCSALMLAALGADDNAILDDYAESENSYRKPLEAMTAKGRESGMTDEQLDILHF
FT                   LVSVKREYLEIPLKRINAEYGSLLNFITQRMHVPTATIDALREYYLE"
FT   gene            complement(692377..693063)
FT                   /locus_tag="FSU_0620"
FT   CDS_pept        complement(692377..693063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0620"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25844"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW2"
FT                   /protein_id="ADL25844.1"
FT                   /translation="MNQFVLAFPIPVAVNEPFAITETVQVNADTKTLMIPGCSVQFNVV
FT                   RQGASADLLEIFKERDELSAEEEKAIVDHKSLLFLLGNVKTMDDVEMVNSAILKVLNAK
FT                   AAGVYMQQSGTAWTAKAFEEQFGDCDYPMDPWINILDSGDSLYTLGLAVFTLPDLCISN
FT                   TIEDPEEALLMAADSLFGDGVPAKSGSVIDWGEGERYTLRQETKTLFSKDAPEFNKQGV
FT                   LRIVKK"
FT   gene            complement(693060..694247)
FT                   /locus_tag="FSU_0621"
FT   CDS_pept        complement(693060..694247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0621"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:Q8TTI1; match to
FT                   protein family HMM PF04101"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27165"
FT                   /db_xref="GOA:D9S794"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D9S794"
FT                   /protein_id="ADL27165.1"
FT                   /translation="MPVVREFLRAGAEVELAVVKANANFFREVFPDLRQRLAPSYNIVY
FT                   PKHGYNMALWLLKNSMHLNAVMRYEHHFAEEMVKRHGYDVLFSDNRFAFYSKKALSIYM
FT                   THQRRIAFPRAFAAFERIGVMWHANIMRKFDEVWVPDLEIYPGYAGSLSHSGATPGDKP
FT                   MRFVGTLSRFSEMGNDGNALGNAPAPVDLEREVDLMSMSEFMAHSANVEWDAAPEKRTS
FT                   GNHSFEMRANYKVVAVVSGVEPARTQFEQQLRDALAQIPGRHMMILGKPSAEQKTWTEG
FT                   NIEFHTHLATNDFAEAVKRADFVVSRGGYSTVMDMAELGAKCIFVPTPGQFEQIVLAHD
FT                   LSKAGYAVEIPADELSAETLTSAFEKSVKMPKVEKQNLLHDAVEDVVRKFKERLI"
FT   gene            complement(694298..696838)
FT                   /locus_tag="FSU_0622"
FT   CDS_pept        complement(694298..696838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0622"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF08305"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26195"
FT                   /db_xref="GOA:C9RJW4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="InterPro:IPR038637"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW4"
FT                   /protein_id="ADL26195.1"
FT                   /translation="MKKETLGRDGVKSKSLRQSFMEWKNSLHWDKPQNIMLAVTMFVLV
FT                   AAFLIFNNLSVPYARHWDIQWGYYSILATFLLLVAGVVVNAPFVAKHVRGFLPSGKSFC
FT                   GLALLLIVFSVFIFGNIGNTHRVLSDETSWESMGLQMYFQHTGGVCNEGVWTDGVLDCK
FT                   TEVNNFKGKALGFVYSLVFNFMEPNRDSALMVNYPFYILSLIAFFLALSKWFKSDKLAL
FT                   AATAFLGGMPIYLLQSRSASTEVLYILLLAVLMAWYAFVPTNKVTWKHFLLTVPLLGFF
FT                   AQTRQETVFAFIPFALYYYRYFLEKPYRLPAFVASVIAVSWPSINTMAAYRGYDFQGGT
FT                   HAAHSFENLWFNLKTNIEVMMNLKPDSAFGGIMENPFYTTFTVILLLATVWLLFRMIYS
FT                   RRYVRGFILGITFCVQIFVILLNVSGTFTIDINQRYVLVALPLFALLMALGLYDALVFT
FT                   TKMKSDAAAKIVAGFACLLSIGLMLYHAPSYKANMLYYKNKLLAEEDFLNTELAKYPKN
FT                   SVFIYARPWQMLASGHTSFSESSFKSWSTEKFAEWMQKSGGNIYLVRGQDGYGKVNRNS
FT                   RVVGFKTTDQIDDILSDYKNERVLMEARLFGYGLAIYKIISKKGVSHYAQNFMVSEETN
FT                   GMIVVNKRFPESIACDYKVNDKDQGEMLVSQSADTLQLDSAKIRAGLNRVVLSCYMPDE
FT                   DTLVTYRDFFVEGENVALLSKLKMGKFFQEWGEPQMNETVDHHKITIDGEPFRYGIGSH
FT                   ANSAIEFPLSRGYDWLNVVIGLDDESACGDGAYFAVEADGREIYHSKKLYTTDKERLRL
FT                   NIKGAKSINLRVLMGNDKDCDHGDWAHAWLEAEK"
FT   gene            697044..697694
FT                   /locus_tag="FSU_0623"
FT   CDS_pept        697044..697694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0623"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27038"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW5"
FT                   /protein_id="ADL27038.1"
FT                   /translation="MFYKHWKKISLALTGFFWASCDSGTTTEPPLYGAPPQYSRSSEIQ
FT                   NSSSSSEDKISSSSEPLPMPAYGVPQMDCEVTSESDLTVTCENGYTCTAKTDTVHVSAP
FT                   ACETFNGTTICPAYGVDADVFIKKYECNDGFTYDDTEFKKIYKTLSCTFKGSEIENTVP
FT                   PKAYHDYECNDGAFCYSEQGTEKTTFNCIDTQGNEITYTEDEFKAMYNVKEPE"
FT   gene            697691..698545
FT                   /locus_tag="FSU_0624"
FT   CDS_pept        697691..698545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0624"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24636"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW6"
FT                   /protein_id="ADL24636.1"
FT                   /translation="MNIRKHWKNLLLTTTAFFWAGCNGDSVTESGCPCYNGSGISSEAS
FT                   SSSESVESSSSSEAVASSSSESASSSSANGSSSSEVTCAPGDSLVSYYPPSYSADIAKM
FT                   NAEEKAKHASVSKIDSISNTLQTVPQCLADLRQELNMFVALYGAPMKFNKNEVCSDGTT
FT                   RPTQEYLDYLKMKEEWERNKPALDAECQKIYEDKLKEIEQTIKECIATSNPNTDLTVCD
FT                   FDAMCPEYGVDSKCTYKYTCNDGVTCRRTEGETNMVCTDKQGEKTTYTKKDFDKKYYTK
FT                   ENY"
FT   gene            698561..698965
FT                   /locus_tag="FSU_0625"
FT   CDS_pept        698561..698965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0625"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26219"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW7"
FT                   /protein_id="ADL26219.1"
FT                   /translation="MLYKHWKKFFLSVLALFWSGCENEDDAVASYGCFPTQCYNTTATN
FT                   DLGEVFDIIECDDGYKYLRQSGIYYEHPELQEKLPEGVEAITPPAGSCGASNCTNKGPD
FT                   YCYKESKKTLEGTTQEYEVCVPSIDCPEKH"
FT   gene            698987..700063
FT                   /locus_tag="FSU_0626"
FT   CDS_pept        698987..700063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0626"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26645"
FT                   /db_xref="GOA:C9RJW8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR026404"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW8"
FT                   /protein_id="ADL26645.1"
FT                   /translation="MQLSLKKKLALEAYRLYRHNEIKAHPLTYFFWECTLRCNLHCLHC
FT                   GSDCVKDAIPDMPREDFMAVLDKLTPHIDPKHFIVVITGGEPLMRPDLEECGQEIKKRG
FT                   YPWGMVTNGLAMTPERYTRLLNAGLRSLTISLDGLEASHNHFRGDPHSFERALRAIDMA
FT                   AHTQGLTFDVMTCVNRENLKELPKILDMLLKIGVKRWRVATVFPKGRAKDNPLFQLTNQ
FT                   EFRQVFDFIREVKSMNVINVNYGCEGFLGSYEKDARNYPFFCRAGVNVSSVLCDGSISA
FT                   CPSLRGDYIQGNIYKDDIWDVWQNRYQVMRDRSWAKIGDCKTCKYWRYCEGSSLHLRDE
FT                   KTKELAYCHVQRLEAAGA"
FT   gene            complement(700157..701059)
FT                   /locus_tag="FSU_0627"
FT   CDS_pept        complement(700157..701059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0627"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27338"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJW9"
FT                   /protein_id="ADL27338.1"
FT                   /translation="MKKLSICAAAIIALAMTGCDNGKTGTIEGEVRDAFTNKPLEMPTV
FT                   GMDSTIYTTLSKKYEFNQELRKGKFKFVKVPVGAYRVYAGRSKYVKTRMKIETTEQNPN
FT                   ASLILYIYSAQVDPGLYQGTPEGPLKIDNKWVVYSTNCDESIAGYRLTMPQQQAGDAKA
FT                   SLAEKIGVKKKGKKGKKARKAAPVAQVAAAVTNLPDPRVVEGKLEVFYHNSSSVSTAIT
FT                   AKTYPAVVAPIASHKDCKGFGAGETKGVFPVKDKATDLKVEYVAENLYKISGNLPKGKQ
FT                   IIQLSQDGKTLQTYYFEAK"
FT   gene            complement(701127..701399)
FT                   /gene="rpmE"
FT                   /locus_tag="FSU_0628"
FT   CDS_pept        complement(701127..701399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="FSU_0628"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27394"
FT                   /db_xref="GOA:D9S7A1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7A1"
FT                   /protein_id="ADL27394.1"
FT                   /translation="MFVDANTGKEYITRSTKSSAEKKTIDGVEYNVISLEITADTHPFW
FT                   TGKQHRVDTAGRIDSFNKRYGGGANITSAKRKTRKAAPVKAEEEA"
FT   gene            701479..702117
FT                   /locus_tag="FSU_0629"
FT   CDS_pept        701479..702117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0629"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26607"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7A2"
FT                   /protein_id="ADL26607.1"
FT                   /translation="MFFRILASCNLIFSIFYSMKSLLLLSSLLLIACGNDHPTAKIVEV
FT                   NKRMVLEEWPDSNYIASLDSILKLEPVKKGKDTADVSLKMNAFKAPTFKLPPSVTGKST
FT                   SRKSGLSKPPKQVKQAAEASKPSNNAENFVAKFSNALSALQSDPSNKGLYKVVTANDGE
FT                   DLFKLLRRTYGAGTQNLPRFYVLSALQSVNPGVMLEHLNAGDKVRVPRL"
FT   gene            complement(702386..703771)
FT                   /locus_tag="FSU_0630"
FT   CDS_pept        complement(702386..703771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26581"
FT                   /db_xref="GOA:C9RJX2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX2"
FT                   /protein_id="ADL26581.1"
FT                   /translation="MKLWWQNTLFCVVAVLLLGAVLCCASECRIVRVEWVGDHSEFEEL
FT                   SMNDVVGAPCDSWRGAKQKLLRYYEDKGFLGAKLQVAVDSAGVMRCEFVRGSAWVWARP
FT                   ENLDSGATDVDVFARLTGLELGGKVSLSDLERSERKMARLGYYEKTADVRLFRDPVRNR
FT                   IIPAYSMRAVPISAAEGFLTYSSDDNVWEGKINLDLYNILGTGRDLQMEGYSQSDSRRL
FT                   EGLYRERFIFGTSWDVVVRGFFEDDSLSRNSRLELGVSRNIGFSFDVAAFVGIGNDEKS
FT                   STLELSYISFDRSVLPRSGMSVDLSLAWMMDRPDSLDSYLRLQSSLVYYLPLWKNFIVR
FT                   YSAAAGAMLPSGGAFAREDLFSLGGINSFKGMMYGFMRTRAYGFSQAAFLWQDGYDLSI
FT                   ELFFQPGLYRRMKPFHGWASEHDYGIGFTQYRKSWSFSIYYALRNGCDYLDGVLGFGVK
FT                   TLF"
FT   gene            complement(703773..706667)
FT                   /locus_tag="FSU_0631"
FT   CDS_pept        complement(703773..706667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25654"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX3"
FT                   /protein_id="ADL25654.1"
FT                   /translation="MRSIPCLGLLFASLAFALDVDSLPVWDPSILAKNALENAPGAALN
FT                   SAQAEDSSRAEIETHGYKTMQVTVGDGGTQVDQELRLSIQGRLADSVYIDALLSDVDRK
FT                   AGDQTTATLQDVDQIYFRVESPYAMLHLGDFTWTDNSMAFTSFSRSTLGAMATLRYRGS
FT                   EVSGAWGTDEVTRYSRSFSGVQGQRDGYHLDESGSFVSVVPNSERVWLNGVELVRNRDY
FT                   EVNYAGGLLDFKNGIIPGSDDEVFVEYDAYLNDDIYTMYAARGSLRFENVFFDVSGFHL
FT                   ENDVDRMRKSTLDSADYERLKNDRGGELKDSLNQDLHRPKMSERLGARLRLQAEHRFYA
FT                   DVELGLNRMDSNTVSKNVGGPSGRAFRWYVTTDSTQNMNTFPVALSVYGNYVQEGFAIS
FT                   EFGGRDRDWDAYALRNEWDLDSAKLSGDLRYDELALRIRLGKDWFGTAKWGYRRGDDER
FT                   WNSSRSQLSLVHRGLDAKSEFTASYVSSAQEVEQKRYQGTFSSEFLRGFFRPFGSGDVR
FT                   YSVRDSLGYKSERGYAKTAVGATLNDDLWNVKESVGTLTVRKHDLTDRADGLSRREGWR
FT                   DSVNLVTWTQSAEANFHNFSLSHLLQYSHAVTDSLGASDSWVGDLTTNFGDDDMGVQGS
FT                   IAYRFGMTSEQTYTAIYKAVAKGTGDVRYDSLTGTFIEGVDNGDFVYEGMGRNDSVGAV
FT                   LSSNASFEASLEWNPGVSLGVNQGLLRDITLSASYHSEAEDTTGEKIYFPPVYSAALRR
FT                   MTAGTVSWDASLAWDHPSGISASYNPSASYEKKMSSIGYFQDMFDHSLRASFNINESHY
FT                   VGVDNTFEKVHLTALQKLDWNIWEITGRYTWKLPAGFSLSPRVRYREGSGEDDMEESFG
FT                   AHLWEEELRVGYEKEGVVDAHVSFASIQMDTHEGAIPYQMMSGFGNGVTYRLETMVSVE
FT                   VNHFLSFSLRYILRFGDAEENVFQKLTSEAKAFF"
FT   gene            complement(706674..707141)
FT                   /locus_tag="FSU_0632"
FT   CDS_pept        complement(706674..707141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27275"
FT                   /db_xref="GOA:C9RJX4"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX4"
FT                   /protein_id="ADL27275.1"
FT                   /translation="MAGKFPPLRNLRKTTVLAIVVFLGFFVHRFVMFFIDDEVNFTDNS
FT                   DIELSPANSVVCRHIVNGEPFGSDSVFEENTRLYVFSSITNSARYQEDTLVHIWFLGID
FT                   TIFVETCNLTGDVCSSMLASDLVELGEWSVDLVAGRKLLASRQFRVVTPSR"
FT   gene            complement(707151..707576)
FT                   /locus_tag="FSU_0633"
FT   CDS_pept        complement(707151..707576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0633"
FT                   /product="putative mglB protein"
FT                   /note="identified by similarity to GB:AAA25388.2"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26257"
FT                   /db_xref="GOA:C9RJX5"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX5"
FT                   /protein_id="ADL26257.1"
FT                   /translation="MSDYTIYSDDANKVRRLMSAYQASVKCEYVVLCHRDGNIIAEVGS
FT                   LGSDLDATPLAVLSIAAFDSSRQIGVMLGGEKFQSVSFTGENRSVYISPVDRSLLLVQV
FT                   FNGGRLPNRIDDFNRLLVEKLEDAVPAFTQNTSSLVR"
FT   gene            complement(707601..708542)
FT                   /locus_tag="FSU_0634"
FT   CDS_pept        complement(707601..708542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0634"
FT                   /product="putative gliding motility protein MlgA"
FT                   /note="identified by similarity to PIR:B32048"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24901"
FT                   /db_xref="GOA:C9RJX6"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX6"
FT                   /protein_id="ADL24901.1"
FT                   /translation="MSSINFATREISCKVVYYGPGLSGKTTNLQVIHQKMPQDKRTDMV
FT                   SLATEGDRTLFFDFLPLNLGDIKGFKTRFQLYTVPGQVYYNSTRKLVLRGVDGIVFVAD
FT                   SQRSRQAENLESLQNLRQNLQDYGMNLDDIPFVLQYNKRDMDNVFTLDEMNEMLNPDKK
FT                   IQFFPATAHNGKGVVTTLKTIAMLVIEKFNVKQGFLRKAAVNAAAAAPTASDAPAQNAD
FT                   AGKPQNESAAPQQPTSPFRMPSFAAKPQANMSNSGGAGSGLFQKGAMSSPFARPRVATA
FT                   VPRMPTFGRAVEKPTQTDDDEIVLRPYKPKDK"
FT   gene            complement(708571..708732)
FT                   /locus_tag="FSU_0635"
FT   CDS_pept        complement(708571..708732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27179"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7A8"
FT                   /protein_id="ADL27179.1"
FT                   /translation="MCIGLFCYPELLKEIRQVVSWGIFPLLVDEKIVILIKKGQKSKNS
FT                   FWFNELFY"
FT   gene            complement(708776..709036)
FT                   /locus_tag="FSU_0636"
FT   CDS_pept        complement(708776..709036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0636"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by similarity to SP:P02378"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27112"
FT                   /db_xref="GOA:C9RJX7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX7"
FT                   /protein_id="ADL27112.1"
FT                   /translation="MPQHKSCKKRLLQAEKANAMNRSTRSAIRASLKVIRTAATKAAAL
FT                   EEMPKLFSMLDKAAVSHRAGFCANRAANYKAKVAKVINGLA"
FT   gene            709348..710433
FT                   /locus_tag="FSU_0637"
FT   CDS_pept        709348..710433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0637"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by similarity to SP:P15263; match to
FT                   protein family HMM PF00155; match to protein family HMM
FT                   PF01041; match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26478"
FT                   /db_xref="GOA:C9RJX8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJX8"
FT                   /protein_id="ADL26478.1"
FT                   /translation="MIPFINVRAQREAYLSEFKQAEQEVLDSGCFIGGPQVQALETELA
FT                   EFTGAKHAITCGSGTDALTIALLALGLEPEDEVIVPDFTFIAPAECVMRLGGIPKFADI
FT                   DAETLQISVESIESLIGEKTRGIIAVNLFGQCAPYAEIRKCARANNLWLIEDSAQAFGA
FT                   MQNGVPACTFGDISITSFYPAKPLGCYGDGGALFTANDELAKKIRLIANHGSQQRYIHE
FT                   ICGMNSRLDALQAAVLRVKLRHFKDELKKRSENASKYNEFFNAVPGIAPQKIAVGNTST
FT                   YAQYTVLADDRPAFLKQLENAGVPYCIHYPQPLHTQPCFKGLNQGIGNGNAIEACQKVV
FT                   SLPMCAFTDVDEIIARLKKVM"
FT   gene            complement(710537..711385)
FT                   /locus_tag="FSU_0638"
FT   CDS_pept        complement(710537..711385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0638"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24824"
FT                   /db_xref="GOA:D9S7B1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7B1"
FT                   /protein_id="ADL24824.1"
FT                   /translation="MMKLLFTDLDGTLLDDEKNISQADMASIQAMIGAGHKFVMTTGRP
FT                   LTSVKHIAEKYGFLKPGYFLVSFNGGLIYDCGTEQPILTRRIAVDQVKFIMDEAHKRGM
FT                   HAHTYAGDLVVSEYETEQLKTYCRLMKMDYVVVDDIRNYYGGVNCNDGPINVVVKPPIK
FT                   VNVITPFEHSSLVDFRAEMRTITAGKLFDVFSKPEMLEFSHMLSNKGAAVRYMADFYHE
FT                   PIENTIAVGDEENDCPMIEAAGVGVAMANASPAAKAVANYVTEHDNNHSGITEVIEKFV
FT                   L"
FT   gene            711458..712408
FT                   /locus_tag="FSU_0639"
FT   CDS_pept        711458..712408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0639"
FT                   /product="DHH subfamily 1 protein"
FT                   /note="identified by similarity to GB:AAM92024.1; match to
FT                   protein family HMM PF01368; match to protein family HMM
FT                   PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26783"
FT                   /db_xref="GOA:C9RJY0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJY0"
FT                   /protein_id="ADL26783.1"
FT                   /translation="MQIDDLLKEAKSVAIFGHVRPDGDCVGSTLGLYNYICDNYPTMKT
FT                   RIFLERFPENYKILSNSNEINEFYNDEFGSFDLAFLLDSSTFDRVGANGECCIKAAKKT
FT                   CNIDHHVSNPLNLCDVNYVDAKASSACEVLYFLLDPNKVSKATAECLYLGIVHDTGAFK
FT                   FSSTGHKTMMVIGDLLEKGIDFTRIINETYYTRTYTQTLVTGYVMMSSKLALDGKVVYS
FT                   YITPEDMDRYSVTPVELSSVIDTLREVTGTEVAIFLYPVNGDYKISLRSNYVVDVNKVA
FT                   GVFGGGGHVRAAGASSKDSPEETIAKLLKVIQEQL"
FT   gene            complement(712405..713025)
FT                   /locus_tag="FSU_0640"
FT   CDS_pept        complement(712405..713025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0640"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26135"
FT                   /db_xref="GOA:C9RJY1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJY1"
FT                   /protein_id="ADL26135.1"
FT                   /translation="MLEFFIAALVIGIAPGPDNLFVLAQSATYGARLGFCIILGLCTGI
FT                   AIHTCLLVAGVSALIAASPTAFFVIQCLGAAYLLYLAYKSFGVKAGVVQMNGDSRSEPG
FT                   MTSARSLYMRGIIMNLTNPKVILFVLSLIPPAVRLERPIHPSLQMAIFGGEFILATMIV
FT                   FGCIALLAGTVKKFLLTSPKANRNLNWFSGAVFVFLAVALFFV"
FT   gene            complement(713025..713495)
FT                   /locus_tag="FSU_0641"
FT   CDS_pept        complement(713025..713495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0641"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25095"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7B4"
FT                   /protein_id="ADL25095.1"
FT                   /translation="MRAQNELDCVKIKYCCCIWLGIVKNSTLWYMSEMDIECPHCGTKF
FT                   KVQIDGDFSNMMVFPCARCQTPLMCYHGEISELDREEFSKLREKLSKVLNVVMRQDGTV
FT                   GEVANALKKLVDVSNARADEREQNHTVITDDELDALQKDLADLDVDAFLSKL"
FT   gene            713528..714676
FT                   /gene="mraY"
FT                   /locus_tag="FSU_0642"
FT   CDS_pept        713528..714676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="FSU_0642"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by similarity to GB:AAG22121.1; match to
FT                   protein family HMM PF00953"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27348"
FT                   /db_xref="GOA:C9RJY3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJY3"
FT                   /protein_id="ADL27348.1"
FT                   /translation="MLCHWLYQTTNIDLFDGRLFRAGVAAMLSIILVLFFMPKYIRFLQ
FT                   RLDATSDFDKDGKTKSPPIMGGLLLVIVVEIVSLLVCQMNGYTISTLVILALFSAVGAT
FT                   DDMAKVRAKRLVNQGKLKAAEYMDKADGISSSLRLFLYFLFSFVVAVFCYKFIPELKGD
FT                   LTIPFCPIDVFQIHLPNWIFVAFMTFVIAASANGTNFTDGLDSLVSVPILTSMVFVGLV
FT                   AYVSGNFIFSQYLSVPYLPGCDELFPLATAIAGALLAYLWFNSPPAEIYMGDAGSVGFG
FT                   AAIGIMFILVQAGLFLPIVCIIIIAEACSVLMQITWFKITKRTTGTGKRIFLCAPLHHH
FT                   YQKKWDGRFPSKPLMNSKIVWRMHLVSIFALIFSMVVFFGIR"
FT   gene            714748..716136
FT                   /locus_tag="FSU_0643"
FT   CDS_pept        714748..716136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0643"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01704"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26617"
FT                   /db_xref="GOA:D9S7B6"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039741"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7B6"
FT                   /protein_id="ADL26617.1"
FT                   /translation="MLCPPPSGHLLFIILHRMNIIETLNAAGQQELAQHLESLTGDARA
FT                   NLERDILSQDWQELKALHAEKSAANLSDNVSADLTPMPWKLATDDLRYDFWKETGEILL
FT                   GQGKVAAFLVAGGQGSRLGFDGPKGMFDIGLPSHKSLFQLQAERLRNLGARVGHAIPWC
FT                   IMTSPLNHEATVNFFSENNFFGLNREDIRFFQQGTICALTADGKAVRDGEDHLALVPDG
FT                   NGGCFRALAQSGTLAWLVERGVQYVFLYSVDNALCRICDPAFIGALAEKGTILSASKVV
FT                   HKAGPNEKVGIFAFQNKKPGVVEYSDLPENFRDMTNADGSLTFDGGNIAIHLFKISGLR
FT                   KLQTSKLPWHTARKTVCGIEKCFKFEQFLFDAFPQLGSMLPFGVVREEEFSPVKNAEGN
FT                   DSPKTARIMIGKLHREWLRKAHVKIDEKKLYEISPTISYAGEGLKQSVFDRELGRNILE
FT                   FDED"
FT   gene            716228..717175
FT                   /locus_tag="FSU_0644"
FT   CDS_pept        716228..717175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26154"
FT                   /db_xref="GOA:C9RJY5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJY5"
FT                   /protein_id="ADL26154.1"
FT                   /translation="MHRIKVITYKFLIYILLRLPDAFYAVLFAIVFPVYKALHKKRAYG
FT                   RVEKHLATAKKYEARESDGTNKMQRNVKSPSPNAIAKINARDTFKGIFWNALESYRGLA
FT                   HIKSVEKRIVYENEHIIRDAIADCAKTNAPIAGISIHQGAFELLHRALCRYSEHVHLIT
FT                   DSVGDIAFREVLKDLRSDPHLTEYHPDETGCLIRELFHTKGILAMVIDQGKHTKGNTVS
FT                   LFGRPSTLYLRLPQKINEMGAGIVTFRTWSEKKRIVIRFEKYYPPKYDESFGNAENAAS
FT                   SESALVTKIAREVETWIAEHPEQWSWNYHGNFIG"
FT   gene            717237..717692
FT                   /locus_tag="FSU_0645"
FT   CDS_pept        717237..717692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0645"
FT                   /product="smr domain protein"
FT                   /note="identified by match to protein family HMM PF01713"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25840"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJY6"
FT                   /protein_id="ADL25840.1"
FT                   /translation="MPLNADEEFQLEWIKNHQMEDKDELAEIQAEAEAEARPQRATRGK
FT                   KMRRNPAAWEMPNPEDEIDLHGLTSEEAAEAVERRIDDLLIAGLSVLRVIHGGGNPEYG
FT                   NVKRIIDRKVRSEWKNRVVFYKVEPDNAGSSIMKIGKPRPQVTKKKK"
FT   gene            717794..717870
FT                   /locus_tag="FSU_0646"
FT   tRNA            717794..717870
FT                   /locus_tag="FSU_0646"
FT                   /product="tRNA-Pro"
FT   gene            complement(719017..719883)
FT                   /gene="trxB"
FT                   /locus_tag="FSU_0650"
FT   CDS_pept        complement(719017..719883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="FSU_0650"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by similarity to SP:P50971; match to
FT                   protein family HMM PF01134; match to protein family HMM
FT                   PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27333"
FT                   /db_xref="GOA:C9RJY9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJY9"
FT                   /protein_id="ADL27333.1"
FT                   /translation="MADILILGHGPAGVSAALYGLRAGLEVQLVGKDVGALAKAHKIEN
FT                   YFGLEKPLTGAELAEVGKKQAIALGAQIVDDEVTDLMFDGFGFVATGLNGTYRGKVCLM
FT                   ATGSARKKTPLPGMAEMEGHGVSYCAVCDAFFYRKKDVAVLGSGEYALHEATELLSVVN
FT                   SVTLLTNGAELTAKFPESVKIETRKITGLKGAGQFEGVKFDDGLEANFDGMFVAMGSAN
FT                   ATDLALKAGAAFDAGKLVLDKDFQTTVPGLFAAGDCTGGTLQVAVAVGEGAIAGLAAIK
FT                   YLREHRE"
FT   gene            719959..721074
FT                   /locus_tag="FSU_0651"
FT   CDS_pept        719959..721074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0651"
FT                   /product="putative xylanase"
FT                   /note="identified by similarity to GB:AAC27700.1; match to
FT                   protein family HMM PF01270"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26708"
FT                   /db_xref="GOA:C9RJZ0"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C9RJZ0"
FT                   /protein_id="ADL26708.1"
FT                   /translation="MLQRYPTRDLFVEAGYGPNFADQLIQNAYSKLFEGDPIDERIYFE
FT                   ASDDMAYIIDIGHDDIRSEGMSYGMFIAALTDHEVTFDKLWNFSKRFVRNNDGPHKGYF
FT                   SWQVNTTDFSMMDPGAAPDSEEYFAAALLIAAKRFNREDLLNDAKELIHDIKYKPQNEL
FT                   VGPIIDPERKLIKFSPVLGNDFTDPSYHTMAFYRMFAEATGDESWLEVAQASIEFLQKA
FT                   AHPVTGLCADYAEYDGTPKAMPWFPESNNFSGDAWRVALNLSLDYAIFHGHESEKEICE
FT                   RILHFFQNCTPYLSDYSVDGGPYPHQGRNATPGLIAMNAAATQVLPVDDPRITPFVRRL
FT                   AALSVPYRFWRYYDGMLYLIGLLATAGKITL"
FT   gene            721085..721999
FT                   /locus_tag="FSU_0652"
FT   CDS_pept        721085..721999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0652"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07661;
FT                   match to protein family HMM TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25414"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKC6"
FT                   /protein_id="ADL25414.1"
FT                   /translation="MKLPAILFIAASSIAFTACDDVRVEKYPNGNVRFEATYVNDKKEG
FT                   IEKEYYDDGTLKRESNYVNDRREGVTKEYYKDGTLQSELPYVNGYVEGTVIRYHKNGKV
FT                   ATKAEYKQNKQVAFGETYNEDGTPATSGSYKDPRDGISYEWIVIGDQLWTAENMNFATA
FT                   SGAICSQCNHWGRLYDFQNAQKACLEGFHMPSKAEWQKLLKVAGKKPGVALKAGYGWDP
FT                   IKPESPIFGNGKDELGFGAKAGGAHFAKSDVAIKDRKFDEAGKKAYFWTREGDVLVFFH
FT                   DKDIAKFEKFNPEFGASLRCLKD"
FT   gene            complement(722175..723353)
FT                   /gene="bdhA"
FT                   /locus_tag="FSU_0653"
FT   CDS_pept        complement(722175..723353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA"
FT                   /locus_tag="FSU_0653"
FT                   /product="NADH-dependent butanol dehydrogenase A"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by similarity to SP:Q04944; match to
FT                   protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27150"
FT                   /db_xref="GOA:C9RKC7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKC7"
FT                   /protein_id="ADL27150.1"
FT                   /translation="MDNFNFYSPTEFVFGKDRENECGELVKKYGGTKVLIHYGGGSAVR
FT                   SGLIDRVKASLNAAGVSFVELGGVKPNPRDTLIYKGIEMVRANGVDFILAVGGGSVIDS
FT                   SKGIAVGALYDGDFWDFYAKKLPVTKALPIGVVQTIAAAGSEGSGDSVVTKEEGMLKRD
FT                   IGADVIRPRFAVQNPALLCTLPAYQTACGITDIMAHVFERYFTNTLEVETTDRLCEALL
FT                   ITILKEGPRAMAEPANYEARANIMWAGTVAHNGLVGCGRSQDWNSHAIEHELSGLYDCA
FT                   HGAGLAVIMPAWMEYVVDHNVMRFAQMATRVFGCQMNFENPKATALEGIKAFRRFLHSI
FT                   GMPINFAELGAKEEDIPTLVEKLNPGDGWGFVPLKAKDVTAIYTIAAHASLD"
FT   gene            complement(723446..724195)
FT                   /locus_tag="FSU_0654"
FT   CDS_pept        complement(723446..724195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0654"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAL38648.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24857"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKC8"
FT                   /protein_id="ADL24857.1"
FT                   /translation="MSKLVKIALVAVMLLALTSFAQSEGIQKKNIVFHTFSIALPMDWG
FT                   GTWTQYSNLEYDDGSFSRDRDFKMDMIMGLQLKWTRDLVYQNGLSFEVGAGIGFINFPV
FT                   NESKKYSYFDPYDHMNQIDSRFDLNAKVGLGYAPFVNDFILAVHAILGGDMKYLGKSYQ
FT                   MEDFTEEYSTLLFNFVVGGDIVLGYRITEKLGINAGVDVVVNLFGFGNRTNEFNYRNDN
FT                   FETIDYKLNHVFSGFQIVPCVGVSLKF"
FT   gene            complement(724403..725620)
FT                   /gene="argJ"
FT                   /locus_tag="FSU_0655"
FT   CDS_pept        complement(724403..725620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="FSU_0655"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by similarity to SP:Q07908; match to
FT                   protein family HMM PF01960; match to protein family HMM
FT                   TIGR00120"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26514"
FT                   /db_xref="GOA:C9RKC9"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKC9"
FT                   /protein_id="ADL26514.1"
FT                   /translation="MYTVLEKGGVCSPKGFTASGICAGIKASGNADMALLKSEKAARCF
FT                   AVFTTNKVKAAPVLYDKAALEHAHFASAVIVNSGNANACTGEKGYADAERMAVLTEEAL
FT                   KLTPKSVLVCSTGVIGHLMPMDKIEAGIPKLVEKLHEDASEEFGRAILTTDLALKSHAV
FT                   EIKTEKGVVTIGGACKGSGMIHPNMATMLAFITTDLALPIDFFAEFRANIADSFNAITV
FT                   DGDTSTNDTCIMLANGMSGIKYEDLSLSEQGEFRAALTLVMQSLAKDIVRDGEGATKLI
FT                   ELRIEKAESHEEALRMARFIGTSNLAKCAMFGEDPNWGRILSSAGSSGCNMVAEHTDLY
FT                   FGEVKVLEGGRPVQLDEKQTAALHAVVRQREYKVTLVLNIGQASASAFTCDLSYGYVKI
FT                   NAEYTT"
FT   gene            725695..726162
FT                   /gene="greA"
FT                   /locus_tag="FSU_0656"
FT   CDS_pept        725695..726162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="FSU_0656"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27116"
FT                   /db_xref="GOA:D9S7C5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7C5"
FT                   /protein_id="ADL27116.1"
FT                   /translation="MEKIMFTQEAYDKLVKDLENLKNVERPRVLQELVDARAQGDLSEN
FT                   AEYHAAKERLASIDNIEMPKLQDQLARAQVIAFDANSDTIKFGATITAKNLKTKREIVY
FT                   QLVSPEEADALNGKISFKSPIGAALMGKKRGDTVEVVTPKGKNQFEIIDFK"
FT   gene            726166..727134
FT                   /locus_tag="FSU_0657"
FT   CDS_pept        726166..727134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25887"
FT                   /db_xref="GOA:C9RKD1"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD1"
FT                   /protein_id="ADL25887.1"
FT                   /translation="MFVTLIGKDQFSKDKRIEKFLSETLGDRISDPMAKQVLYATDTNI
FT                   ASISDVIIEACDSVSMFSPEQVIVVRKAEALKTDDMKALAKWLPHAASGKLLFDFETLL
FT                   ASSELYKALAKVGKVEKFDVPKQYEMAEWISAVVPTHFNKAIEPTASQYLAEALGNDTK
FT                   LVSEEVEKIILYAPDCKKITLDLVKTMVVSQRDIPTYEIEGFFGMQNAKAYVQKLNELL
FT                   NSGVDAIRISNTLYNYALSLLNYGSLTAKGVSPEEAAKKIGKNYYMFVKKGQAAECCRR
FT                   WRKPLLVRVLRRLADLNYEIKSGKCPTRMSQELALAALVVR"
FT   gene            complement(727219..728682)
FT                   /locus_tag="FSU_0658"
FT   CDS_pept        complement(727219..728682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0658"
FT                   /product="bacterial type II and III secretion system
FT                   protein"
FT                   /note="identified by similarity to SP:P31780; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM PF07660"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25531"
FT                   /db_xref="GOA:C9RKD2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD2"
FT                   /protein_id="ADL25531.1"
FT                   /translation="MKKLTKILTILIMVASFATAWAAPAEGSVAPNKKLYDFNFVNMDY
FT                   EAIFRSVSVIAGVDILIAPDVKGKISLRVTKKTWQETLDIICNMNDLTWVIQDKYISIQ
FT                   RLSTYQAKQKKLADEENQAEQNAPLVRKNFQVHHAKADELVKVLESMKSNRGKISVVER
FT                   TNSIIVYDTESKIEQMGNALVELDVETLQIMITAKLVVVNSELARELGVDWTAALGSST
FT                   LTPGTAAAATGATAGSSRISGVIQSFPNGTSPAVGKANTAITASLLDNNLQIAISNLMG
FT                   DASTEVLASPQVSTLDNTEAQVFMGDKVSIRVIDDSGESSTKMVETGIKLTVTPHVSGD
FT                   NRILLDLHPENNSYGYDEKGEVVISTQEAKTKVVVADGETVVIGGLTRNENTESESGIP
FT                   FLKDIPLLGNLFKYSRKSITKKDLVIFVTPRIIRNYIGNVDISEKSEEINGAAPELKPV
FT                   DDKIMTSPVVTGETPDAPVPENSHDDWNQ"
FT   gene            complement(728679..730451)
FT                   /locus_tag="FSU_0659"
FT   CDS_pept        complement(728679..730451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0659"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25985"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD3"
FT                   /protein_id="ADL25985.1"
FT                   /translation="MKCKFLLMLLSSAVALQAALIKDVRFDCSKNCQMVFQFASDKNLP
FT                   TFFQKYDNASKTLTVGFSESDFALGVGNFDVDQSSPYVRSMNVSKELYRGMNFLMIRMP
FT                   VGASIASDKNAIALDKSRFLLKFSGKNGNSWTLSKLFASKKAAAEKAAREEEKRMAAER
FT                   KAAEKQAALDRKAAEKQAALDRKAAREEEKRLAAERKAAEKQALLERKAAEKAARDNIA
FT                   QAASAPGASALLPGLKEMTVIIGSGMEQFRLVANTSLNINKVSLPNGSFVIKLSIDGPE
FT                   RSPVFKVGAGSLVKSVFWDMDGLNIQLSAGAKPAILVQEGALILQTSENAIRRDGFVFW
FT                   SARPNGIYVRDWMKSPDAVPEFSDFVKSYEKDSKKVVASTQTFHLRPVLRELIVVADET
FT                   EFYASPSDKAPVMQRVVFGDRLVNMDLTGLYRKVQIGNKIGYVNRRAVSFTDELSAVQM
FT                   ERLKKVDQERGDMLTQGMRPGGSALDELYEDRVTYSSFGRRDPFVEIKGLVEEGINIDQ
FT                   VELVGIIWESEEPVAILVDSKNSGVSYTIKEGDKIMNGKVLKITQTDVLFLIQEFGVSR
FT                   RYSMGLPDKFGGQK"
FT   gene            complement(730451..731056)
FT                   /locus_tag="FSU_0660"
FT   CDS_pept        complement(730451..731056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0660"
FT                   /product="putative type IV pilus biogenesis protein PilO"
FT                   /note="identified by similarity to PIR:S77728"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27234"
FT                   /db_xref="GOA:C9RKD4"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD4"
FT                   /protein_id="ADL27234.1"
FT                   /translation="MGNLNIDFKDKKNLYCIVTIVVICLALYSVYTYIWDPFQIEYESL
FT                   ESQRVSAQKELDKINSKKHRVAELEMQLVQAEKDFQKLKEMFPEEEKVPLRLQDLYSVL
FT                   RSSGVQIQKFNPEGRSEREHYIENRYSIAVNSGYHMLGYLFAEIANFNYPTAITNLKLS
FT                   RYSGIAAEVQKAETHGWTPITMSVNFNLTTYTSKKVGK"
FT   gene            complement(731058..731669)
FT                   /locus_tag="FSU_0661"
FT   CDS_pept        complement(731058..731669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0661"
FT                   /product="fimbrial assembly protein PilN"
FT                   /note="identified by match to protein family HMM PF05137"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26942"
FT                   /db_xref="GOA:C9RKD5"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD5"
FT                   /protein_id="ADL26942.1"
FT                   /translation="MATKKNKGVNKALAITINLLPGEHRKQQKDLTWLTDRRVVWPTVF
FT                   LILAIFVALFTYAYTLQELSSKEAELQSVRAAVERERPLLKKISELEKNQSIINTKINA
FT                   LKSIQISKKRWVVLFENISSVLPPNMWLLSVSQVSEFNLEMKGTTFDFSEVAEYMVKLE
FT                   KQVSVQKVSLVSISTTKVDGDEAYSFTLKVELKKDLGEEG"
FT   gene            complement(731669..732817)
FT                   /locus_tag="FSU_0662"
FT   CDS_pept        complement(731669..732817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0662"
FT                   /product="putative type IV pilus assembly protein PilM"
FT                   /note="identified by similarity to PIR:S77726"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24853"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD6"
FT                   /protein_id="ADL24853.1"
FT                   /translation="MALGLIARIRGERETVGIDVGHYSIKYVKVYHDANGKRIVREVDL
FT                   EPVPAGSIINGLIQRRDTDDLSTEKGAKKEKDGFDKLGEAFSKLLLRHPIDENVDVVAS
FT                   VNCGAGEGGVLVDRLSIKVPKNGNEAAIIVQTAQSRPPFDDQDNVLDYEVVSREGDEVK
FT                   VNVVAAKSSMLDSWAQFFTRKGVRLSALDVDIFGLLNSFVMTASDEERKKTTAIFNIGD
FT                   NKMSVGFIQDGAFHSVRSMNGGSLNVIINKLSSSLDISAEKCHEMFEKNDLKVIDNVAI
FT                   SVLEDAMKVAFEELMSQITFGIRYHSSAEDSRPLERILIGGGGAAVPGLLEYIAEKTGI
FT                   ETATVNPFRSVECDSSVVDKDGMSIALSNIYAPALGLAMRKF"
FT   gene            complement(732909..733985)
FT                   /locus_tag="FSU_0663"
FT   CDS_pept        complement(732909..733985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0663"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26483"
FT                   /db_xref="GOA:C9RKD7"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD7"
FT                   /protein_id="ADL26483.1"
FT                   /translation="MISWFQEVGRDILDVWMFFTDHPSLQILVIVLIFLAVVLIEVQLM
FT                   YKRRETDVMFGTDAFNEKIKAFDFTPKEVETLGDLVRSSKFENMDAVLNSSGLFEAAVS
FT                   EYYRIRNVFSVRDETLEAIAGLRRKMDFTGSNPLSMVCSTRQFNIGDKVDLEFENGQSF
FT                   KRIPIYERTEKVWSVKIDGSPSLAKALVGSHALVRWTRMNDAVYSIHLNVLAATPDKVV
FT                   FTHSASLDKEQLRKWVRQVVDFPVTATFPNGDTHSGVLYDLSAGGILLGLADDVKPDQQ
FT                   FSISFELPTFGVQNVDVKVLNNLGHRNPNFPLYNSISAVFTGAYAWTQERVLQYIFEST
FT                   RKAKSKKTELNGVNSETT"
FT   gene            complement(734000..735253)
FT                   /locus_tag="FSU_0664"
FT   CDS_pept        complement(734000..735253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0664"
FT                   /product="putative dihydroorotase, multifunctional complex
FT                   type"
FT                   /note="identified by similarity to SP:P48795"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26744"
FT                   /db_xref="GOA:D9S7D3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7D3"
FT                   /protein_id="ADL26744.1"
FT                   /translation="MRKPCKGRLVNVVLKNAKFWNGKSFELQNEVRLNACETSETVEFD
FT                   CNGALVMPALFGLGLDFMEPLRDDVYTFADGFDAMRKGGFYGGLYESAANPIDDADKYT
FT                   AMVNRFKSEERGEDAFDIKFLGAYSKGFGTDSLAEMVELAEAGVAGFGDGNGVIPHSRF
FT                   LRLAMEYGKMTGKRFFFQPMDKTLRHSGCVHEGAYSDMLGMKGIPRIAETIAAYTVLET
FT                   ARFLQVPVHFKQVTCGETLELVRNARKNGIDVTCDVNLYHLLLDDSCLETLDSAYHILP
FT                   PIRSAADREALWQGIVDGTVNAISVNHTPVLRQDTVVNFEDSVPGALSLEVALPAIWNK
FT                   LVASVGEARAIELLSTAPARLAGAESAGESVVVLAPEKTHKVLESDFAGHVCNSPLTGK
FT                   VLPSSILATYINGVFTQL"
FT   gene            complement(735246..736187)
FT                   /gene="pyrB"
FT                   /locus_tag="FSU_0665"
FT   CDS_pept        complement(735246..736187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="FSU_0665"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by similarity to SP:Q59711; match to
FT                   protein family HMM PF00185; match to protein family HMM
FT                   PF02729; match to protein family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25889"
FT                   /db_xref="GOA:C9RKD9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKD9"
FT                   /protein_id="ADL25889.1"
FT                   /translation="MSALEIKHLFGLRGVSKHDIRLILDHAKQFREILERPVKKVPSLR
FT                   GMTVVNLFFENSTRTRTSFELAEKRLSADTVNFASSNSSVKKGETLVDTLRNIEAMKID
FT                   IVVVRHKGTGVPKFLADNSNAIIVNAGDGAHEHPTQALLDMLTIEEKLGTLEGKNVTII
FT                   GDIRHSRVARSNLWGMSTMGAHVTLCGPSTLVPRNTDLMNHVTWEPDVKKAVANADAII
FT                   ALRLQKERMDDALLPSMREYRNTFGITEELLECAKDKVIIMHPGPINRGVELDSDIADG
FT                   EHSVILDQVTNGVAVRMAVLFLLAGGRNNENA"
FT   gene            complement(736189..736746)
FT                   /gene="pyrR"
FT                   /locus_tag="FSU_0666"
FT   CDS_pept        complement(736189..736746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="FSU_0666"
FT                   /product="pyrR bifunctional protein"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by similarity to SP:P39765; match to
FT                   protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26528"
FT                   /db_xref="GOA:C9RKE0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE0"
FT                   /protein_id="ADL26528.1"
FT                   /translation="MNDNCKKVSELLTAQTMEFALDEMAAKIAKMHPSADNMIVLGMAS
FT                   RGIPLAKKLTERLSQKFGKPIEMGSLDATYYRDDFHYRKKVATEMRFTEMPASVEGKTV
FT                   ILVDDVLYTGRSALAAMRSILDLGRPAAIRLCVLVDRGHRELPIAPDCAGLTVETARNQ
FT                   EVRVAIEPIDKENSVYLVEVEA"
FT   gene            736992..737543
FT                   /gene="ppiB"
FT                   /locus_tag="FSU_0667"
FT   CDS_pept        736992..737543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="FSU_0667"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P23869; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27410"
FT                   /db_xref="GOA:C9RKE1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE1"
FT                   /protein_id="ADL27410.1"
FT                   /translation="MAFNQLDKPQAGETIAIMKTNHGTMKLRLFEEIVGECATNFIELA
FT                   KQGKYDGAPFHRIINDFMIQGGDFTNRNGTGGHAAKGPGSTIGDKYDPRLTHMRGALSW
FT                   AKTSMPHSIGSQFFIVHGNRVHFLDHAECGPGPADGYSVFGQLYEGFEVLDEIASVATD
FT                   RMDRPFEDVIIESVTIEKAV"
FT   gene            737725..737800
FT                   /locus_tag="FSU_0668"
FT   tRNA            737725..737800
FT                   /locus_tag="FSU_0668"
FT                   /product="tRNA-Ala"
FT   gene            737960..739975
FT                   /locus_tag="FSU_0669"
FT   CDS_pept        737960..739975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0669"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25984"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE2"
FT                   /protein_id="ADL25984.1"
FT                   /translation="MVRLTKISSLLLSAGCALSFAGTGSNTVCDASKMDAFAYEDCIAV
FT                   QRGAKLDNTDFSERAAPPPELISESYVEPFSYDPFNRDAYLTSSFGENRGTRYHAGIDY
FT                   STLMEEGWPIYAPENGYVREIKTSPFGYGKVMFFEGESGKTWVFAHQSSFPQTIENLIS
FT                   QKQYATQNNDISIKPNLRFRKGDTLTFSGSTGIGNPHLHLEVRLNKDIVVSPCQVGVKC
FT                   LDTIAPQIFGVAVWQGNELSLTTDEALRNGCVEIPVKNEFNLSMAIKIADYSRTPKENP
FT                   MAIRRLELWRYDDKIYSKVLDTLNYKKMIDIRNELLWAEEADTAGDWHYINAKLGPIST
FT                   YRLEIEDFSGHITKREFNFHQSCKTNNGKFVLTQNQNTPLYTFLSKSMLDIYRCESGYK
FT                   FTALNKDKQTINGDLCKIFDHSKPLPLGKVVETFPETRYIQYSADASSTGTGRGVNELI
FT                   SIYPYGKYKTNINWYTQVGNVKISQKISGIPVVGDTSQRVLAVTRNQTDSVDFYEFHPK
FT                   GLQFYGKWNVCIENDDNSSPLYWLGETTRRWFYFEKQTGSKNRCASTNELRDLANINDE
FT                   DGFSLGFPYWTETLVAGRPQSALKIPLYSRYAGIPDGNAITVKAGKKWIAAEYDSEPRE
FT                   IILLGEALPDAGETITVEITDDSKRKTKKEITIPGF"
FT   gene            complement(739972..740697)
FT                   /locus_tag="FSU_0670"
FT   CDS_pept        complement(739972..740697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0670"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAN66992.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25581"
FT                   /db_xref="GOA:C9RKE3"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE3"
FT                   /protein_id="ADL25581.1"
FT                   /translation="MCKRFLLCFHDFSVWNHQKVTPILEELKELVGGPFSLLVIPDTEN
FT                   ATDEAVENFRAALAKLKSEGFELALHGFKHKAEFSQGRSYVGLVGMNLTGGEAEFAGLS
FT                   EYESSRLLQAALESWKKLFADENGNADAPIAFVPPTWFSNKFLPGQVRAEKMLYEDRFS
FT                   LTTAEGVRYASPVASFAGIPKSTEKAAFVYAEGILKIPFGVPRIAVHPVDFPRLNDKIR
FT                   DLIRLALGRKRRLTLYRDL"
FT   gene            740751..741593
FT                   /locus_tag="FSU_0671"
FT   CDS_pept        740751..741593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0671"
FT                   /product="putative undecaprenol kinase"
FT                   /note="identified by similarity to SP:P31054; match to
FT                   protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24797"
FT                   /db_xref="GOA:C9RKE4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE4"
FT                   /protein_id="ADL24797.1"
FT                   /translation="MFESIILGLLQGLAEFLPISSSGHLVLGHELLGMNEAGMFFDIML
FT                   HAGTLLSIFVVFHKKITDIIVGCLRRDRDQLREAGYIILASIPTALIGLGFKDALESLF
FT                   ENPRAVCVAELFTGLLLFTSQWGPTGAKHPDNEGVKMNWWRALVTGTVQGIACIPGISR
FT                   SGSTISAMMFMGVNRKYAGEFSFLMSIPAVGGAALLDCIKWIKCQTMTPEKALLNPEKA
FT                   LKCVDAGGFTPELLVGMIVAFIFGIIALKWLMNFVQKGKFQHFAWYVWAVGILGLILL"
FT   gene            complement(741687..741938)
FT                   /locus_tag="FSU_0672"
FT   CDS_pept        complement(741687..741938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0672"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27218"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7E0"
FT                   /protein_id="ADL27218.1"
FT                   /translation="MRLLDKDFAKDVSLTGYMDETLLNEVDGMTDLLYEKQGSYLQGKG
FT                   DGILESAQLMVDSGILTPEKAAELFKVRKEDIRPRNNK"
FT   gene            complement(742538..745198)
FT                   /locus_tag="FSU_0673"
FT   CDS_pept        complement(742538..745198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0673"
FT                   /product="type III restriction-modification system-like
FT                   protein"
FT                   /note="identified by similarity to SP:P40815; match to
FT                   protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25139"
FT                   /db_xref="GOA:C9RKE6"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE6"
FT                   /protein_id="ADL25139.1"
FT                   /translation="MILKSYQKQIIDDLALFLEKLKERRNIAEAFNAFWMLHPRTPITP
FT                   SFGEAVEPYKNNVPNCPHVCIKVPTAGGKTFIAANALSAIFKELDPARPKIAVWLVPSN
FT                   SILEQTIRNFSNPRHPYREQLNTDFANKVNVFDKRMLLQGAGFNTSSVRENMTLCILSF
FT                   DSLRARKKEDRKVNEENGNLQSFAKDVGEEEISVMSVLRAFNPVVIVDESHNAESELSV
FT                   EMLKNLNPSFILDLTATPRKNSNIISFTPAIELKKENMVKLPVIVYNHHKKEEVVSSAL
FT                   ELRSKLESAAVEAEKSGAPYIRPIVLFQAEPKTKDDNATFECVKSMLLEKKIPEEQIKI
FT                   KTADKNELQNVNLLSKDCPVRYIITVNALKEGWDCPFAYILASLADRSSSVDVEQILGR
FT                   VLRLPNVRKNENVMLNMSYVFTASARFSETLDSIVKGLNRAGFSSSDYRQVELEKSVEP
FT                   TEMPMNESIASMSLLNDSNGGSKEGEFDLSSILWNGDDSSLSPASVASVSDHGDAKSEL
FT                   QNQQSSIMAQIEHLAQKENEELEKRIEENRTSPVAPPEMEKQVKTYAIKSIFKDSASQI
FT                   ILPKFFMKGAVEGLHVDLFGIANTPFDKDMLLKNFPLRNADTNINFENVDVEMRSIDLD
FT                   ESQKDFTPTIFSVGKNQQAEITRWLSNIEDVERKRQKCAERLRDWIGNMYPIPDPDIIE
FT                   YIRRVLSNFNDKDLNQMLNSQSTYAERIKQKINALAAEYIETEFDRTLDQDKIILRQHY
FT                   RIADKLTLSSAGKPLPKTLHEKEENVNGFEETVINAVANLENVEFWTRNREKKDFCING
FT                   FINHYPDFIIKTKHGKIVMLETKGDHLDAEKKIKLGNLWASKAGNNYRYCLVYEHRKVD
FT                   HAYTKDEFLATLKEW"
FT   gene            complement(745237..747141)
FT                   /pseudo
FT                   /locus_tag="FSU_0674"
FT                   /note="Possibly an isoschizomer of M.BsupGET109P found in
FT                   Bacillus subtilis.; putative type III
FT                   restriction-modification system, Mod subunit; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01555"
FT   gene            747504..748301
FT                   /locus_tag="FSU_0676"
FT   CDS_pept        747504..748301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0676"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD86410.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27053"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE8"
FT                   /protein_id="ADL27053.1"
FT                   /translation="MKIKVMDAEISVQRIGNEDYISLTDMLKAKDGDFFITDWLRNRNT
FT                   LEYIGIWEKVYNPNFNYGEFAIIKNHSGLNSFKISVKEFQARTNAVSLVAKAGRYGGTY
FT                   AHKDIAFEFAMWISAEFKIYMVKEFQRLKEAEQAQMGWSVRRELSKINYHIHTDAIKQN
FT                   LIPATLTKQQMSMIYANEADVLNVALFGFTAKEWRDTHADLQGNVRDYASVNQLICLSN
FT                   MESLNSVLIKEGLPQPERLQKLNQIAISQMTVLESIGENKLLK"
FT   gene            748468..750354
FT                   /gene="htpG"
FT                   /locus_tag="FSU_0677"
FT   CDS_pept        748468..750354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="FSU_0677"
FT                   /product="heat shock protein HtpG"
FT                   /note="identified by similarity to SP:P10413; match to
FT                   protein family HMM PF00183; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25782"
FT                   /db_xref="GOA:C9RKE9"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKE9"
FT                   /protein_id="ADL25782.1"
FT                   /translation="MATEKMEFQTEVRDMLNLMINSLYSNKEIFLRELVSNAADALDKR
FT                   RFLSLSNSSLLPVGTQLRIDISVNKEGKRLIVEDNGIGMNKEDLINCLGTIARSGTKNF
FT                   IKNLKDADKSSVDLIGQFGVGFYSVFMVAKKVEVLTLKAGETQGYLWSSEGTGDFEISE
FT                   APLDKVGTKITLYLKDDEDADDFASEWKIKDIVQKYSGFVSYGIYFHPEATKNDKGELE
FT                   EKPEERLNDKTALWRQSEKEVTEEQYKDFYNVISHEADEPAAWSHSHAEGSQEFWSLVY
FT                   IPSKAPFNIWHNDALHGLKLYVKKVFIMDDCKDLLPPWLRFVRGVVDSEDLPLNVSREI
FT                   LQNNKIITNIRKHVIKKVLDALQNMADKDVAKYNAWWRELGMVLKEGFYMNWEHLDELK
FT                   KLLRFESTKTEGDALVSLDEYVKRMPEGQKEIYYLVGDKNAIKSNPMLEAFKAKGYEVL
FT                   LMSDGIDEFMMSSLTEFGDKKFHDISRGDVDFEKTEEEKKAEEENKGIFKGLCENLQKV
FT                   LDENIKEVRVSSRLKDSPCCLVTSEDAMSAQMERMMKAMGQKNLPKSKRILEINPTHPI
FT                   CEMLKKKAEANEDLGDWPKALYGQALLAEGSPLPNPAEYVAAITKLLTASVK"
FT   gene            complement(750428..752695)
FT                   /locus_tag="FSU_0678"
FT   CDS_pept        complement(750428..752695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0678"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF09603;
FT                   match to protein family HMM TIGR02145"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADL25958"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF0"
FT                   /protein_id="ADL25958.1"
FT                   /translation="MKMFARFLPFLLVTAMSVFTACGGDSGSNADSEEPVSSSAVKKSS
FT                   SSNANSSSSKKVSSSSAKSSSSAKTSSSASGAKAVYDEKNNTMKDPRDNKTYKTVKIGD
FT                   QVWMAENLNYNSGLSYCFGEEPSYKQNSHPGLCGTYGRLYKWDAATEVCPGGWHLPSKD
FT                   EFETLIQTVGGSGNAGIKLKSVDGWKFEKKETVGTDEYGFTALPGGFRKEDDLSDYVTE
FT                   NIESYDFIGDKTEAYFWSSTEDVESSTRLDGNRILVDHAFCMSLENRYAKADIWGEPMI
FT                   NAMSVRCILDSKTSSNEKSSSSKANSSSSAKSSSSAKSGSSVAVPKGCKTSTKDNCEYG
FT                   ELVDDRDGQTYKTVKIGDQWWMAQNLNYRREAKYKNDYCYCYNNSKDNCDKFGRLYVWT
FT                   AAADACPEGWHLPSTAEWKTLIDSVGGEEVAGITLKTSGWNRGGDATDAFGFSVLPAGY
FT                   RDWLYQDDYYEEGYQALFWSSNEYENSSGCVYFQSVYDGADIRSGNKDDGYSVRCVMDV
FT                   EPKIIEPPVIIVPEAKACKTKTKDECEYGTLTDSRDKQTYKTVKIGSQIWMAENLNFET
FT                   NSSYCFNDSAKYCSKYGRLYTWAAAMDSAGVWSENGKGCGYQKTCTPTYPVQGACPSGW
FT                   HLPTKAEYDTLFAAIGGSETAGEKLKSTSGWSEGGNGTDDYSFSASPAGYRFINGIYPI
FT                   YSEIGYLGVLWTSTEAESDEWCDETCRRVVACNVSLTSLNDDSFVGNVGKDDAYPVRCV
FT                   KN"
FT   gene            complement(752867..754282)
FT                   /locus_tag="FSU_0680"
FT   CDS_pept        complement(752867..754282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0680"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26115"
FT                   /db_xref="GOA:C9RKF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF2"
FT                   /protein_id="ADL26115.1"
FT                   /translation="MLSYDISKAGDDTLYHFLYRSIKDDILSGRLEADAKLPSKRPFAN
FT                   ALGVSVVTVENAYEQLLAEGFIYSLPRKGFFVAAIQSKNPQILPKPVPTKQSRESQRVE
FT                   PPKTPHYIADFVNNQVDASTFPFSTWAKITRKVLCEQQNELLTRSPNSGVIALRKAIAK
FT                   MLLEFRGMRVDPEQIVVGAGTDCLYTWLVQLLGFDKKYGVEDPGYSKISKIYQKLNVVC
FT                   NFIPLDEQGVRIDQLEETCTDVVHLSPSHHFPTGKVMPVSRRYELLSWASKSSNRYIVE
FT                   DEYDSEFRMVGRPIPALQNIDVQDKTIYINSFSKTLASTVRVGYMILPKPLAQKFREEF
FT                   SFYTCTISNLVQYVLAAFISGGHYEKHINRMRNFYRHRRDTLLDIIRRSPLHDRVEIAE
FT                   QDAGLHFILKVKTTLSDEEFCNRALEKGVRIGALSDYYTMATPSQHEFVINYSSVPEKQ
FT                   MKKAISLLEKIVE"
FT   gene            754545..755423
FT                   /locus_tag="FSU_0681"
FT   CDS_pept        754545..755423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0681"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26752"
FT                   /db_xref="GOA:C9RKF3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF3"
FT                   /protein_id="ADL26752.1"
FT                   /translation="MPTENRYELNKNLAQMLKGGVIMDVTTPEQAKIAEAAGAAAVMAL
FT                   ERIPADIRAAGGVSRMSDPKMIKGIQDAVSIPVMAKCRIGHFVEAQLLEAIEIDYIDES
FT                   EVLSPADDVFHINKHEFKVPFVCGARDLGEALRRIEEGASMIRTKGEPGTGDIVQAVRH
FT                   IRLMNQEIARITSMREDELFNRAKELQVSYELVKFVHDHKRLPVVNFAAGGVATPADAA
FT                   LMMQLGAEGVFVGSGIFKSGNPAKRAAAIVQAVTNYKDAKLIAKLSEDLGEAMVGINEN
FT                   EIALLMAERGK"
FT   gene            755424..756047
FT                   /gene="pdxT"
FT                   /locus_tag="FSU_0682"
FT   CDS_pept        755424..756047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="FSU_0682"
FT                   /product="pyridoxal 5'-phosphate synthase, glutaminase
FT                   subunit Pdx2"
FT                   /EC_number="2.6.-.-"
FT                   /note="identified by match to protein family HMM PF01174;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR03800"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADL27284"
FT                   /db_xref="GOA:C9RKF4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF4"
FT                   /protein_id="ADL27284.1"
FT                   /translation="MSENKTNNHIKIGVLAVQGAFAEHRQILEKLGVETFEIRQLRDLE
FT                   QDFDGLILPGGESTVQGKLLHDLRLFEPLRERIESGLPTFGTCAGLILLAEKLSNDGHT
FT                   YFATTPVTVERNAYGRQLGSFYTEENFEGIGKIPMTFIRAPLIQRASQDVQILATVQNQ
FT                   IVAVRYKNQLAISFHPELNNDLRVHQYFVEEIVKANQIQAKKAA"
FT   gene            complement(756052..756444)
FT                   /locus_tag="FSU_0683"
FT   CDS_pept        complement(756052..756444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0683"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAN68587.1"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24956"
FT                   /db_xref="GOA:C9RKF5"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF5"
FT                   /protein_id="ADL24956.1"
FT                   /translation="MANGKVYDDVEVHDMNDMHREKRSVKTGDEQNGAPVVWKALSVII
FT                   AMLAVVYDLSPIDAVPDTIPLFGWLDDVGFTVMAALNAYQQFAKDQNSMVVRLAKYVKW
FT                   MMVAFIVLAGVAVGGLITAIIALVTR"
FT   gene            complement(756693..758177)
FT                   /locus_tag="FSU_0684"
FT   CDS_pept        complement(756693..758177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0684"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE50868.1; match to
FT                   protein family HMM PF08903"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26299"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF6"
FT                   /protein_id="ADL26299.1"
FT                   /translation="MFKVGFDNDAYLKTQSEKIQERISKFGGKLYLEFGGKLFDDHHAS
FT                   RVLPGFAPDSKIRMLEKLKDKAEVIIAINAGDIEKNKVRGDLGITYDQDVLRLIDAFRG
FT                   YGLYVSSVVLTRWQEQPSAVAYQKKLEGLGLKVYRHYPIAGYPSNIPLVVSDDGYGKNE
FT                   FVETSRELVVVTAPGPGSGKMAVCLSQIYHENKRGVKAGYAKFETFPIWNIPLKHPVNL
FT                   AYEAATADLNDVNMIDPFHLEAYGKTTINYNRDVEIFPVLNALFTRILGESPYKSPTDM
FT                   GVNMAGNCIVDDAAVCEAANAEIIRRYYNTLCQVRKGNAEKDQVYKLELVMEQAHISAK
FT                   DRKVAVAAVAKAEETNGPAVAIELNDGTIITGKTSSLLGASSAMLLDSLKHLAGIPDEV
FT                   RLLSPMVIEPIQNLKTKQLGHKNPRLHMDEVLVALSVCALTDYNAKIALEKLPELRHCE
FT                   VHSSVILSQVDVGVFRRLGVNLTSEPNYQTSKLYHG"
FT   gene            758283..759911
FT                   /locus_tag="FSU_0685"
FT   CDS_pept        758283..759911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0685"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF03486"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADL26957"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKF7"
FT                   /protein_id="ADL26957.1"
FT                   /translation="MFTYRYRELAVALEKKGEVRLALAKTLRVNPEEIFNLEVERFSLD
FT                   SRRKGDLHWSYNVVFDLKRKVRASGNNARGLIESKREIRSLDAEPLKDTVTMASHVDVI
FT                   GAGPSGLWAALHLLRKGFSVDIYEQGKQVEERFRDIRKFFVDRKFNAYSNVLFGEGGAG
FT                   AFSDGKLNTRSRNLFSETVLKDMVDFGVDESVVTFAKPHIGTDKLVLMLRQIRAEIVRL
FT                   GGHIHFNTSLEDIEIKEGRICAIKLGDALGVAGSHWQPCEALVLAVGHSARSVYEMLHA
FT                   RGVTLESKAFAMGVRVEHPQSLINMRQLGLNVDTRLTGAAEYFLATPTINKTSSAYSFC
FT                   MCPGGVLVPCASEPGTLATNGMSYSRRNGAFANGAIAVPITAGAEGFDITSSGSLFGGL
FT                   DLQRKIETDAYNVGGKVYAAPAQTIKNFLAHREDKTLPKTTYPCGLVPSNLWDWMDTTI
FT                   CQSLAEGFQNFDRKIPGFINEGLIVAPETRTSSPLRITRNNETLESVNTQGLFVLGEGA
FT                   GYAGGIVTSAADGVRLAHYAKKEKI"
FT   gene            759982..761217
FT                   /locus_tag="FSU_0686"
FT   CDS_pept        759982..761217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0686"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase C"
FT                   /note="identified by similarity to SP:P23851; match to
FT                   protein family HMM PF00849; match to protein family HMM
FT                   PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24710"
FT                   /db_xref="GOA:D9S7F1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9S7F1"
FT                   /protein_id="ADL24710.1"
FT                   /translation="MFPDIIPQSTDWCEPIPHYPIPQKLMITRTIDRNFANMRLDRFLR
FT                   KAFPEESLSVFFAVIRKKKVRVNGVVGKANQMLVEGDVVNIYENFKSVNESDERRETKD
FT                   ERNINGESLPLASAAEAAPATPSSGDTPQRPDAKSATGFAKNKSTWGRHLTGAEKQAHW
FT                   GAHELDLVVQTEDYVIVNKPSGLASQPGSGTRPGESLVEYLWEWGRNEGLDFKPTIAHR
FT                   LDQETSGLIIAALHGDTLRDFTRMIREHVVDKFYFALVKGNLKKDRGTISESLLRTDSA
FT                   KGSKMLVGQDDENAQKAITHYRVKQHYEGYDLVKIKLETGRMHQIRAHFASIGHPLLGD
FT                   TRYGDFALNREVKKLFGLNRLFLHSCRLEFDWQGEHKVFDCPLPKELRDVIKQLKPMRF
FT                   ERPENNFQRSRR"
FT   gene            complement(761260..763671)
FT                   /locus_tag="FSU_0687"
FT   CDS_pept        complement(761260..763671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FSU_0687"
FT                   /product="ATP-dependent DNA helicase, UvrD/REP family"
FT                   /note="identified by similarity to SP:P56255; match to
FT                   protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:FSU_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADL24804"
FT                   /db_xref="GOA:C9RKG0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C9RKG0"
FT                   /protein_id="ADL24804.1"
FT                   /translation="MEKSPKSENIENSLEWERSRLDKEQLEAVETTEGYVRVVAGAGSG
FT                   KTRTLTHRYLYLVKEMGISPANILCVTFTNKA