(data stored in SCRATCH zone)

EMBL: CP002159

ID   CP002159; SV 1; circular; genomic DNA; STD; PRO; 3162471 BP.
XX
AC   CP002159; ACSD01000000-ACSD01000064;
XX
PR   Project:PRJNA32827;
XX
DT   14-AUG-2010 (Rel. 105, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Gallionella capsiferriformans ES-2 chromosome, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Gallionella capsiferriformans ES-2
OC   Bacteria; Proteobacteria; Betaproteobacteria; Nitrosomonadales;
OC   Gallionellaceae; Gallionella.
XX
RN   [1]
RP   1-3162471
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Davenport K.W., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N.,
RA   Mikhailova N., Shelobolina E.S., Picardal F., Roden E., Emerson D.,
RA   Woyke T.;
RT   "Complete sequence of Gallionella capsiferriformans ES-2";
RL   Unpublished.
XX
RN   [2]
RP   1-3162471
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Davenport K.W., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N.,
RA   Mikhailova N., Shelobolina E.S., Picardal F., Roden E., Emerson D.,
RA   Woyke T.;
RT   ;
RL   Submitted (04-AUG-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2ef08a3f6a88cc58d2bcfc079372e80a.
DR   BioSample; SAMN00002572.
DR   EnsemblGenomes-Gn; EBG00001044395.
DR   EnsemblGenomes-Gn; EBG00001044397.
DR   EnsemblGenomes-Gn; EBG00001044399.
DR   EnsemblGenomes-Gn; EBG00001044401.
DR   EnsemblGenomes-Gn; EBG00001044402.
DR   EnsemblGenomes-Gn; EBG00001044405.
DR   EnsemblGenomes-Gn; EBG00001044408.
DR   EnsemblGenomes-Gn; EBG00001044411.
DR   EnsemblGenomes-Gn; EBG00001044415.
DR   EnsemblGenomes-Gn; EBG00001044418.
DR   EnsemblGenomes-Gn; EBG00001044421.
DR   EnsemblGenomes-Gn; EBG00001044423.
DR   EnsemblGenomes-Gn; EBG00001044425.
DR   EnsemblGenomes-Gn; EBG00001044427.
DR   EnsemblGenomes-Gn; EBG00001044429.
DR   EnsemblGenomes-Gn; EBG00001044431.
DR   EnsemblGenomes-Gn; EBG00001044434.
DR   EnsemblGenomes-Gn; EBG00001044437.
DR   EnsemblGenomes-Gn; EBG00001044439.
DR   EnsemblGenomes-Gn; EBG00001044442.
DR   EnsemblGenomes-Gn; EBG00001044444.
DR   EnsemblGenomes-Gn; EBG00001044447.
DR   EnsemblGenomes-Gn; EBG00001044449.
DR   EnsemblGenomes-Gn; EBG00001044451.
DR   EnsemblGenomes-Gn; EBG00001044453.
DR   EnsemblGenomes-Gn; EBG00001044455.
DR   EnsemblGenomes-Gn; EBG00001044457.
DR   EnsemblGenomes-Gn; EBG00001044460.
DR   EnsemblGenomes-Gn; EBG00001044464.
DR   EnsemblGenomes-Gn; EBG00001044467.
DR   EnsemblGenomes-Gn; EBG00001044469.
DR   EnsemblGenomes-Gn; EBG00001044471.
DR   EnsemblGenomes-Gn; EBG00001044473.
DR   EnsemblGenomes-Gn; EBG00001044475.
DR   EnsemblGenomes-Gn; EBG00001044477.
DR   EnsemblGenomes-Gn; EBG00001044478.
DR   EnsemblGenomes-Gn; EBG00001044479.
DR   EnsemblGenomes-Gn; EBG00001044480.
DR   EnsemblGenomes-Gn; EBG00001044482.
DR   EnsemblGenomes-Gn; EBG00001044483.
DR   EnsemblGenomes-Gn; EBG00001044484.
DR   EnsemblGenomes-Gn; EBG00001044485.
DR   EnsemblGenomes-Gn; EBG00001044487.
DR   EnsemblGenomes-Gn; EBG00001044489.
DR   EnsemblGenomes-Gn; EBG00001044491.
DR   EnsemblGenomes-Gn; EBG00001044494.
DR   EnsemblGenomes-Gn; EBG00001044496.
DR   EnsemblGenomes-Gn; EBG00001044498.
DR   EnsemblGenomes-Gn; EBG00001044500.
DR   EnsemblGenomes-Gn; EBG00001044502.
DR   EnsemblGenomes-Gn; EBG00001044504.
DR   EnsemblGenomes-Gn; EBG00001044506.
DR   EnsemblGenomes-Gn; EBG00001044508.
DR   EnsemblGenomes-Gn; EBG00001044510.
DR   EnsemblGenomes-Gn; EBG00001044513.
DR   EnsemblGenomes-Gn; EBG00001044516.
DR   EnsemblGenomes-Gn; EBG00001044518.
DR   EnsemblGenomes-Gn; EBG00001044520.
DR   EnsemblGenomes-Gn; EBG00001044522.
DR   EnsemblGenomes-Gn; EBG00001044524.
DR   EnsemblGenomes-Gn; EBG00001044526.
DR   EnsemblGenomes-Gn; EBG00001044529.
DR   EnsemblGenomes-Gn; EBG00001044531.
DR   EnsemblGenomes-Gn; EBG00001044534.
DR   EnsemblGenomes-Gn; EBG00001044537.
DR   EnsemblGenomes-Gn; EBG00001044539.
DR   EnsemblGenomes-Gn; EBG00001044541.
DR   EnsemblGenomes-Gn; EBG00001044543.
DR   EnsemblGenomes-Gn; EBG00001044545.
DR   EnsemblGenomes-Gn; EBG00001044547.
DR   EnsemblGenomes-Gn; Galf_R0001.
DR   EnsemblGenomes-Gn; Galf_R0002.
DR   EnsemblGenomes-Gn; Galf_R0003.
DR   EnsemblGenomes-Gn; Galf_R0004.
DR   EnsemblGenomes-Gn; Galf_R0005.
DR   EnsemblGenomes-Gn; Galf_R0006.
DR   EnsemblGenomes-Gn; Galf_R0007.
DR   EnsemblGenomes-Gn; Galf_R0008.
DR   EnsemblGenomes-Gn; Galf_R0009.
DR   EnsemblGenomes-Gn; Galf_R0010.
DR   EnsemblGenomes-Gn; Galf_R0011.
DR   EnsemblGenomes-Gn; Galf_R0012.
DR   EnsemblGenomes-Gn; Galf_R0013.
DR   EnsemblGenomes-Gn; Galf_R0014.
DR   EnsemblGenomes-Gn; Galf_R0015.
DR   EnsemblGenomes-Gn; Galf_R0016.
DR   EnsemblGenomes-Gn; Galf_R0017.
DR   EnsemblGenomes-Gn; Galf_R0018.
DR   EnsemblGenomes-Gn; Galf_R0019.
DR   EnsemblGenomes-Gn; Galf_R0020.
DR   EnsemblGenomes-Gn; Galf_R0021.
DR   EnsemblGenomes-Gn; Galf_R0022.
DR   EnsemblGenomes-Gn; Galf_R0023.
DR   EnsemblGenomes-Gn; Galf_R0024.
DR   EnsemblGenomes-Gn; Galf_R0025.
DR   EnsemblGenomes-Gn; Galf_R0026.
DR   EnsemblGenomes-Gn; Galf_R0027.
DR   EnsemblGenomes-Gn; Galf_R0028.
DR   EnsemblGenomes-Gn; Galf_R0029.
DR   EnsemblGenomes-Gn; Galf_R0030.
DR   EnsemblGenomes-Gn; Galf_R0031.
DR   EnsemblGenomes-Gn; Galf_R0032.
DR   EnsemblGenomes-Gn; Galf_R0033.
DR   EnsemblGenomes-Gn; Galf_R0034.
DR   EnsemblGenomes-Gn; Galf_R0035.
DR   EnsemblGenomes-Gn; Galf_R0036.
DR   EnsemblGenomes-Gn; Galf_R0037.
DR   EnsemblGenomes-Gn; Galf_R0038.
DR   EnsemblGenomes-Gn; Galf_R0039.
DR   EnsemblGenomes-Gn; Galf_R0040.
DR   EnsemblGenomes-Gn; Galf_R0041.
DR   EnsemblGenomes-Gn; Galf_R0042.
DR   EnsemblGenomes-Gn; Galf_R0043.
DR   EnsemblGenomes-Gn; Galf_R0044.
DR   EnsemblGenomes-Gn; Galf_R0045.
DR   EnsemblGenomes-Gn; Galf_R0046.
DR   EnsemblGenomes-Gn; Galf_R0047.
DR   EnsemblGenomes-Gn; Galf_R0048.
DR   EnsemblGenomes-Gn; Galf_R0049.
DR   EnsemblGenomes-Gn; Galf_R0050.
DR   EnsemblGenomes-Gn; Galf_R0051.
DR   EnsemblGenomes-Gn; Galf_R0052.
DR   EnsemblGenomes-Gn; Galf_R0053.
DR   EnsemblGenomes-Gn; Galf_R0054.
DR   EnsemblGenomes-Gn; Galf_R0055.
DR   EnsemblGenomes-Gn; Galf_R0056.
DR   EnsemblGenomes-Gn; Galf_R0057.
DR   EnsemblGenomes-Gn; Galf_R0058.
DR   EnsemblGenomes-Gn; Galf_R0059.
DR   EnsemblGenomes-Gn; Galf_R0060.
DR   EnsemblGenomes-Gn; Galf_R0061.
DR   EnsemblGenomes-Gn; Galf_R0062.
DR   EnsemblGenomes-Gn; Galf_R0063.
DR   EnsemblGenomes-Gn; Galf_R0064.
DR   EnsemblGenomes-Tr; EBT00001647262.
DR   EnsemblGenomes-Tr; EBT00001647263.
DR   EnsemblGenomes-Tr; EBT00001647264.
DR   EnsemblGenomes-Tr; EBT00001647265.
DR   EnsemblGenomes-Tr; EBT00001647266.
DR   EnsemblGenomes-Tr; EBT00001647267.
DR   EnsemblGenomes-Tr; EBT00001647268.
DR   EnsemblGenomes-Tr; EBT00001647269.
DR   EnsemblGenomes-Tr; EBT00001647270.
DR   EnsemblGenomes-Tr; EBT00001647271.
DR   EnsemblGenomes-Tr; EBT00001647272.
DR   EnsemblGenomes-Tr; EBT00001647273.
DR   EnsemblGenomes-Tr; EBT00001647274.
DR   EnsemblGenomes-Tr; EBT00001647275.
DR   EnsemblGenomes-Tr; EBT00001647276.
DR   EnsemblGenomes-Tr; EBT00001647277.
DR   EnsemblGenomes-Tr; EBT00001647278.
DR   EnsemblGenomes-Tr; EBT00001647279.
DR   EnsemblGenomes-Tr; EBT00001647280.
DR   EnsemblGenomes-Tr; EBT00001647281.
DR   EnsemblGenomes-Tr; EBT00001647282.
DR   EnsemblGenomes-Tr; EBT00001647283.
DR   EnsemblGenomes-Tr; EBT00001647284.
DR   EnsemblGenomes-Tr; EBT00001647285.
DR   EnsemblGenomes-Tr; EBT00001647286.
DR   EnsemblGenomes-Tr; EBT00001647287.
DR   EnsemblGenomes-Tr; EBT00001647288.
DR   EnsemblGenomes-Tr; EBT00001647289.
DR   EnsemblGenomes-Tr; EBT00001647290.
DR   EnsemblGenomes-Tr; EBT00001647291.
DR   EnsemblGenomes-Tr; EBT00001647292.
DR   EnsemblGenomes-Tr; EBT00001647293.
DR   EnsemblGenomes-Tr; EBT00001647294.
DR   EnsemblGenomes-Tr; EBT00001647295.
DR   EnsemblGenomes-Tr; EBT00001647296.
DR   EnsemblGenomes-Tr; EBT00001647297.
DR   EnsemblGenomes-Tr; EBT00001647298.
DR   EnsemblGenomes-Tr; EBT00001647299.
DR   EnsemblGenomes-Tr; EBT00001647300.
DR   EnsemblGenomes-Tr; EBT00001647301.
DR   EnsemblGenomes-Tr; EBT00001647302.
DR   EnsemblGenomes-Tr; EBT00001647303.
DR   EnsemblGenomes-Tr; EBT00001647304.
DR   EnsemblGenomes-Tr; EBT00001647305.
DR   EnsemblGenomes-Tr; EBT00001647306.
DR   EnsemblGenomes-Tr; EBT00001647307.
DR   EnsemblGenomes-Tr; EBT00001647308.
DR   EnsemblGenomes-Tr; EBT00001647309.
DR   EnsemblGenomes-Tr; EBT00001647310.
DR   EnsemblGenomes-Tr; EBT00001647311.
DR   EnsemblGenomes-Tr; EBT00001647312.
DR   EnsemblGenomes-Tr; EBT00001647313.
DR   EnsemblGenomes-Tr; EBT00001647314.
DR   EnsemblGenomes-Tr; EBT00001647315.
DR   EnsemblGenomes-Tr; EBT00001647316.
DR   EnsemblGenomes-Tr; EBT00001647317.
DR   EnsemblGenomes-Tr; EBT00001647318.
DR   EnsemblGenomes-Tr; EBT00001647319.
DR   EnsemblGenomes-Tr; EBT00001647320.
DR   EnsemblGenomes-Tr; EBT00001647321.
DR   EnsemblGenomes-Tr; EBT00001647322.
DR   EnsemblGenomes-Tr; EBT00001647323.
DR   EnsemblGenomes-Tr; EBT00001647324.
DR   EnsemblGenomes-Tr; EBT00001647325.
DR   EnsemblGenomes-Tr; EBT00001647326.
DR   EnsemblGenomes-Tr; EBT00001647327.
DR   EnsemblGenomes-Tr; EBT00001647328.
DR   EnsemblGenomes-Tr; EBT00001647329.
DR   EnsemblGenomes-Tr; EBT00001647330.
DR   EnsemblGenomes-Tr; EBT00001647331.
DR   EnsemblGenomes-Tr; Galf_R0001-1.
DR   EnsemblGenomes-Tr; Galf_R0002-1.
DR   EnsemblGenomes-Tr; Galf_R0003-1.
DR   EnsemblGenomes-Tr; Galf_R0004-1.
DR   EnsemblGenomes-Tr; Galf_R0005-1.
DR   EnsemblGenomes-Tr; Galf_R0006-1.
DR   EnsemblGenomes-Tr; Galf_R0007-1.
DR   EnsemblGenomes-Tr; Galf_R0008-1.
DR   EnsemblGenomes-Tr; Galf_R0009-1.
DR   EnsemblGenomes-Tr; Galf_R0010-1.
DR   EnsemblGenomes-Tr; Galf_R0011-1.
DR   EnsemblGenomes-Tr; Galf_R0012-1.
DR   EnsemblGenomes-Tr; Galf_R0013-1.
DR   EnsemblGenomes-Tr; Galf_R0014-1.
DR   EnsemblGenomes-Tr; Galf_R0015-1.
DR   EnsemblGenomes-Tr; Galf_R0016-1.
DR   EnsemblGenomes-Tr; Galf_R0017-1.
DR   EnsemblGenomes-Tr; Galf_R0018-1.
DR   EnsemblGenomes-Tr; Galf_R0019-1.
DR   EnsemblGenomes-Tr; Galf_R0020-1.
DR   EnsemblGenomes-Tr; Galf_R0021-1.
DR   EnsemblGenomes-Tr; Galf_R0022-1.
DR   EnsemblGenomes-Tr; Galf_R0023-1.
DR   EnsemblGenomes-Tr; Galf_R0024-1.
DR   EnsemblGenomes-Tr; Galf_R0025-1.
DR   EnsemblGenomes-Tr; Galf_R0026-1.
DR   EnsemblGenomes-Tr; Galf_R0027-1.
DR   EnsemblGenomes-Tr; Galf_R0028-1.
DR   EnsemblGenomes-Tr; Galf_R0029-1.
DR   EnsemblGenomes-Tr; Galf_R0030-1.
DR   EnsemblGenomes-Tr; Galf_R0031-1.
DR   EnsemblGenomes-Tr; Galf_R0032-1.
DR   EnsemblGenomes-Tr; Galf_R0033-1.
DR   EnsemblGenomes-Tr; Galf_R0034-1.
DR   EnsemblGenomes-Tr; Galf_R0035-1.
DR   EnsemblGenomes-Tr; Galf_R0036-1.
DR   EnsemblGenomes-Tr; Galf_R0037-1.
DR   EnsemblGenomes-Tr; Galf_R0038-1.
DR   EnsemblGenomes-Tr; Galf_R0039-1.
DR   EnsemblGenomes-Tr; Galf_R0040-1.
DR   EnsemblGenomes-Tr; Galf_R0041-1.
DR   EnsemblGenomes-Tr; Galf_R0042-1.
DR   EnsemblGenomes-Tr; Galf_R0043-1.
DR   EnsemblGenomes-Tr; Galf_R0044-1.
DR   EnsemblGenomes-Tr; Galf_R0045-1.
DR   EnsemblGenomes-Tr; Galf_R0046-1.
DR   EnsemblGenomes-Tr; Galf_R0047-1.
DR   EnsemblGenomes-Tr; Galf_R0048-1.
DR   EnsemblGenomes-Tr; Galf_R0049-1.
DR   EnsemblGenomes-Tr; Galf_R0050-1.
DR   EnsemblGenomes-Tr; Galf_R0051-1.
DR   EnsemblGenomes-Tr; Galf_R0052-1.
DR   EnsemblGenomes-Tr; Galf_R0053-1.
DR   EnsemblGenomes-Tr; Galf_R0054-1.
DR   EnsemblGenomes-Tr; Galf_R0055-1.
DR   EnsemblGenomes-Tr; Galf_R0056-1.
DR   EnsemblGenomes-Tr; Galf_R0057-1.
DR   EnsemblGenomes-Tr; Galf_R0058-1.
DR   EnsemblGenomes-Tr; Galf_R0059-1.
DR   EnsemblGenomes-Tr; Galf_R0060-1.
DR   EnsemblGenomes-Tr; Galf_R0061-1.
DR   EnsemblGenomes-Tr; Galf_R0062-1.
DR   EnsemblGenomes-Tr; Galf_R0063-1.
DR   EnsemblGenomes-Tr; Galf_R0064-1.
DR   EuropePMC; PMC3753938; 23811518.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP002159.
DR   SILVA-SSU; CP002159.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024181
CC   Source DNA and organism available from David Emerson
CC   (demerson@bigelow.org)
CC   Contacts: David Emerson (demerson@bigelow.org)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Gallionella capsiferriformans ES-2
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: USA
CC   environment         :: Fresh water
CC   num_replicons       :: 1
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemolithoautotroph
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02007
CC   Greengenes ID       :: 198458
CC   Isolation Site      :: iron contaminated groundwater in Michigan
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3162471
FT                   /organism="Gallionella capsiferriformans ES-2"
FT                   /strain="ES-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395494"
FT                   /type_material="type strain of Gallionella
FT                   capsiferriformans"
FT   gene            90..1445
FT                   /locus_tag="Galf_0001"
FT   CDS_pept        90..1445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   slt:Slit_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54046"
FT                   /db_xref="GOA:D9SHL3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL3"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADL54046.1"
FT                   /translation="MQEKAFWDACLSSFEKSLPPQQFNSWIKPLKLTCEDSCFILTAPS
FT                   SFALKILQDRFFPEINRQAKLTYPVVPQFEFRVVESTTANSMPIAPPPEKKITTSDLKP
FT                   KIETSFRGYGKLNQSLTFDNFVIGKANQLAFAAATQVAELPGVSYNPLFIYGGVGLGKT
FT                   HLTQAIGNQILINRPQAKVCYMHAERYVADVVRAYQTNKFEEFKQYYHSLDVLLIDDIQ
FT                   FFAGKNKTQEEFFYAFNTLVDSHKQVILTSDTFPKELTGLESRLVSRFGWGLTIAIEPP
FT                   ELEMRVAILLKKAAISGYVLDDAVAFFIAKHVNSNVRELEGALKRVEAYTKFHKRIISV
FT                   DTAKEALKDILVAQSRQISIDNIQKTVADYFRIKIIDMLSKKRTRNLTRPRQIAMSLAR
FT                   ELTTMSLPEIGNAFGGKDHSTVIHACQTIATLRAGDTTIDADYKILLQTLTG"
FT   gene            1947..3053
FT                   /locus_tag="Galf_0002"
FT   CDS_pept        1947..3053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: slt:Slit_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54047"
FT                   /db_xref="GOA:D9SHL4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL4"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADL54047.1"
FT                   /translation="MFIEKIEKETLLKPLQVVIGIVERKQTMPILSNVLIEKELGKIRF
FT                   TATDLEIQITTTIETGADHESNAAITVGGKKLQEILRILPDQSKVSIEVKENKAQIKSN
FT                   KSKFNLQSLPAQDFPTLSNQLADARKISLSQRALKALFSSVQFAMAQQDVRYYLNGVLF
FT                   VIEDNIFRAVATDGHRLAYNAIAIESSSEKIEIIIPRKAIVELSKLLSDDDQLIELEFS
FT                   SQQLKATFSGIELTTKLIEGKFPDYQRVIPNYTNHLSINRTLVQQALQRAAILSNEKFR
FT                   GVRFVLTEKNLCIISSNSEQEEAQVEIETDYHGEAIDIGFNVNYLMDGLSSVHSEMAIF
FT                   SFGNPNSSILITSPDDLEFRYVVMPMRI"
FT   gene            3126..5504
FT                   /locus_tag="Galf_0003"
FT   CDS_pept        3126..5504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: slt:Slit_0003 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54048"
FT                   /db_xref="GOA:D9SHL5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL5"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADL54048.1"
FT                   /translation="MSEYDSTSIKVLKGLEAVRKRPGMYIGDTNDGTGLHHMVFEAVDN
FT                   AVDEALAGHCNEINVIIHADNSISVSDNGRGIPTDIHKEEGRSAAEVIMTILHAGGKFD
FT                   SNSYKVSGGLHGVGVSVVNALSEWLKLTIYREGKEHFMEFRHGDPVAPLKVIGESKKKG
FT                   TVVHFLAAKETFGLIEFHFDILAKRLRELSFLNNGVKIALIDHRNGKEENFSFTGGIKG
FT                   FVDYMNRNKTALHPTVFHAIGEKDGMTAEIAMQWNDTYQESVQCFTNNIPQRDGGTHLT
FT                   AMRAAMTRTLNNYIEAEQLAKKAKVEPTGDDMREGLTAVLSVKLPDPKFSSQTKDKLVS
FT                   SEVRPVIEELIGQQMSAFLLERPNDAKIIVGKIIEAARAREAARKARDLTRRKGVLDGM
FT                   GLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEKARFEK
FT                   LISSQEIATLITVLGTGIGKDEYNADKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMP
FT                   ELVERGHIYIAQPPLYKIKQGREERYLKDDLEMKSYLLGNALKDASLYSALDAAPIQGE
FT                   TLEQIAKQYFLAEAVIDRLTHFIAPEASHALLILPTLSLDDATEAQKSAQLLESASGGV
FT                   IKVTVEDDEQGELRLRLEKLYYGNYSISFLDKDFLQGGDYKQIRQTADALDGLMSPTAY
FT                   VTRGEQKRGVASFKQAIEWLLEEAKRGLSIQRYKGLGEMNPEQLWETTMFVKNRILLKV
FT                   RIEDTIAADEVFTTLMGDLVEPRRAFIEKNALGAKNLDV"
FT   gene            complement(5699..6691)
FT                   /locus_tag="Galf_0004"
FT   CDS_pept        complement(5699..6691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0004"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54049"
FT                   /db_xref="GOA:D9SHL6"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL6"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ADL54049.1"
FT                   /translation="MSLLTHPNDALFNGEKSFPVIPSCEHFAGSEKLILKAMSLQDTLG
FT                   PIFDITCDCEDGAAAGQEREHAEMIVRVLNSPANKHKMAGARIHDYTHAAWRQDVDILV
FT                   GGAGQLLTYITIPKCTKAAQAAEMIGYIQSVASACGIGLEIPIHILIETHGALHDAYEL
FT                   ASLPWLQVLDFGLMDFVSGHYGAIPASAMRSPGQFEHRLLARAKAEVVAAALAHGVVPA
FT                   HNVTLDLKNTETTFSDASRARNEFGFMRMWSIYPTQIQAIVDAMKPNYDEVTISANILL
FT                   AAQAAEWGPIQYDGELHDRATYRYFWEVLQKARVTGVTIPESAVNAFFS"
FT   gene            complement(6703..7785)
FT                   /locus_tag="Galf_0005"
FT   CDS_pept        complement(6703..7785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0005"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG: MaoC
FT                   domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54050"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL7"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADL54050.1"
FT                   /translation="MHKSTANTEPGRGNFFEDFHFGQVLHHATPRTITDGDCSLYIALT
FT                   GSRQPMHCAQPVAHALGYRDRTVDDLLAFHIAFGKTVPDISVNAVANLGYANVKFVRPV
FT                   YPGDTLSTTSTVIGLKQNSNGANGVVYVHSVSHNQNRQPILEWVRWVMVHKQNTSLPAP
FT                   ATVIPELDAYVAPDTLSIPDFADFHRFETKVTGSQKLWNDYQRSERINHPAGMTVDDSD
FT                   HTMATRLYQNNARLHFDALMMKDTQFGRRLMYGGHVISLCRALSYDGLENAIGIAAINA
FT                   GTHSNPCFGGDTIYTWTEVLDCWELPGRQDLGALRLRMVGLKNLPARELQNTHTEQNGR
FT                   QVYHPNVVLDLDYTVLMPRR"
FT   gene            complement(7778..8659)
FT                   /locus_tag="Galf_0006"
FT   CDS_pept        complement(7778..8659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0006"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="manually curated; KEGG: mmb:Mmol_0753 citrate
FT                   (pro-3S)-lyase; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54051"
FT                   /db_xref="GOA:D9SHL8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL8"
FT                   /inference="protein motif:PRIAM:4.1.3.34"
FT                   /protein_id="ADL54051.1"
FT                   /translation="MNNYFRPRRSMLYVPGCNTRYLEKARSLPADSVILDLGDPILISA
FT                   KETSRHNVVDAVKQGGYRASEVVIRVNDLESPWGYDDIKAVANIGADAILFSHIESRAG
FT                   LLRALEALDQAGGHNMPVMVMIESPLAVLHAEAIASASDRIACLVMATSDLTSQLHAHT
FT                   TRDRIPLLTSLSMVILAARAYNRAVVDGINSHFKDIESFEYACRLGRDMGFDGKSMIHP
FT                   LQLTYANDAFTPKPSEVKTAREIISALSEANAAGRGTVVVNDRLVERHNIEAAERLLEL
FT                   SEMIAKLEEDHA"
FT   gene            8840..9574
FT                   /locus_tag="Galf_0007"
FT   CDS_pept        8840..9574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0007"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: mmb:Mmol_0754 transcriptional regulator, GntR
FT                   family; PFAM: UbiC transcription regulator-associated
FT                   domain-containing protein; regulatory protein GntR HTH;
FT                   SMART: UbiC transcription regulator-associated
FT                   domain-containing protein; regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54052"
FT                   /db_xref="GOA:D9SHL9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHL9"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADL54052.1"
FT                   /translation="MKSSPTHPSFQPLYRQIKALLTQSLITGEWVPGAAIPSEMDLAAR
FT                   FGVSQGTVRKAIDELAAENIVVRRQGKGTFVATHTEEVVKLRFLRLVAADGSKELLDNR
FT                   LLSCEKSKATAAIARALNIRTGSSVIEIRRLLLFSGKPLILDRIILPAALFKGVTTERI
FT                   EALKGSMYRLYETQLGIRMVRAEEKLTAIGADGEVATALGLLQGTPLLSIERVSYTYGD
FT                   KPMEWRLGLCLTDDHHYLNQFE"
FT   gene            9630..10760
FT                   /locus_tag="Galf_0008"
FT   CDS_pept        9630..10760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0008"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: mmb:Mmol_0762
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54053"
FT                   /db_xref="GOA:D9SHM0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM0"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ADL54053.1"
FT                   /translation="MNTTGSQGGAEEAGANMLGGYWPGIQLYYPPVKYSPAQGIYEDLE
FT                   AAGQRMKKYAHQTHAHTLIFDLEDGCRQKEMSRTLLRLELPQFKRRNEVAIAIRVNPFR
FT                   TEEYEHDMALVRDLAEHIDVVMLAKAGEAYGAAEVRDLSSFLAGLNHPISIQPIIEHPK
FT                   SLKIAPDLMQYNTVKHVVFGIHDFSKAMGIQITPENWTEELKYFLNQIMFEARIAGKGV
FT                   IGGVETLIGSSSMPEKYIEPHDVRRWLDLHGENESRIVYKHACQEAAMGLTGKQVIHPG
FT                   HIHLCKVAYTPSPTDIAQKVRILKAAIEADALLGGAIRIDGEMLDPPMFGKALQTLLRA
FT                   HSLRALSAKDSDFAMTVLHLMPTQVVRENWPYGVIL"
FT   gene            10769..12400
FT                   /locus_tag="Galf_0009"
FT   CDS_pept        10769..12400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0009"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54054"
FT                   /db_xref="GOA:D9SHM1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM1"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADL54054.1"
FT                   /translation="MSNFAPFKPWVWQVPENFNIGVACTDAHLGTPAAGNIAMIVEDDK
FT                   LGTSQITFAELAERTSRFAQLLRNLDVGDGECILIRLPNCLDYPTAFLGAMKRGTIAVP
FT                   TSTLLTSEEVSYLAQDSGASVLVTDKAAWATLKDSLHSAPNLRHVLLSGPGEALEVAGL
FT                   DILDLDSALSAINSFEAPYPSKATDPAYLVYTSGTTGYPKGVLHSHRSMIGRTPASTYW
FT                   FDFSDVNDRIMHSGKFNWTYVLGSGLMDPLYLGKTVIVHEGRNDANTWPRLIKKHSATI
FT                   FVGVPTIYRQIVQKSDFTKTDVPSLRYCMSAGEHLSDEVLSQWRERFGVDIYEAVGMSE
FT                   FSYYLCQTKSRPIRPGSAGFAQPGHNIQLLDPETLQPVASGEEGMICVPDNDPGLFLRY
FT                   WNMVEETAKLVHDGWFFTGDYARYDADGYIWFLGRKDDIIKSFGYRVSPYEIERVLKSH
FT                   PAVADCASVGEEIEKDKVLVVAYLILHPGSTTTADELLAFGREHLAAYKAPKTIYIATD
FT                   FPRTKNGKILRREVNPSIAIAKSISR"
FT   gene            12972..13580
FT                   /locus_tag="Galf_0010"
FT   CDS_pept        12972..13580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0010"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   slt:Slit_1995 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54055"
FT                   /db_xref="GOA:D9SHM2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM2"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ADL54055.1"
FT                   /translation="MKLLGTHTSPYVRKARLVLLEKNIPHEYVIDPPSEPGSLVLQVNP
FT                   LGRIPALILDDGFCVFDSSVIADYADTLNDAPVLIPRTDPLARLRVKRWEALADGIMDS
FT                   AIVVRNESLRAEDKQSQAVLDMHNLAVTHALDYAAQLLGEREWCEGDAITLADLALVSA
FT                   LLYLDLRQAARDWRSAHANLAVWFSRISARPSVIVSNRL"
FT   gene            complement(13651..15756)
FT                   /locus_tag="Galf_0011"
FT   CDS_pept        complement(13651..15756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0011"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG:
FT                   carboxyl-terminal protease; PFAM: peptidase S41; Peptidase
FT                   S41A, C-terminal peptidase-1-like; PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54056"
FT                   /db_xref="GOA:D9SHM3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM3"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADL54056.1"
FT                   /translation="MKTKLLWIALALFNSTLAAVELAPLPLQPQTALLSAQVLNRYHYK
FT                   HVPLDEATSAKVFDNYLKGLDSERFFFLQADINRFEAERPRLVDAVLKENLSTPFAIYN
FT                   LYQQRVTERIVYARSLLSQGFDFDTLDSYQYLRKHAAWPKSEEEINELWRRRVKNDWLR
FT                   LKLTGKDDKDISNTLNKRYDNTLNSLAKVKSDDVFQRFMSAYAMTIDPHTDYFGTRASE
FT                   DFDISMRLSLVGIGAVLQDKDDFTTIRELVAGGPAALSGRLKVGDRIVGVGQGNSPITE
FT                   VQGQRLDDTVALIRGAEDTVVRLDILPAEATPDGKHKLITLIRKKITLDKQAAKKSILD
FT                   VTDGGATRHIGVITLPGFYLDFAARQRGDKNFKSASRDVSQLLKEFKKNKVDSVLIDLR
FT                   NNGGGSLDEAIELTGLFIDKGPVVQQRDSKGKISVSSDLNSGMAWQGPLGVLINRGSAS
FT                   ASEIFAAAIQDYGRGIVIGETSFGKGTVQSVVDLDSLFKSPQPKFGELKMTIAQFFRIN
FT                   GGTTQLRGVIPDITLPSMIDEEEFGESSYDNALPWSQIKAADYTKAGDLAPVVPLLIRK
FT                   HDQRVATDQEFKYLQEDINEFNTRRRENRISLNETERRHEREVQEARIKLRDKFRGDKS
FT                   EPAGTGFQDDGLQANERNLEADIALENTRKNAKDVLLNEAVHILSDEVALLKSKSRLAA
FT                   SALPEIQ"
FT   sig_peptide     complement(15697..15756)
FT                   /locus_tag="Galf_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.583 at
FT                   residue 20"
FT   gene            complement(15832..16944)
FT                   /locus_tag="Galf_0012"
FT   CDS_pept        complement(15832..16944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0012"
FT                   /product="alanine dehydrogenase"
FT                   /note="KEGG: slt:Slit_2149 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: alanine dehydrogenase/PNT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54057"
FT                   /db_xref="GOA:D9SHM4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM4"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ADL54057.1"
FT                   /translation="MKIGVPKEIKTNENRIALAPSGAAALVVAGHQVWVEQGAGEGSGF
FT                   SDQLYLDAGAQIAPDAEMLWLQAELIVKVKEPLRAEWPRIRPGQILFTYFHFAASRELT
FT                   DAHLASGAICIAYETVAQPSGELPLLTPMSEVAGRMAVQEGAKYLEKLYGGRGVLLGGV
FT                   PGVAPAHVVVLGGGIVGSNAARMAAGLGARVTLLDVSLDRLRHLSQTLPANVQTLYSNR
FT                   HNLLEQLTSADLIIGGVLIPGAAAPKLLRAEDLKLMQPGTVIVDVAVDQGGCFETTRPT
FT                   THEKPVYIVDGVLHYAVANMPGGVPRTSTLALTNATFPYLLQLASKGWQQALRDSSALR
FT                   FGLNIIDGKITYRAVANAFDLAYTSPENFL"
FT   gene            complement(16968..17708)
FT                   /locus_tag="Galf_0013"
FT   CDS_pept        complement(16968..17708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0013"
FT                   /product="Protein of unknown function DUF2257"
FT                   /note="PFAM: Protein of unknown function DUF2257; KEGG:
FT                   slt:Slit_1170 protein of unknown function DUF2257"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54058"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM5"
FT                   /inference="protein motif:PFAM:PF10014"
FT                   /protein_id="ADL54058.1"
FT                   /translation="MTITMLTPAFIPPQQLAEAVKRQGYGVLNAEGLSRLTGIALSDMN
FT                   AIQADWNDLPPDNFLKDGGRYRRRRHSCFIASGDTLLQAPHRAHYQPLEYNALHGGMHR
FT                   LFEPMSAQLLQCPLWPALLLAAAGICSTVKGIRPWYIEAHQFRIDTSNGIGRPTPEGAH
FT                   RDGVDFVAIVLVNRHNVNGGESRIFEADGPNGQRFTLSEPWTMLLLDDQRVLHESTPIQ
FT                   PTAEGGYRDTLVLTFRSGAFLDAV"
FT   gene            complement(18060..20201)
FT                   /locus_tag="Galf_0014"
FT   CDS_pept        complement(18060..20201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0014"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: GGDEF domain containing protein; PAS fold-4 domain
FT                   protein; PAS fold-3 domain protein; KEGG: slt:Slit_1666
FT                   diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF
FT                   sensor(s); SMART: GGDEF domain containing protein; PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54059"
FT                   /db_xref="GOA:D9SHM6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54059.1"
FT                   /translation="MSLKRVFKPSDFAAIALLLGIFLLLELSRSIHYLFFHTMVELLSI
FT                   VVSISIFILIWASHRQLANGYLIILGGAYGAIGLIDVFHTLTFKGMNLFPAIDVNYTNQ
FT                   FWLTARFLEAAALLVAPLYINKKPNLFHVSLIFFLLAAVAGIAVINRWFPATFVTGTGL
FT                   TPFKIYSEIIIIAVMLSALFLLYQRREHFDRRIFFLLQLSLILAIVGEFCFTLYAGFYD
FT                   FTHALGHYIRFVSVAAALAALVISGIRRPLNLLFRELSEHRKSQDELNHKLAKSVSLLN
FT                   ATVESTDDAILVVDLDGTWVLHNKRFDELWDISDELIASQDDRAALTYVLDQLQDPDSF
FT                   LAHVGELYATPDANSFDTLEFKNGKTIERYSFPQKVDGRVVGRVWRFRDITERKAMEDK
FT                   LRYSEQRFQDVSNAAGEYVWEIDINLIYTYVSLRSIEVKGYLPEQLIGHTPVEFMHPDD
FT                   INTVGEIVNHAISNKSAFNLQHRDITPSGEVVWEEVNGTPYYDHKGNVIGLRGTGLNIT
FT                   DRKSRENQIHRLAFYDPLTKLPNRRLLNERLLHTLATIKRNDRYGALMFLDLDHFKPLN
FT                   DAYGHVAGDLLLIEATRRMEESVRAIDTIARFGGDEFVVLLSDLETNLQATLSDAHAIA
FT                   EKIRTTLSVPYQLTILDEKNMNLTVEHTCSASIGICIFNATNSNADEILQRADEAMYQA
FT                   KKSGRNCIRIHSSTDELLK"
FT   gene            complement(20252..21943)
FT                   /locus_tag="Galf_0015"
FT   CDS_pept        complement(20252..21943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0015"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: slt:Slit_0544 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54060"
FT                   /db_xref="GOA:D9SHM7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL54060.1"
FT                   /translation="MKIWWGKLSISSKLQLPIQLCLLVVMLLAQRMALDTYEKTILDGT
FT                   KDKAVLSADGLLVALNMMMINGEIHDAGQRALYVQKMGAASAMLELRVIRGQSVQNQFG
FT                   PGLPSEQPVDEMDRRVLRDGQLQSNLLEFEGKHALRVVIPFIAQNEFRGTKCLSCHNVP
FT                   AGTVNGAASMTIDLNDDLVLMRRANYILWGLQVIVQIFLYLGIGWLIRRTLRPAQQIQL
FT                   NLEKMSTGDFTGQILVSNNDEISAIAKSSRLLNDELGKLIGNIKLAANHLSGTAQRVAM
FT                   VSNMTSEGIKSQREETTHASESVTQIAHSLNESVTGSRNAVSVAETIAEQAGEAKIIVS
FT                   DAIITIHTLAEEVKAATEVIQALHKESDDIRGVTNIINDIANQTNLLALNAAIEAARAG
FT                   EQGRGFAVVADEVRKLAQRTQDATREIEKKIETLLKGVESATSVMKSGTNRADDSVVQI
FT                   NKTNLSLEEIIQSITKIREVNMRIADSVENQSLIATNINDTIVNIRHVADQTAFSSKNT
FT                   SAEIEKVAEAAVELNKLVEKFAVHETTQTFKDATNSKKTDSSDVLF"
FT   gene            22548..24155
FT                   /locus_tag="Galf_0016"
FT   CDS_pept        22548..24155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0016"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: lhk:LHK_00064 CheY-like receiver; PFAM:
FT                   response regulator receiver; Tetratricopeptide TPR_1
FT                   repeat-containing protein; SMART: response regulator
FT                   receiver; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54061"
FT                   /db_xref="GOA:D9SHM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54061.1"
FT                   /translation="MATVNNVSDKWVLVIDDMEGMRSQLRMSLSSSGFAKLHVVGSIKE
FT                   ALERLSANHYDVILCDYSLGDSTDGQQFLEYLRTNDLIGRNTIFVMITAEQSYAKVVAA
FT                   SECAPDDYLLKPFTSAQFTTRLEKLLERQEYFRAIDQAADKKNWSKMIAECDKLLAGRD
FT                   KHYFDLCKIKGVALVRNEQVQQAADLYREIISLRPLGWARLGLARALARLGKQGEAIEL
FT                   LREILVETPQFMAAYDFLGKLMAESGDKKGALDVLQQARSISPGTMSRIRELSTLAVST
FT                   GQPEIAEKIMRETLIKHKYSPVRQANDYVVLSRALTDQGKTADALSVVQDARKSFTDSH
FT                   SNVVLSVTESSVHRAAGNEELAHAVLEQAMNSGEMGSFSADALVALADACFSLGKSEDA
FT                   TRLLHHAVQNHHESDEIKGKVHAVLVAAGKDASEASALIEASAGEVIALNNEGVRHAQA
FT                   GKLDEAIALLSEAANRLPNNLQILGNAALVIALDLVRNGRDPAKLAMCLGYREALTKKS
FT                   RNHAKLEQIDGMLKQLKS"
FT   gene            24167..24781
FT                   /locus_tag="Galf_0017"
FT   CDS_pept        24167..24781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0017"
FT                   /product="histidine kinase"
FT                   /note="KEGG: sde:Sde_1855 signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54062"
FT                   /db_xref="GOA:D9SHM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHM9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL54062.1"
FT                   /translation="MNDLAAAVMHDVKNQLAELALRLKKRGDARAEMEIAMNASRRLTE
FT                   MLLLGREESNQLWVSADTVNPADFLEVLAAEYAELFPDIEIKLDVARAPECVFFDDALV
FT                   RLALGNALHNACRYAHEKVTLAAFQQNDLLFLEVRDDGTGFPDSVLSSGGQLPASVTGT
FT                   GTGLGLYLAQKIAALHKLGDRHGYISLYNGVQGGIFRIVLP"
FT   gene            complement(24810..27428)
FT                   /locus_tag="Galf_0018"
FT   CDS_pept        complement(24810..27428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0018"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: slt:Slit_0004
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain-containing protein;
FT                   DNA topoisomerase type IA zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54063"
FT                   /db_xref="GOA:D9SHN0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN0"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADL54063.1"
FT                   /translation="MAINLLIVESPAKAKTLKKYLGNDYEVLASYGHVRDLVPKTGAVD
FT                   TENGFAMNYETIARNSKHMDAIAKAAASAENILLAPDPDREGEAIAWHIAELLKAKRGF
FT                   KGKNMKRVVFYEITQSAVQAAVANPREIAMPLVNAQQARRALDYLVGFNLSPLLWRKIR
FT                   PGLSAGRVQSPALRLIVERELQIEAFKTQEYWSVHLDTQKNHQSFSARLIQYQGKKLEQ
FT                   LSIASQSEYDAIYAKLNDAKLPPKVVKVEKKAKQRYAAAPFTTSTLQQEAVRKLGMSAE
FT                   RTMRTAQSLYEGVDIGGQTVGLISYMRTDSVSLANEAVAEIRNYIGDHFSSEYLPGTPP
FT                   TYKSKTKNAQESHEAIRPTSIVRTPDSLQDRLTVDQARLYEMIWKRTLACQMTAARYDT
FT                   VSADIRLGGDDTLFRANGQVLVFPGFISVYMEDVDDAEEEQGSRLPPLVEGDILPVDKL
FT                   FGEQHFTQPPPRFTEASLVKSLEEYGIGRPSTYATIISTLQTREYAILDKKRFMPTDVG
FT                   RVVTRFLTDHFTRYVDYNFTASLEDELDEVSDGKRDWIGVMDEFWKGFSALIKEKTNIE
FT                   RPQELLDEACPECGKPLAKKLSRYGSFISCTNYPECKYKRSVGGETQEEVRVELGVHPE
FT                   SAQAVLLLRGPYGHYVQLGEVIEGEKAKPKRVSWPKEMAVDQADLESALKLLSLPKDLG
FT                   LHPETNKKVIVNIGRFGPYIGHDGKFKSIPRTDSIFDVTLDRAVELLAQAKDGNTVLRT
FT                   LGDHPVDKTTVEICSGRYGPYARHGKINATLPKDVSPDEITLEQALELIAAKAAKGDTK
FT                   PARKSAAKPKATAKPKAAAKPKAAAKPKAAPKAEAKPKAAAKPKAAPKAAAKPKAAAKK
FT                   A"
FT   gene            complement(27441..27896)
FT                   /locus_tag="Galf_0019"
FT   CDS_pept        complement(27441..27896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0019"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   slt:Slit_0005 protein of unknown function DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54064"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN1"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ADL54064.1"
FT                   /translation="MFEILMYLFESYIDAGSYPAPDKLSRKLSAAGFEGEDIDEALNWL
FT                   SALREQNSDSYPVVLAHSGMRFFAELEFSLIGAEARQFLLFAEQQKMITAIEREIIIDR
FT                   ALALQQKDLGLDKLKLIMLIVLWDRHHDLSPLLVEELLVPITSTQLH"
FT   gene            complement(27910..28992)
FT                   /locus_tag="Galf_0020"
FT   CDS_pept        complement(27910..28992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0020"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: slt:Slit_0006 DNA protecting protein DprA;
FT                   TIGRFAM: DNA protecting protein DprA; PFAM: SMF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54065"
FT                   /db_xref="GOA:D9SHN2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN2"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADL54065.1"
FT                   /translation="MPGDTSIQAWLTLGLIRGLGGEGARHLLREFGSPEAVLAAPTERL
FT                   KSVVKPEVAQAVNKGADEVALNAALLWLTDEQNHLVTLADSDYPEALLNIIDPPILLYV
FT                   KGRRDLLNAKSLAIVGSRHATPQGIDNAEQFANVLSDAGLCIISGMAHGIDAAAHRGAL
FT                   RGTGSSIAVVGTGLDKVYPAANRELAHRLAKAGTLISEFPLGTPPMAGNFPRRNRLISG
FT                   MSLGCLVVEASLQSGSLITARQAMEQGRDVFAIPGSIHSPQSRGCHKLIKQGAKLVETA
FT                   QDILEELTGLLTPPPVQAAKPTPAPHAVLLEQMGFDPVGIDALCLRSGLTVSQLSAMLL
FT                   TLELEGCIATLPGGLFQRIH"
FT   gene            complement(28995..30032)
FT                   /locus_tag="Galf_0021"
FT   CDS_pept        complement(28995..30032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0021"
FT                   /product="Peptidoglycan-binding lysin domain"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; KEGG:
FT                   slt:Slit_0007 peptidoglycan-binding lysin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54066"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN3"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADL54066.1"
FT                   /translation="MRKIISLICFLMPVLAFAGQPDASPQIRSDAPDQYMIVKGDTLWG
FT                   ISGKFFKDPWKWPFIWGMNKDAIKDPHWIYPGATLYLDRTSGTLSLTKQSAAVTGNGET
FT                   VRLSPQIRTEDSTQNAIPSIPSRVIEPFLSQPLIVSDKLLNEAPTLIGLPEERVIAGPG
FT                   DVVYVKGLSAADTKSWQIYRPGKTFTDPDTHEVLGHEAIYLGTLEVREFGPTSIAVVTE
FT                   AKQEINLGDRLIPATAYIANTYLPRAPETQINARVISIYGGVTQAGQNTVITLNKGERD
FT                   GVQSGHVLAVSSKGRTVQREGKSLTLPDERFGLLFVFRVFEKVSYALVMQTRLPVQLLD
FT                   SAQTP"
FT   sig_peptide     complement(29976..30032)
FT                   /locus_tag="Galf_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.846 at
FT                   residue 19"
FT   gene            30122..30625
FT                   /locus_tag="Galf_0022"
FT   CDS_pept        30122..30625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0022"
FT                   /product="peptide deformylase"
FT                   /note="manually curated; TIGRFAM: peptide deformylase;
FT                   KEGG: slt:Slit_0008 peptide deformylase; PFAM:
FT                   formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54067"
FT                   /db_xref="GOA:D9SHN4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN4"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADL54067.1"
FT                   /translation="MAILQILQYPDERLHTIAKKVVQVNDVTRKLVQDMAETMYAAPGV
FT                   GLAATQVNVHEQIIVVDVSETHDELLVFINPEILHRSGEQEGEEGCLSVPGIYENVRRA
FT                   DKISVRALNQQGESFTLDAEGFLAVCIQHEVDHLHGRVFVEYLSQLKQSRLRAKLKKRR
FT                   REAM"
FT   gene            30635..31558
FT                   /locus_tag="Galf_0023"
FT   CDS_pept        30635..31558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0023"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="KEGG: slt:Slit_0009 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54068"
FT                   /db_xref="GOA:D9SHN5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN5"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADL54068.1"
FT                   /translation="MKIIFAGTPHFAASALEALLKEHQVAAVLTQPDRPSGRGMQLTAS
FT                   PVKLLALAHGIPVLQPESLKTEQAQSDIKALDADVMVVAAYGLILPKAVLELPRLGCLN
FT                   IHASLLPRWRGAAPIQRAILAGDTETGITIMQMDVGLDTGDILLTRRCTIDAHDNAQTL
FT                   HDKLAALGAASIVEALRADNVLTPVAQDNDAACYAAKLLKGEALIDWTQDAVQIERAVR
FT                   AYNPFPVCQAKFNDVVLKLWQAEACDAMSGHPGEVLAVDKSGITVACGRGALKLQMLQR
FT                   PGGKSQPAVQFLQAMPVRAGDNFQVH"
FT   gene            31559..32824
FT                   /locus_tag="Galf_0024"
FT   CDS_pept        31559..32824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0024"
FT                   /product="sun protein"
FT                   /note="KEGG: slt:Slit_0010 sun protein; TIGRFAM: sun
FT                   protein; PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54069"
FT                   /db_xref="GOA:D9SHN6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN6"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ADL54069.1"
FT                   /translation="MHNIQLAATQIVQQVMEDGRNLNQVLDESLRRKSVWTPAQRAALQ
FT                   DLSYGTLRFYGQLNAILELLLHKHMTDHRISYLLLVALYQLQYSRAAQHAVVDHAVRSA
FT                   DILNPKIRGLVNAILRNFLRNQADLLTQAALKDEGHYSHPQWWIDELRAQYGDAADAIL
FT                   IAGNGHPPMTLRVNAQRGSTPDYLAQLAAQDIPARLIGAEALQLEKPVSVDKLPGFFDG
FT                   LVSVQDAGAQYAARLLDAKAGMRVLDACAAPGGKTAHILERADVELLALDKDAARLSRV
FT                   KENLQRLTLNAALLTGDAASPSDWWDGRLFERILADVPCSATGVVRRHPDIKWLRRKKD
FT                   LASFAEQQFEILNALWPLLAPGGLLLYATCSVFKQENQQVVDKFLAQTPAAQQRDTGLP
FT                   GGMLLPDDEHDGFFYALLQKTV"
FT   gene            32799..33389
FT                   /locus_tag="Galf_0025"
FT   CDS_pept        32799..33389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54070"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN7"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_0048"
FT                   /protein_id="ADL54070.1"
FT                   /translation="MPCCKKLFKVLLLLTLPVWLYATAARADGIEVNKAEIHASEDGYQ
FT                   LSADFNVNLNNVVQQALSLGVPLYFIGEFTLTRSRWYWLDEQVYQNEHSVKLSYNVLTR
FT                   QYRISRGSLFQNFASLEDLMRILARQNSGYIPIDAMKKDGNYIASVRLRLDTKQLPKLM
FT                   QVNVLTSRDWDFDSGWYRWLIRSQDAALRGKTE"
FT   sig_peptide     32799..32882
FT                   /locus_tag="Galf_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.854 at
FT                   residue 28"
FT   gene            33392..35512
FT                   /locus_tag="Galf_0026"
FT   CDS_pept        33392..35512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0026"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; KEGG: slt:Slit_0012 multi-sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54071"
FT                   /db_xref="GOA:D9SHN8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADL54071.1"
FT                   /translation="MKYLIILSVIAGAALLFMLSSSSVNTEVFSINYYGLLGLMGLLAA
FT                   GLLGLVVYQVWRLRVKLKNKIFGAKLTLRLVLFFTLIAVLPGILVYAVSVNFLSKSIES
FT                   WFDVRVEKALEGGLNLGRSGLDNSLKELTQKTQFIALLLTEKNPAQFKNTLDQLIDEGV
FT                   AQEAALFGAGDKMIAFSASDSALLPDIPSDKLMRQVREKGLYSAIEATPSRALSLRVLA
FT                   LVSVNSYSKASYVLQFNQLVPKQIAADAETVQAVYRDYQELTLSRLGLKRLYGITLTLA
FT                   LLVVLLTAISAAFFISERIGSSLEALAVGTRAVAQGDFSGQHPIRSSDELGALTGLFNQ
FT                   MTRQLADARRASEQQQREVESAKGYLESVLTHLSSGVLALDDEFRLRSVNTSAAQILGA
FT                   PLQELQRMPLQQIAEKYSLLHSFCQTITEAFAQNGEWQRQIERLSRNGTQILLMRGTSL
FT                   PQGSDAGYVVVFDDISHLLQTERQAAWGEVARRLAHEIKNPLTPIQLSAERLQYKLSSK
FT                   LDETDAKLLQRATQTIVSQVGAMKNMVTDFADYARGPVLKLLRLDVHKLIKEVLGLYEA
FT                   NAVPISLDLSEGRAEVNGDATRLRQVLHNLLQNAQDALSGVEQPKIILSSQIVQGEIHL
FT                   RVLDNGTGFSENALSRVFEPYMTTKTKGTGLGLAIVKKIIEEHGGQIRVENNASGGACV
FT                   NISLPLIQEVQV"
FT   sig_peptide     33392..33472
FT                   /locus_tag="Galf_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.727 at
FT                   residue 27"
FT   gene            35509..36156
FT                   /locus_tag="Galf_0027"
FT   CDS_pept        35509..36156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0027"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: slt:Slit_0013 two component transcriptional
FT                   regulator, fis family; PFAM: response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54072"
FT                   /db_xref="GOA:D9SHN9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHN9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54072.1"
FT                   /translation="MSKQILVVDDEVGIRELLAEILFDEGYQIHLAENAEQARAFRHEH
FT                   EPDLVLLDIWMPDTDGVTLLKEWVEQDLLTMPVVMMSGHGTIETAVEATLIGAVDFLEK
FT                   PISMQKLLNTVAKAIREGAPRPPMVVAETEVSQKFTVEIGGATKQFLLPLDLPLREARE
FT                   HFDAIYFDYHLQMEAGNVSRVAEKIGVERTHLHRKLKQLGIKVIKKSGESES"
FT   gene            36338..38353
FT                   /locus_tag="Galf_0028"
FT   CDS_pept        36338..38353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0028"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain-containing protein; KEGG:
FT                   slt:Slit_0014 transketolase; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54073"
FT                   /db_xref="GOA:D9SHP0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP0"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADL54073.1"
FT                   /translation="MTADRSITPPKYNDITGAIRMLAVDAVQKANSGHPGAPMGMAEIA
FT                   DVLWNHHLRHNPANPKWPGRDRFMMSNGHGSMLVYALLHLSGYDLPIDELKRFRQMHSK
FT                   TPGHPEYGYTAGVETTGGPLGQGITNAVGMAMAEKLLAAEFNKPGHEIVDHRTYVFMGD
FT                   GCMMEGISHEACALAGTWGLGKLTAFWDDNEISIDGHTNGWFTDDTAKRFEAYGWHVVA
FT                   NVEGHDPEAINAAIEAAKAVTDKPSLICCKTVIGAGSPNKEGTHDVHGAALGDAEVAAT
FT                   RAHINWPYAPFEIPQHVYEAWDARTKGAGLEQLWNNKFAEYSAAYPAEAAEFTRRTKNE
FT                   LPSGWAAHAAAAIAATNAKGETIATRKASQNAINALASALPEFLGGSADLTGSNLTNWT
FT                   GCKHVHGKTTGNYISYGVREFGMSHIMNGMALHGGLLPFGGTFLMFSEYARNALRMSAL
FT                   MKQRVIYVFTHDSIGLGEDGPTHQPVEQTATLRHIPNMEVWRPCDTVESIVSWVAAVER
FT                   KDGPSSLIFSRQNLQFQKRTEAQIADIRKGAYVLSEAAGGKPQAVIIATGSEVTLALDA
FT                   QKALAEAGINVRVVSMPSTNVFDKQDQAYKDSVLPRGVNRVAVEAGVTGGWYKYVGLDG
FT                   AVVGMDCFGESAPAPELFKHFGFTVANVVQAVKGVL"
FT   gene            38454..39452
FT                   /locus_tag="Galf_0029"
FT   CDS_pept        38454..39452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0029"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="SMART: Glyceraldehyde 3-phosphate dehydrogenase,
FT                   NAD(P) binding domain; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; KEGG: slt:Slit_0015
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, catalytic domain;
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54074"
FT                   /db_xref="GOA:D9SHP1"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP1"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADL54074.1"
FT                   /translation="MAIKVGINGFGRIGRMVFRAATKDFPEIEVVAINDLLEPDYLAYM
FT                   LKYDSVHGRFNGDVAVKGSNLVVNGKEIRLTAERDPANLKWNEAGVDIVIECTGFFLDQ
FT                   ESCQKHIQAGAKKVVMSAPCKDTSPMFVYGVNHETYKGEAIVSAASCTTNALAPVAKVL
FT                   NDTFGIKRGLMTTVHAATATQKTVDGPSNKDWRGGRGILENIIPSSTGAAKAVGVVLPE
FT                   LKGKLTGMAFRVPTSDVSVVDLTVELNKEATYAEIVAAMKAASESGPLKGVLGFTAEKV
FT                   VSTDFRGYTCPSVFDAEAGIALDPTFVKVVAWYDNEYGYTCNLMRMVRHIA"
FT   gene            39520..40719
FT                   /locus_tag="Galf_0030"
FT   CDS_pept        39520..40719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0030"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: slt:Slit_0016 phosphoglycerate kinase; PFAM:
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54075"
FT                   /db_xref="GOA:D9SHP2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP2"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADL54075.1"
FT                   /translation="MSVIKMTDLDLKGKRVLIRSDLNVPVKDGKVTSDARITASMSTIN
FT                   AAIKAGARVMVTSHLGRPTEGEYSEENSLKPVADTIANKLGKPVRLIKDWIDGGFDVAE
FT                   GELVLLENCRFNKGEKKSTDELAKKYAALCDIFVMDAFGTAHRAEASTHGVAKFAPVAA
FT                   AGILLTEELEALTKALLSPARPMVAIVGGSKVSTKLTVLESLSEKCEQLVVGGGIANTF
FT                   LKATGHPVGKSLCENDLVPTAQALIAKMTARGAIIPIATDVVVGTAAPFIPGNENTPAI
FT                   LKDAKDVADEDMIFDIGPKSAQEICDIIMNAGTVVWNGPVGVFEFDQFGEGTKAIANAI
FT                   ASTKAFTLAGGGDTIAAIQKYDIFDKVSYISTAGGAFLEFLEGKTLPAVAILEERAKNS
FT                   "
FT   gene            40792..42240
FT                   /locus_tag="Galf_0031"
FT   CDS_pept        40792..42240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0031"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="TIGRFAM: pyruvate kinase; KEGG: slt:Slit_0017
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54076"
FT                   /db_xref="GOA:D9SHP3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP3"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ADL54076.1"
FT                   /translation="MLRRTKIVATLGPASSDQKVLEEMIRAGVDLVRMNFSHGSAADHV
FT                   KRAEVVRAAATAVGRTVGILADLQGPKIRVGKFENSKIVLEKGDTFILDAELEGLGNQQ
FT                   CVGLDYKELPNDVSPGSVLLLNDGMLEFDVLEVQGSRVICKVIRGGVLSNNKGINRKGG
FT                   GLTAPALTEKDMEDIKTAALIKADYLAISFPRSGEDMRFARKLMHEAGGQSLLMAKIER
FT                   AEAIPALADIIEASDAIMVARGDLSVEVGDAAVPGLQKRMIKMARAKNRLVITATQMME
FT                   SMITNPIPTRAEVSDVANAVLDGTDAVMLSAETAVGDYPVETIEAMARICINAEQQVDD
FT                   HAIDQRAVAHKFTRIDQSIAMSALFAASHFKVKAIVALTQSGSTALWMSRVNAGVPIFA
FT                   LTPVHATLTKVTLFSGVHPVLFPSRDVKNTAQELIDAEQKLVEMGCVQDGDLIVVTVGE
FT                   SVGQSGHTNTLKIVRIGDHHKNSL"
FT   gene            42293..43357
FT                   /locus_tag="Galf_0032"
FT   CDS_pept        42293..43357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0032"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II,
FT                   Calvin cycle subtype; ketose-bisphosphate aldolase; KEGG:
FT                   slt:Slit_0018 fructose-bisphosphate aldolase, class II,
FT                   Calvin cycle subtype; PFAM: ketose-bisphosphate aldolase
FT                   class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54077"
FT                   /db_xref="GOA:D9SHP4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP4"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ADL54077.1"
FT                   /translation="MALVSLRQLLDHAAEHSYGLPAFNVNNLEQVKAIMEAADECNSPV
FT                   IMQGSAGARKYAGEPFLRHLIEAAVEMYPHIPVVMHQDHGASEAVCINAIRSGFSSVMM
FT                   DGSLLADGKTPSSFEYNVNISRRVAEMSHAVGVSVEGELGCLGSLESGEGEKEDGHGAE
FT                   GVLSHDQLLTDPEEAAEFVRQTGVDALAIAIGTSHGAYKFTRPPTGAVLRIDRIREIHE
FT                   RLPNTHLVMHGSSSVPQEWLKIINEFGGTMGETYGVPVEEIVEGIKNGVRKVNIDTDLR
FT                   MASTGATRRYLAQNTKDFDPRKFLAATTVAMKAICKARYEAFGCAGQASKIKPISLEAM
FT                   ANRYAKGELNAIIK"
FT   gene            complement(43428..44315)
FT                   /locus_tag="Galf_0033"
FT   CDS_pept        complement(43428..44315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0033"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: nmu:Nmul_A0687 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54078"
FT                   /db_xref="GOA:D9SHP5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADL54078.1"
FT                   /translation="MLHFTLRQLQVFEKVASLLNYSRAAEELYLSQPAVSMQIKQLEGH
FT                   IGLPLFEQMGKKIYLTAAGIELFHYARNIAQQLEEMEVVFDEMKGMARGKLTLSVVNTA
FT                   NYFTPKLLARFSQRYPTINMILQVANRDAVLSQLADNSTDLAIMGQPPEGLDITAQLFM
FT                   DNPLVVIANPSHPFSALKRIKFSQLAGETFLSREKGSGTRSAMERVFAKHGVQPRISME
FT                   METNEAIKQAVQAGMGLGILSLHSIELELETHRLVVLDVEHFPLLRHWFVAHRSNKRLT
FT                   SAALAFKEFLLNEA"
FT   gene            44501..45913
FT                   /locus_tag="Galf_0034"
FT   CDS_pept        44501..45913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0034"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: slt:Slit_0022 ribulose-bisphosphate
FT                   carboxylase; PFAM: ribulose bisphosphate carboxylase large
FT                   chain; Ribulose bisphosphate carboxylase, large
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54079"
FT                   /db_xref="GOA:D9SHP6"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020871"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP6"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADL54079.1"
FT                   /translation="MDQSNRYANLNLKEEDLIKNGKHLLVAYKLIPAKGHGFLEVAAHV
FT                   AAESSTGTNVEVSTTDDFTRGVDALVYEIDETAFGDDIVKGGGLFKVAYPVELFDPNLT
FT                   DGTYNISHMWSLILGNNQGMGDHQGLRMLDFLVPEMMVRKFDGPSANISNLWKVLGRSE
FT                   TDGGYIAGTIIKPKLGLRPEPFAKACYDFWLGGDFIKNDEPQANQPFCPMEVVMPKVAE
FT                   AMDRAQQETGQAKLFSANITADYYKEMIHRGDFVLETFAKYNSASHVAFLVDGFVTGPA
FT                   GVTTCRREFPDTFLHFHRAGHGAVTSYKSPMGMDPLCYMKLVRLMGASGMHTGTMGYGK
FT                   MEGHGKETVLAYMLERDECQGPYFYQKWYGMKATTPIISGGMNALRLPGFFQNLGHGNV
FT                   INTCGGGAFGHIDSPAAGGISLGQAYDCWKSGSDPIEYAKTHKEFARAFESFPKDGDKL
FT                   FAGWREKLGVHK"
FT   gene            46084..46887
FT                   /locus_tag="Galf_0035"
FT   CDS_pept        46084..46887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0035"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: slt:Slit_0023 CbbQ/NirQ/NorQ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54080"
FT                   /db_xref="GOA:D9SHP7"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP7"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADL54080.1"
FT                   /translation="MTNKNQYTVSKEPFYQAQGDEVALYEAAYAARLPVMVKGPTGCGK
FT                   SRFIEYMAWKLNKPLITVACNEDMTASDLVGRYLLDANGTRWLDGPLTTAARIGAICYL
FT                   DEIVEARQDTTVVIHPLTDHRRTLPLDKKGELIEAHPDFQLVISYNPGYQSLMKDLKQS
FT                   TKQRFTGFEFDYPDAALESEILAKETGLDIEVCGKLVQIGQAARNLKGHGLDEGISTRL
FT                   LVYAAILIKNGVDAKAACRMALVRPITDDADIRDTLDHAIDASFA"
FT   gene            46923..49196
FT                   /locus_tag="Galf_0036"
FT   CDS_pept        46923..49196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0036"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: slt:Slit_0024 von Willebrand factor type A;
FT                   PFAM: von Willebrand factor type A; SMART: von Willebrand
FT                   factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54081"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP8"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADL54081.1"
FT                   /translation="MTEIVTQRTEELSMYWEKLSCRFARVDAVFDECMKEAQALLSKAG
FT                   LEAYIENARIIGKMGRGAEPLLIYLEEAPGVASIIGEHALIKLREFSEYLSTHTNFKAI
FT                   VPFLQYSGAVARRLNNDKMYGRYIELIRDMLDRTSGSIHGHHTTFASPGLPELLKQAPK
FT                   LLGVLSLQGLQNWIEYGIKYYNHHPERQEEYFRLESADAVAVMQRERHGTLLVNNERKL
FT                   DTYIRALWNDSDYLIPYSVAFDEQRKPMPYYTDDGIRLPDVYDDFNGVSGIDRYRAALA
FT                   HMAAHRRWSQKMIVDNWSPFQRASVEIFEDSRVEYLACQKYPGLRKLFLALHPIPKEED
FT                   LQLEEQGISVFRLRLAMLSRAILDPAYICQNEHVREFTKRFHELMAGGQSTSAAMASVA
FT                   LAFIARTRGQRDLSANMYFDNTEVDYRDDNRHLWIYIEESDEDEMFEHLDQRKNSEVEL
FT                   QALPPRHYDEWDYNTKSYRPDWVSVYEALHPRGNPAVIDNLLAKHAALAKRLKKMLDLL
FT                   KPQDKVRIRYQEEGSELDLDVAIRSLIDFKGGSSPDPRINMSHRNDGRNIAVSVVLDLS
FT                   ESLNEKAAGSTQTILELSQEAVSLLAWAIEKLGDPFAISGFHSNTRHDVRFMHIKGFSE
FT                   KWDDEVKGRLAAMQASYSTRMGAAMRHASHYLEQQQADKKLMLILTDGEPADIDSRDGR
FT                   ILIEDARKAVTELDQKGIYAYCINLDPKADEYVKDIFGKQYTIIDKVADLPAKLPQLFI
FT                   SLTK"
FT   gene            49297..50298
FT                   /locus_tag="Galf_0037"
FT   CDS_pept        49297..50298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0037"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: slt:Slit_0025
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54082"
FT                   /db_xref="GOA:D9SHP9"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHP9"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADL54082.1"
FT                   /translation="MSKSLIQFIIEEQRHIPNASGDFTGLLSDIISACKQIAHDVNKGA
FT                   LIGVLGSAGSENIQGETQKKLDIITNEVFIKANEWSGHLAAMASEEMDDIYEIPKQYPR
FT                   GKYLITFDPLDGSSNIDVNISVGTIFSILRCPEGVTNPTAADFMQPGTKQVCAGYALYG
FT                   PNTMMVITTGHGVNGFTLDRDVGDFFLTHPDMQIPVDTQEFAINMSNRRYWEEPVQRYI
FT                   EECVKGKDGGREKNFNMRWVASMVAEIHRILTRGGIFLYPFDNKEAGKAGKLRLMYEAN
FT                   PMSFIVEQAGGVCSTGRERIMELQPTGLHQRVPVIMGSKNEVERVVGYHKGA"
FT   gene            50357..50851
FT                   /locus_tag="Galf_0038"
FT   CDS_pept        50357..50851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0038"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: slt:Slit_0026
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54083"
FT                   /db_xref="GOA:D9SHQ0"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ0"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADL54083.1"
FT                   /translation="MSKPLVSIIMGSSNDWDIMSQAAQQLKDFGVAYDARVISAHRSPD
FT                   LLFDYIKEVSAQGVQCFIAGAGGAAHLAGVIAGKTTLPVLGVPIPSKYLKGMDSLLSIV
FT                   QMPKGIPVATFAIGEAGAANAGLFAIAMLALNDVALAERLTEYRAQQAIKIAETTLPEL
FT                   A"
FT   gene            50893..51777
FT                   /locus_tag="Galf_0039"
FT   CDS_pept        50893..51777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0039"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: slt:Slit_0027
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54084"
FT                   /db_xref="GOA:D9SHQ1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ1"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADL54084.1"
FT                   /translation="MSALHESNLTSLPLLHRGKVRDLYEVDAQHLLIVQTDRLSAFDVI
FT                   LDDPIPGKGEVLTTLSNFWFKKLGHIIPNHLSGIAPESVVKGDAEQAQVRGRSFVTKKL
FT                   KPLPIEAIVRGYLVGSGWKDYQKTGTICGLALPAGLREAQKLPEPLFTPSTKAAVGDHD
FT                   ENISYAQAVELLGEARAAQVRDATVALYVEAANYAASRGIIIADTKFEFGVDEAGTLYL
FT                   IDEALTPDSSRFWPAESYQVGSNPPSFDKQFVRDWLEASDWNKQAPAPRVPQDVLQKTA
FT                   DKYHEALQRLTAE"
FT   gene            51792..52493
FT                   /locus_tag="Galf_0040"
FT   CDS_pept        51792..52493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0040"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: slt:Slit_0028 carbonate dehydratase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54085"
FT                   /db_xref="GOA:D9SHQ2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ2"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADL54085.1"
FT                   /translation="MSEGGDEMNSSALAHRASAAAADRRWPQPLIEGFLRFRDNHFPSD
FT                   DIEYLRLFSEGQKPKFLIVGCCDSRVDPALIFNCAPGELFVVRNVANIVPPNEARIGHH
FT                   GTTAAIEYGVCNLGVEHIVVLGHEHCGGIQNLLKTRGAGNPDSFIDDWMRLVESARVSV
FT                   ERDYVHATEEVRGRACEQRAILVSLKNLLTFPWIAQRVAERALRIHGWYFDIKQGQLLG
FT                   YNDATGEFEPL"
FT   gene            complement(52494..53096)
FT                   /locus_tag="Galf_0041"
FT   CDS_pept        complement(52494..53096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54086"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ3"
FT                   /inference="similar to AA sequence:KEGG:Slit_0029"
FT                   /protein_id="ADL54086.1"
FT                   /translation="MTKKILLLALIACCSQQVMAKTYKWVDDKGVTHMGDTIPPEYAGK
FT                   DRAELNKSGRTVSTKDILTIEERRAKEAEQLKASVQETSARDQKLHDKSLTDTYSSVQE
FT                   IELSRTRSLQQVDARINSINSQLKMNGNSLASLQKDADNRIKSNGKIPVSLQEDIKSAQ
FT                   ERDRRLQHDLEKYLAEKSAVNTRYDADKARFRELTGK"
FT   sig_peptide     complement(53034..53096)
FT                   /locus_tag="Galf_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(53089..53736)
FT                   /locus_tag="Galf_0042"
FT   CDS_pept        complement(53089..53736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0042"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   slt:Slit_0030 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54087"
FT                   /db_xref="GOA:D9SHQ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ4"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADL54087.1"
FT                   /translation="MFNFRQDFIRFAVQKQVLRFGEFQTKAGRLSPYFFNAGLFNDGDS
FT                   MRNLSQFYAQAIIASDIPFDMIFGPAYKGIPLATGAAIALSEQGRNVPYSYNRKEAKDH
FT                   GEGGTTVGATLQGRVLIIDDVISAGTSVRESIELIRAAGAEPCAVVIALDRMERGLGDL
FT                   SAVQEVRENYGIPVIAIATLNDLLGFLQNEPEMIANLDAVRAYRDLFGVEND"
FT   gene            53808..54572
FT                   /locus_tag="Galf_0043"
FT   CDS_pept        53808..54572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0043"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; KEGG: mei:Msip34_2527
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54088"
FT                   /db_xref="GOA:D9SHQ5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ5"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADL54088.1"
FT                   /translation="MRIISVNLNGIRSASSKGFYEWLAQQDADVICLQELKAQAADMTE
FT                   HMLTPLGYHGYFHYAEKKGYSGVGIYCRELPKNVIVGLGIEQFDAEGRYLCADFADYSV
FT                   VSLYLPSGSSGEERQGVKFSFMEAFLPHLRELRASGREVIVCGDWNIAHKEIDLKNWRG
FT                   NKKNSGFLPEERAWLTQLFDEVGFVDVFRRVHPELEAYTWWSNRGQAWAKNVGWRIDYQ
FT                   IATPAIAGRATSASIYKEQRFSDHAPLIIDYL"
FT   gene            54833..55324
FT                   /locus_tag="Galf_0044"
FT   CDS_pept        54833..55324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54089"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ6"
FT                   /inference="similar to AA sequence:KEGG:Slit_2156"
FT                   /protein_id="ADL54089.1"
FT                   /translation="MSYSGFSKISRHDNLFQERVHDAYKSRGKLHEPSVCSECGAVFHA
FT                   GRWQWLQAPADAHQETCPACHRIRDHYPAGYLSLKGSFFSSHRDEIMQLLHHHEKHERA
FT                   EHPLKRIIAIEEKPGETLVSTTDIHLARGMGEALHHAYQGELEYHYNPEENLLRVNWAH
FT                   "
FT   gene            55345..55998
FT                   /locus_tag="Galf_0045"
FT   CDS_pept        55345..55998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0045"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: nmu:Nmul_A2188
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54090"
FT                   /db_xref="GOA:D9SHQ7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ7"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADL54090.1"
FT                   /translation="MKTFICLFGLTAVFVSSLVCAQEVADKSGYLTDSAGNVVRNAYGD
FT                   CWRTGYWTPAMAISECDPDLVKKEVAIVPQQKEIPVIPEKIVPPAIVRLNAGTLFDFDR
FT                   AEVKPEGKTVLDEKIVTGMKLHTDTGPLLIIGHADRIGSERYNQRLSERRANAVRDYLV
FT                   EQGVGAQRLSVQGKGESEPDPVSNTGVSCRGMRGERLITCLQPDRRVTVETTAK"
FT   sig_peptide     55345..55410
FT                   /locus_tag="Galf_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            56097..56285
FT                   /locus_tag="Galf_0046"
FT   CDS_pept        56097..56285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54091"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ8"
FT                   /inference="similar to AA sequence:KEGG:Slit_1356"
FT                   /protein_id="ADL54091.1"
FT                   /translation="MKFAVLLMLVCGLAFASGAPWYKWQNIYDQTIMCSQNSPGDTWQI
FT                   YQGPFMESNCRQPGNPQ"
FT   sig_peptide     56097..56147
FT                   /locus_tag="Galf_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.811 at
FT                   residue 17"
FT   gene            56258..56668
FT                   /locus_tag="Galf_0047"
FT   CDS_pept        56258..56668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmb:Mmol_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54092"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHQ9"
FT                   /inference="similar to AA sequence:KEGG:Mmol_0117"
FT                   /protein_id="ADL54092.1"
FT                   /translation="MQAARESSVAMFKYLLVLLLVCTNASAAWQHVGGDKDESAYVDSV
FT                   VHRDRDRVKMWALFDLKAAHAFGDMAYLSMKIQREYHCRDKKSRIVAMQAYAKNMGEGE
FT                   LIYSNNAREKWQAVQSDSVEEMLWNMACKSSS"
FT   sig_peptide     56258..56341
FT                   /locus_tag="Galf_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.905 at
FT                   residue 28"
FT   gene            56678..57463
FT                   /locus_tag="Galf_0048"
FT   CDS_pept        56678..57463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54093"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR0"
FT                   /inference="similar to AA sequence:KEGG:Mpop_2237"
FT                   /protein_id="ADL54093.1"
FT                   /translation="MLSEWLTYLAADCCTFSRKSGYLRESIGIRSRYRRCQSAWQSHLE
FT                   NSRSAIRVSLNSCRSHRTALVLGSGVLLDIPIDELAARFENVWLVDLVHLPEVRRAVRR
FT                   YTNVRCIEHDVSGFREQRAVLSEGGLDLSDPVQFLDEASIDWVASVNLLSQLPLLPQDW
FT                   LRAQFPKIDEQKLEAWGDRIMQQHLDYLAAFGVPVCLLTDYEQTSYQRSGEILSVVDFS
FT                   TRLRFTGTLLKTWRWDVAPPGEISGGGGRFHLVASIAIS"
FT   gene            complement(57468..57920)
FT                   /locus_tag="Galf_0049"
FT   CDS_pept        complement(57468..57920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0049"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: slt:Slit_2921 rhodanese domain protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54094"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR1"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL54094.1"
FT                   /translation="MGKITSILQAAQQRAKDQNLPYEGALYPEEAYEILQSAPGAKLVD
FT                   VRCRAELDWVGRIPDAVEIEWLTYPGMKANPNFAASLTQQVDKEALVLFICRSGARSNA
FT                   ATIAAMQSGFRDCYNILQGFEGDKDSNEHRNTVDGWRAAGLPWVQS"
FT   gene            58029..59219
FT                   /locus_tag="Galf_0050"
FT   CDS_pept        58029..59219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0050"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: slt:Slit_2922 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54095"
FT                   /db_xref="GOA:D9SHR2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR2"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADL54095.1"
FT                   /translation="MKNHTHHSHTEKEAFEPAHPERYAAAQKSTWVSIVINLLLTLFQV
FT                   VGGFFAHSQALMADGLHSLSDLLSDVLVLYANRHGNRHADANHPYGHARVETAATLILG
FT                   VFLAALGVGLLVAAAMRLQHPSALQAVSPLGLAIAVFALLAKEGMFRYMLAVAMRVRSQ
FT                   MLVANAWHARSDAASSLVVVVGIIGNMLGYTFLDLVAAAVVGVMISHMGGKLALEALSE
FT                   LIDTGLDAEEVEAIRQTLLNTHGVLGLHDLRTRKMADNALVDAHILVDPKISVSEGHYI
FT                   AELARHAVLNSHHVLDVMVHIDPEDDMQAGHNAKLPSRPVLLEQLAEQLGKPVVQDNRV
FT                   IFHYLDGQVDVELYLTAGELNEEQVKSLQARCDVLVNGSSLFRAIHVHSNHGVARQ"
FT   gene            59391..60806
FT                   /locus_tag="Galf_0051"
FT   CDS_pept        59391..60806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0051"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: slt:Slit_2923 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54096"
FT                   /db_xref="GOA:D9SHR3"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR3"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADL54096.1"
FT                   /translation="MSLSANDVLQMIKDHDVKFVDFRFTDTRGKEQHVGVPAKYVGLDK
FT                   FEEGHAFDGSSIAGWKGIQASDMLLMPDPATAFLDPFTEDVTLIITCDVVEPTDGKGYD
FT                   RDPRSIAKRAEAYLQSSGVGDTAYFGPEPEFFIFDSVNWKIDMSGCSVKINSEEAAWSS
FT                   DEKYDGGNTGHRPVVKGGYFPVPPVDSLNDIRAAMCLILEDIGIEVEVHHHEVATAGQC
FT                   EIGTKFDTLVRRADQTQALKYVVHNVAHQHGKTATFMPKPIVGDNGSGMHVHQSIWKDG
FT                   KNLFAGNGYAGLSETALYYIGGIIKHAKALNAITNPGTNSYKRLVPHYEAPTKLAYSAK
FT                   NRSASIRIPHVASDKARRIETRFPDPTANPYLCFAALMMAGLDGIANKIHPGDPADKNL
FT                   YDLPPEEDAKIPTVCTSLDEALAALDKDREFLTRGGVFSNDFLDAYIALKMEEVTRLRM
FT                   TTHPVEFEMYYSI"
FT   gene            60944..61366
FT                   /locus_tag="Galf_0052"
FT   CDS_pept        60944..61366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54097"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR4"
FT                   /inference="similar to AA sequence:KEGG:Slit_2924"
FT                   /protein_id="ADL54097.1"
FT                   /translation="MKFWILLLCLSPSLVLADIYKSVDADGHVTYSSAPIKGGKRIVLS
FT                   APTQNTPNHVRASATPHDFPRVTDEAQKGRDGSRRKILEDELKAEVGLMEAAKQSLQVA
FT                   EAHRPRDAEKIKGLTRQLDLHQGNIAALKTELSKLK"
FT   sig_peptide     60944..60997
FT                   /locus_tag="Galf_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.985 at
FT                   residue 18"
FT   gene            61407..62441
FT                   /locus_tag="Galf_0053"
FT   CDS_pept        61407..62441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0053"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: slt:Slit_2925 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54098"
FT                   /db_xref="GOA:D9SHR5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL54098.1"
FT                   /translation="MPDSHYLTLDYLATAIILMDDQSRVIYLNPAAENLFEVSGKNMSG
FT                   NPLKQLFSDAGRLDMAMLLALENNASYIEHDLMLVTHTHNKLYVRCTVTPLQTGQLLLE
FT                   FHPVDRPLKLAREEQMLDQTQANRLLLRNLAHEIKNPLGGIRGAAQLLEQELDKPALHE
FT                   YTQVIIQEADRLRSLMEKLLTPQGKMQHSALNIHEVLERVRSVVMAEVPEGLKIQRDYD
FT                   ISLPALVGDKEQLIQVILNIVRNAVQAMHGQGRIILRTRIARQVTLFKQRHRLAVMVQI
FT                   IDNGPGILPELRDKIFYPLVSGRADGHGLGLTLAQDFISQHHGTIEFESEPGCTRFTVM
FT                   LPLP"
FT   gene            62513..63910
FT                   /locus_tag="Galf_0054"
FT   CDS_pept        62513..63910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0054"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="TIGRFAM: nitrogen regulation protein NR(I); PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   response regulator receiver; helix-turn-helix Fis-type;
FT                   KEGG: slt:Slit_2926 nitrogen metabolism transcriptional
FT                   regulator, NtrC, fis family; SMART: response regulator
FT                   receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54099"
FT                   /db_xref="GOA:D9SHR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR6"
FT                   /inference="protein motif:TFAM:TIGR01818"
FT                   /protein_id="ADL54099.1"
FT                   /translation="MKPVWIIDDDRSIRWVLEKSLARANIEFESFQSADDAQRALSHDM
FT                   PQVVVSDIRMPGISGLDFLQTLHERHPLIPVIIMTAYSDLESAVSAFQGGAFEYLPKPF
FT                   DINHAVDLIRRALEQSRRKSAEIGQIDVVADILGHAPAMQDVFRAIGRLSQSHATVLIN
FT                   GESGTGKELVARALHRHSPRAEKPFIAINTAAIPKDLLESELFGHERGAFTGAAAVRHG
FT                   RFEQAEGGTLFLDEIGDMPSELQTRLLRVLSDGNYYRVGGHQPIKANVRIITATHQNLE
FT                   ERVKLGLFREDLFHRLNVIRLRLPPLRERSEDIPLLAKFFLQKSAQELAVECKQFGEAT
FT                   LQHLSAQDFPGNVRQLENLCHWLTVMTPSQVIEIADLPPEWRENESAVEKSGDWSSVLA
FT                   GQVEAALQRGDESIMDRFVAQFERTLILQALQHTNGRRIEAATLLGIGRNTLTRKIQEL
FT                   GLDEQEA"
FT   gene            63994..64401
FT                   /locus_tag="Galf_0055"
FT   CDS_pept        63994..64401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54100"
FT                   /db_xref="InterPro:IPR009833"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR7"
FT                   /inference="similar to AA sequence:KEGG:Psta_4123"
FT                   /protein_id="ADL54100.1"
FT                   /translation="MESKIVADAARATLDGSIPFSEVVRRLLETGVEYYHVDYVALQKT
FT                   YYSASGEVIKTPIHYDDLPSVASEFNLEKLRAAIFDSQQNGQHYRDFTKRAMNAGVQGY
FT                   IAFLRGKRVTYWGRGGDQHIEWFPGAKPQNA"
FT   gene            64694..65005
FT                   /locus_tag="Galf_0056"
FT   CDS_pept        64694..65005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54101"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR8"
FT                   /inference="similar to AA sequence:KEGG:Daro_0284"
FT                   /protein_id="ADL54101.1"
FT                   /translation="MEIKFSTEIISRILEQSMLYQCACPAQVCKNINEQRALYVYQQNC
FT                   INMTDTDRAVHKCIADAVMQSHAAMEACLEVVLRLEGWDLTTYEMPENLKKMLLKQFE"
FT   gene            complement(65115..66455)
FT                   /locus_tag="Galf_0057"
FT   CDS_pept        complement(65115..66455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0057"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="KEGG: slt:Slit_0052 UDP-N-acetylmuramate; TIGRFAM:
FT                   UDP-N-acetylmuramate; PFAM: Mur ligase middle domain
FT                   protein; cytoplasmic peptidoglycan synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54102"
FT                   /db_xref="GOA:D9SHR9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9SHR9"
FT                   /inference="protein motif:TFAM:TIGR01081"
FT                   /protein_id="ADL54102.1"
FT                   /translation="MSKPTHIHILGICGTFMGGIAAIAKQSGFRVTGCDTNVYPPMSTQ
FT                   LEAQDIELITGFGVEQLELNPDIYVIGNVVTRGNLLMEEILNRNLPYVSGPQWLSDTLL
FT                   RDRWVLGVAGTHGKTTTASMLAWILEHAGLNPGFLIGGVPQNFDISARITESPFFVIEA
FT                   DEYDTAFFDKRSKFVHYHPRTAILNNLEFDHADIFADLFAIETQFHHLVRTVPGNGLVV
FT                   SNGREAALQRVIERGCWTPVEAFGGDTGWNIDTGNQVTLNGVAQGELKWELLGEHNRMN
FT                   ALAALAAARHAGVPVALGLAALSEFKNVKRRMEVKGIVNGITVYDDFAHHPTAIDTTVA
FT                   GLRHKVGAARILAVLEPRSNTMKLGVMKDALPGSLKDADQVFCYSGNLGWDAKSALAVM
FT                   GDKAVVIDDLDTLIDVIAKSAMPGDHILVMSNGGFGGIHDKLLKKLA"
FT   gene            complement(66461..66814)
FT                   /locus_tag="Galf_0058"
FT   CDS_pept        complement(66461..66814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0058"
FT                   /product="protein of unknown function DUF486"
FT                   /note="PFAM: protein of unknown function DUF486; KEGG:
FT                   slt:Slit_0053 protein of unknown function DUF486"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54103"
FT                   /db_xref="GOA:D9SI46"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI46"
FT                   /inference="protein motif:PFAM:PF04342"
FT                   /protein_id="ADL54103.1"
FT                   /translation="MGLISQPLLVTILMLAISNLFMTFAWYGHLKNMSASPWYVAALVS
FT                   WGIALFEYLIQVPANRIGYSELNLGQLKILQEVITLLVFVPFAVLYMNQPLKWDYLYAA
FT                   LCMMGAVYFIFRN"
FT   gene            complement(66814..68442)
FT                   /locus_tag="Galf_0059"
FT   CDS_pept        complement(66814..68442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0059"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rfr:Rfer_2184 putative glutamate
FT                   synthase (NADPH) small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54104"
FT                   /db_xref="GOA:D9SI47"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI47"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADL54104.1"
FT                   /translation="MSNRPFAITLKPGTSLANLTGTWRTERPVYLNRLPPCNNACPAGE
FT                   NIQGWLFHAESGDYEQAWRVLVQDNPLPAVMGRVCYHPCENACNRGQLDSSVGINSVER
FT                   FLGDEAIKQGWKFDAPQAATGKRVLVVGAGPSGLSAAYHLTRAGHCVEIHEAGPQAGGM
FT                   MRFGIPKYRLPRFVLDAEVQRILDLGVTLKLNTRIENIEQSMQDGHFDAAFLAVGAHIA
FT                   KRTYIPSGDAAHIVDAVSVLRSMEGEDKPMLGRRVVVYGGGNTAIDVARTAKRLGATEA
FT                   IIVYRRTREKMPAHDFEVEEALQEGVMIKWLSTIKQAEVGSLTVEKMELDEQGVPQPTG
FT                   EFETMEADSLVLALGQDVDLSLLEGVSGLEIINGTVQVSNNMMTGHPGIFAGGDMVPSE
FT                   RTVTVAVGHGKKAARHIDAWLHGASFTPAPKPEIATFDKLNPWYYSDADKTVRPMLDII
FT                   RRQTSFDEVQGGLNETNALFEARRCLSCGNCFECDNCYGVCPDNAVIKLGPGKGFQFNY
FT                   DYCKGCGLCVAECPCGAIAMVPEET"
FT   gene            complement(68444..69445)
FT                   /locus_tag="Galf_0060"
FT   CDS_pept        complement(68444..69445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0060"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; KEGG: rfr:Rfer_2185 thiamine
FT                   pyrophosphate enzyme-like TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54105"
FT                   /db_xref="GOA:D9SI48"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI48"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADL54105.1"
FT                   /translation="MGFQPVKFYQTGTYTVGNRLLSDTERSVQAGELRSNSINSGHRAC
FT                   QGCGEALGARYAIDAAMAGSNNQLIAVNATGCLEVFSTPYPESSWQVPWIHSLFGNAPA
FT                   VATGVAAAMKVKGRTEVRVVAQGGDGSTTDIGFGCLSGMFERNDDVLYICYDNEAYMNT
FT                   GVQRSSATPPAARTATTMPVGAEPGNLFGQGKNLPEIAMAHGIPYVATATVADLRDLEY
FT                   KVRRAMTIRGARYIHLSVPCPLGWGTASADTIRIARLAKECGLFPVFEAEHGEVTGVSK
FT                   IRHQVAVEDYLKPQKRFAHLFGKTPHPETVARIQAIADRNIRKYGLLEEGGN"
FT   gene            complement(69456..70709)
FT                   /locus_tag="Galf_0061"
FT   CDS_pept        complement(69456..70709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0061"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain-containing protein;
FT                   KEGG: lch:Lcho_2150 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54106"
FT                   /db_xref="GOA:D9SI49"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI49"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADL54106.1"
FT                   /translation="MLKQTEGSKAVAEAIALCRPEVICAYPISPQTHIVEALGESVKSG
FT                   ELTPCEFINVESEFAAMSVAIGASAAGARAYTATASQGLLFMAEAVYNASGLGLPIVMT
FT                   VANRAIGAPINIWNDHSDSLSQRESGWMQLFAETNQEAVDLHIQAFRLAEELSMPIMVC
FT                   MDGFILTHAFERVDIPSQAQVDAYLPPFEPRQVLDPAEPVSIGAMVGPEAFMEVRYLAH
FT                   AKQMQAIERIPQLASEFREIFGRDSGGLIRTYCTEDADTIIIAMGSVLGTIKDTVDEMR
FT                   AEGHKIGVLGIISYRPFPLEQVKAALINCRRFVVLEKSLAVGMGGIVATDVRMAVTGTG
FT                   LKGFTAIAGLGGRPITKASLHKLFREAEAETLPPVTFLDLDWDAVNKQLAREKQTRRSG
FT                   PVAENILHDKGIVSAKFG"
FT   gene            complement(70693..71283)
FT                   /locus_tag="Galf_0062"
FT   CDS_pept        complement(70693..71283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0062"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; KEGG: app:CAP2UW1_2510
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54107"
FT                   /db_xref="GOA:D9SI50"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI50"
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /protein_id="ADL54107.1"
FT                   /translation="MFQIRVHGRGGQGVVTAAEMLSVAAFEEGRHAQAFPSFGSERTGA
FT                   PVVAFCRISDKEIRLREPIMEPDAIIIQDPTLLHQIDVFAGLKPDGYVLLNSHHSIEAL
FT                   GLAELVKGRQPERFCTLPASELGLKHVGRPIPNVPLLAGFAALSGIIRLESVILAINER
FT                   FTGKIAAGNITAATEAYERVQQQMKEQAHAKAD"
FT   gene            complement(71341..71799)
FT                   /locus_tag="Galf_0063"
FT   CDS_pept        complement(71341..71799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0063"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: slt:Slit_0057 peptidylprolyl isomerase; PFAM:
FT                   peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54108"
FT                   /db_xref="GOA:D9SI51"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI51"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADL54108.1"
FT                   /translation="MKLIPKLTIALLLAAAFSTTACSEQAAPPAPKMEKSNMSELIKND
FT                   VKLGTGAEAVAGQNVSVHYTGWLFDEAAADHKGKKFDSSRDRGQPFQFPLGAGHVIKGW
FT                   DVGVAGMKVGGQRTLTIPSDMGYGARGAGGVIPANATLVFDVELLGVN"
FT   sig_peptide     complement(71719..71799)
FT                   /locus_tag="Galf_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.545 at
FT                   residue 27"
FT   gene            complement(71831..72517)
FT                   /locus_tag="Galf_0064"
FT   CDS_pept        complement(71831..72517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0064"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: slt:Slit_0058 peptidylprolyl isomerase; PFAM:
FT                   peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54109"
FT                   /db_xref="GOA:D9SI52"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI52"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADL54109.1"
FT                   /translation="MTTLIKIDTSLGEGAEAQAGQTVIVHYTGWLYDDAAPDNKGSKFD
FT                   SSLDRNDPFDFPLGAGRVIQGWDEGVAGMKEGGTRTLLIPPEMGYGAQGAGDDIPPNAT
FT                   LVFEVKLLKVIRTEIVDNKVGEGDEAQAGQTVTVHYTGWLFDKKSPENKGVKFDSSRDR
FT                   NDPFEFPLGMGRVISGWDTGVAGMKVGGSRTLTIPPEMGYGRRGAGGVIPANATLVFDV
FT                   ELLGLR"
FT   gene            complement(72534..76208)
FT                   /locus_tag="Galf_0065"
FT   CDS_pept        complement(72534..76208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0065"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; KEGG: slt:Slit_0060
FT                   methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   Vitamin B12 dependent methionine synthase activation
FT                   region; dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54110"
FT                   /db_xref="GOA:D9SI53"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI53"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADL54110.1"
FT                   /translation="MTRHLIEDIIQQRILILDGAMGTMIQRYKLNEADYRGERFAQWPQ
FT                   DLKGNNDLLVLTKPEVIRAIHSEYLAAGADIVETNTFGANATTLKAYGMAELNYELNVA
FT                   GARLAREACDAYSTPDKPRFVAGVLGPTDKTATISPDVNDPAARNISFDQLVADYSDAT
FT                   RGLMDGGADTILIETIFDTLNAKAAIFAVQSVFTERGTRLPIMISGTITDASGRTLTGQ
FT                   VTEAFYNSLAHAQPLSIGLNCALGAEELRQYVAELSRVANCYVSAHPNAGLPNPLAETG
FT                   YDDTPENMAGHIKEWAASGFLNIIGGCCGTSPAFIKAIAETVQGIAPRKIPENPVECRL
FT                   SGLEPFNISDSSLFVNVGERANVTGSAKFKRLILEGKYDEALEVAKQQVETGAQVIDVN
FT                   MDEAMLDGEAAMVRFLNLIASEPDISKVPLMIDSSKWSIIEAGLKCVQGKSIVNSISLK
FT                   EGEENFIKYATLVRKYGAAAVVMAFDEAGQADTYARKIEICKRSYDILVNKVGFPPEDI
FT                   IFDPNIFAIATGIEEHNNYAVDFIEACKWIRANLPYAKISGGVSNVSFSFRGNEPVREA
FT                   IHTVFLYHAIGAGMNMGIVNAGQLGVYEEIPRELRDAVEDVVLNRHPDAGEKLVKIAES
FT                   VKGGGKEIIEDLEWRKGTVQERLTHALVRGITTFIVEDTEEARLAAKFPVEVIEDSLMS
FT                   GMNVVGDLFGAGKMFLPQVVKSARVMKQAVAHLIPYIEAEKLRSGDTSTKGKILMATVK
FT                   GDVHDIGKNIVTVVLQCNNFEVVNMGVMVPCQQILDAAREHKVDVIGLSGLITPSLEEM
FT                   AHVAKEMERQGFKIPLLIGGATTSRVHTAVKIEPNYPSGTVIYVTDASRAVGVCSNLLS
FT                   DTLRDDYVASIKADYIEARETHEARQSKAVYVTLEAARAHGMKTDWNAYTPPKPKFTGV
FT                   KELRDYSLSEIAEYIDWTPFFQAWELAGRYPKILQDEVVGEESRKLFADAQAMLKQIID
FT                   GKWLTANAVYGLFPANTINGDDIEIYTDETRSECAMTWHNLRQQTKKPASIPNYCLADY
FT                   IAPKGVADYIGGFAVTTGIGIDARVAEFEAQNDDYNAIMLKALADRLAEAFAELLHARV
FT                   RREFWGYASDEGLDNDALIAEKYRGIRPAPGYPACPEHSEKGPLFAMLDATRRAGISIT
FT                   DSFAMLPTAAVSGFYFSHPEAKYFATGKIDRDQVASYAERKGWDIETAERWLAPVLSY"
FT   gene            complement(76299..76763)
FT                   /locus_tag="Galf_0066"
FT   CDS_pept        complement(76299..76763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pph:Ppha_0844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54111"
FT                   /db_xref="GOA:D9SI54"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI54"
FT                   /inference="similar to AA sequence:KEGG:Ppha_0844"
FT                   /protein_id="ADL54111.1"
FT                   /translation="MFEQKLINSMKNFNQFIHVLLALALGIACIMVIWDFGARALDAWN
FT                   AGNATSGFFHALGSLFILWTLSTLISAEMHYLQTGRTSVRVFVEVAMISVIREMIVQPV
FT                   QVISAPGGSGPIFSPLHYGLLLAALLVIGVVYKLISSTEPVETVEHVTNK"
FT   sig_peptide     complement(76641..76763)
FT                   /locus_tag="Galf_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.645) with cleavage site probability 0.478 at
FT                   residue 41"
FT   gene            complement(76784..78274)
FT                   /locus_tag="Galf_0067"
FT   CDS_pept        complement(76784..78274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0067"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: slt:Slit_0062 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54112"
FT                   /db_xref="GOA:D9SI55"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI55"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADL54112.1"
FT                   /translation="MSLAVLYSRALEGMEADLVTVEVHLANGLPGFTIVGLPETEVKES
FT                   RERVRAALQNCQFDFPARRITVNLAPADLPKESGRYDLPIALGILAATGQIPADKLGLY
FT                   EYAGELALTGEVRPVRGTLAMTCRAVTSGRAFILPEVNAAEAALVEHAVIYPAKTLLQV
FT                   AAHLSGRESIAPFKSQPQTVKPHYPDFSEVKGQEQVKRALEIAAAGGHSVLMIGPPGTG
FT                   KSMLAARFPGILPQMTDKEALESAALQSLGGNFDIANWKTRPYRAPHHTASGVALVGGG
FT                   SNPRPGEISMAMHGVLFLDELPEFERSVLEVLREPLESGHITISRAARHAEFPAQFQLI
FT                   AAMNPCPCGYFGHYNGRCHCTPDQIARYRGKISGPLLDRIDIQIEVPAVPQQDLLKKSA
FT                   GECSSDIQARVEAARQRQIDRQHKPNAQLSVTELDELCTPDAEGQTLLKRAITRLDLSA
FT                   RAYHRVLKMARTIADLAGSDALQTAHIAEAVQYRRMDK"
FT   gene            complement(78276..78518)
FT                   /locus_tag="Galf_0068"
FT   CDS_pept        complement(78276..78518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0068"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   cvi:CV_4001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54113"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI56"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="ADL54113.1"
FT                   /translation="MLNAKIFDDISAKLSQAAESGPAKDIEKNVRALLTQGFSKLDLVT
FT                   REEFDIQSQVLLRTREQLTALEARVAELEAQQPPK"
FT   gene            78835..79650
FT                   /locus_tag="Galf_0069"
FT   CDS_pept        78835..79650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0069"
FT                   /product="Conserved hypothetical protein CHP02001"
FT                   /note="PFAM: Conserved hypothetical protein CHP02001; KEGG:
FT                   slt:Slit_0064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54114"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI57"
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /protein_id="ADL54114.1"
FT                   /translation="MLKSKLLNTLILAAMAVPCVAMAEDAPASPHTVSANVGIVSDYVF
FT                   RGISQTSHNSAIQGGVDYAHASGFYAGVWGSNVSWIYDTAATASGSPSMELDTYLGFKN
FT                   AFAEDFSYDVGFVRYNYLGTYTAAGGYAKADTDEVYGAIGYKWFTAKYSYGLGDFLTVP
FT                   GAKGTNYLELNASVPLADSGFTVTAHVGRQTYKGAGADAAAAITTGAPGTGTPTYSDYK
FT                   VGITKDISGYVLGLAYTSTNVSSFYTTPVATTNSQLGKGTAALTLTHAF"
FT   sig_peptide     78835..78906
FT                   /locus_tag="Galf_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            79697..80035
FT                   /locus_tag="Galf_0070"
FT   CDS_pept        79697..80035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0070"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   slt:Slit_0065 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54115"
FT                   /db_xref="GOA:D9SI58"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI58"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADL54115.1"
FT                   /translation="MKMVTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKLEAAIAADQLDSVLEVIEKAAQTGKIGDGKIFVQEIEQVIRIRT
FT                   GETGSDAL"
FT   gene            80046..81566
FT                   /locus_tag="Galf_0071"
FT   CDS_pept        80046..81566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0071"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: pol:Bpro_0184 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54116"
FT                   /db_xref="GOA:D9SI59"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI59"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADL54116.1"
FT                   /translation="MRKIFASFMLIAALCGLSASGFAEEAASAVVSATEVASAVVSATE
FT                   AAPVMAVVAEAVVEAAPVVAPVPNKGDTSWMLVATLLVIMMSIPGLALFYGGLVRSKNM
FT                   LSILMQVFSIFALITVLWAIYGYSLAFTEGNAFIGGFDRLFLKGIFDPMTGSVANAATF
FT                   SKGVVIPEFVFVAFQATFAAITVALIVGAFAERMKFSAVMLFSGLWFTFAYLPIAHMVW
FT                   FWTGPDAIKDAATLAVETVKAGWLFQKGALDFAGGTVVHINAAVAGLVGAFMVGKRIGY
FT                   GKEPMAPHNLVMTMIGAALLWVGWFGFNAGSALEAGGTATLAFANTLIATAAAVLTWLA
FT                   AEWLLKGKPSLLGAASGAVAGLVAITPACGWVGIGGGLVIGALSGVVCFWGVTGLKKLL
FT                   GADDALDVFGIHGIGGILGALLTGVFNSWSMGGTGIADYANNTIVDTVIADQVWIQAQA
FT                   VLTTVIWSGVVAFVCYKIVDLTIGLRVAAEEEREGLDTSSHGERAYNY"
FT   sig_peptide     80046..80117
FT                   /locus_tag="Galf_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            81892..84042
FT                   /locus_tag="Galf_0072"
FT   CDS_pept        81892..84042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0072"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: slt:Slit_0069 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54117"
FT                   /db_xref="GOA:D9SI60"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI60"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL54117.1"
FT                   /translation="MLKSQQMNLSNSERFWLPYFGKCGRLAMGWACYLNQWRYPILEEI
FT                   FDSIATTRVRILSEWAEQKWSALSGMSAQIAHDWPKFDAELLAENLRLDGDFTELFVIN
FT                   AQAVTLYSSCRSRVGKNDLNAKAVTLGLAGKFLHGPYLDAATGALGASSSRFHDAVTLM
FT                   FYYPLQKDGVLLGAVCGRVPNDVLGDLIQREAGHIFHESGDNYLFMVKAGFDTAIKAGT
FT                   ALSRSRFEDATFSMGDNLKQGVRTDFGVVSVRNHTEFELIFNDPATGQLHPGVRETIRC
FT                   GQNTFVTYPGYSDYRHIPVIGRGITFTLPGSIDSWGMMCEADLEEVYRFRSLNFRMMSV
FT                   YLAMWVAMMAVISGIALAFKPDAQVMASICCGLFLTGGLVLHRFVAKPVGQRLRSMVSV
FT                   VRNVAEGHGNLSQRLDRGDASRDEAGVLSQWINSLIDNIDRTVGNVRRGTDGMVNNQAH
FT                   MDVRNKEATAATGEVLIAVQDILQALEKQMSDIDLANLTTSEMRQAMQLATDRARAQVS
FT                   MVQSRTQDIRESIKASSLRIRSLGESTEKIGEIAEVIKGIADQTNLLALNAAIEAARAG
FT                   EFGRGFSVVADEVRKLAERTSSATHEINLMIASVQDKARDAVAIMEHGATGMEEGLRLA
FT                   EASAADNSGSAEIIERMFATISQISMSAAESGSKVQGVARTADSMSAAVGELNFAIASN
FT                   REGTQKLRLLVNQFQITDVHNQ"
FT   gene            84049..85278
FT                   /locus_tag="Galf_0073"
FT   CDS_pept        84049..85278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0073"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: alv:Alvin_0883 diguanylate phosphodiesterase;
FT                   PFAM: EAL domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54118"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI61"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADL54118.1"
FT                   /translation="MKTHNFNAVNQRVSGNTGQFRDYSIGSAFQPIFSLSHRNPVGYEA
FT                   LCRAKKKDGLPVSPLALFGQVKDESDNVLLDRLCRAVHVQNFSRFSDTSWIFLNVNPLV
FT                   TVLGKSYGSFFKEMLDQNGISPSQVVVEILEKGIYDESILSAAINYYKNLGCLVAIDDF
FT                   GASHSNFDRIWNIQPDIVKFDRSIIVQAESSVVVRKALPSLVGLIQELGCIALMEGVET
FT                   EQQALIAIDSNVDLVQGYYFGFPREQLVETDDPNNMLLKLRGKHIEFSASIRTRYRDAV
FT                   DQCLIEFKAILHTLTSGCAPQMLACEKLLALPNVMRVYFLDEAGYQIGDNIQKQQSEYI
FT                   DPRYKPLAEAAEANWSRRYYFRQAVLNPGEIQITRPYRSLTGKSQCITISALVNTPCGM
FT                   LVACLDLDWS"
FT   gene            85322..86851
FT                   /locus_tag="Galf_0074"
FT   CDS_pept        85322..86851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0074"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: alv:Alvin_2395 PAS/PAC sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54119"
FT                   /db_xref="GOA:D9SI62"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI62"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL54119.1"
FT                   /translation="MERLVNLKLRQRFAILIFCVVAGFLLYGLWSFKTLGELKVNGPIY
FT                   KEIAQGKDFVADILPPPGYIIESYLVSLQLVECEPSEQAHLIERLLNLQREYVNRHEFW
FT                   QKHRLGDELTTTLLAGAHEPAMRFYAVVSDEFVPALLHENRPAVVAAMKKMKSSYALHR
FT                   EAIDRAVKIASHRVVLDEARASQQINFATYLMLFILVCTVSLTVLLAYLISRSVIGPLQ
FT                   SLQQAMKDITNSGDFSRRLVVSSDDEAGDTARIFNELIESVQLAHVAAEAASRAKSDFL
FT                   ANMSHEIRTPMNSIIGFSELALDNPDPKDQQIFLSQILESSNMLLGILNDILDLSKIES
FT                   GRMMLDVASFDFDELLGSIERSFALRAQEAGLGFTLLRLGESGRVFLGDVLRLRQILTI
FT                   LLGNAVKFTSQGETSLEVKQIRVPDGKVRLEFSIQDTGIGMSAETIKNLFQPFVQADNS
FT                   ITRRFGGTGLGLVIARNLAQMMHGRITVESQLGVGSVFRFQVTLLDGLSVS"
FT   gene            86944..89148
FT                   /locus_tag="Galf_0075"
FT   CDS_pept        86944..89148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0075"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: net:Neut_1169 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54120"
FT                   /db_xref="GOA:D9SI63"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI63"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL54120.1"
FT                   /translation="MNNLSMKSKLFLLIGIFSSGFVLSGLFLLLTLNQVKVNGPIYQGI
FT                   VQQKDLLADILPPPEYLIESYLVTQQMFVADKAGLPTLIDKSRALLKDFDDRSQYWQQG
FT                   LPDGDIKALIGGDVYKSGKDFLTLQQSNLIPALMGGDLKTADSLRPQLEQKYLQHRMAI
FT                   DKLVGLASAQAGIEEAQAKELIAFKTIVATAIILGFLLLGIVISLRITKSLLKQLGGEP
FT                   AYAVEVVEKIASGDLSVELVVEAGDTSSLLYSMKMMQDSLRNIVAEIKNIVEAAAQRGD
FT                   FSVKMTLNGKSGYTEELSSLLNDLSDVSETVLNDFMRVTTALASGDLSQTITRDYPGVF
FT                   GQTKNAVNSTVDALTKVVAEIQQVVEAAAAQGDFSVKMQMQGKLGFVRTLAELLNQLST
FT                   VTDTGLRDVMRVSQALAEGDLTHKISADYPGLFGQTKSSVNATVENLKTLVGDIKVTVD
FT                   SIETAAKEIASGNTDLSQRTEEQASSLEKTASSMEQITSTVKQNADNARQANQLALSAS
FT                   TIAIKGGGVVNDVVDTMSAINASSRKIVDIISVIDGIAFQTNILALNAAVEAARAGEQG
FT                   RGFAVVATEVRTLAQRSAAAAKEIKELISDSVDKVETGTKLVDNAGKTMQEVVTAVKRV
FT                   TDIMAEISAASTEQSQGIEQVNQAITQMDQVTQQNAALVEEAAAAAESLEEEANSLVRS
FT                   VSVFKMESQRAKIPASTGLAKPANKVAKVVDKAGDEWQEF"
FT   gene            complement(89196..92570)
FT                   /locus_tag="Galf_0076"
FT   CDS_pept        complement(89196..92570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0076"
FT                   /product="Protein of unknown function DUF2126"
FT                   /note="KEGG: mei:Msip34_0342 transglutaminase domain
FT                   protein; PFAM: Protein of unknown function DUF2126;
FT                   transglutaminase domain protein; transglutaminase
FT                   domain-containing protein; SMART: transglutaminase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54121"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI64"
FT                   /inference="protein motif:PFAM:PF09899"
FT                   /protein_id="ADL54121.1"
FT                   /translation="MTIRVALNHQTSYVFDRAVKLWPHEIRLRPAAHCRTPILSYSLNV
FT                   EPAGHFLNWQQDPFGNWVARLVFPDKAESLKITVDLVADMTVINPFDFFMDEYAECFPF
FT                   AYPESLKRELGPYLEADLLTPLLSDWLARTRIELLAKPLRTIDMLVGINQRLKDDINYI
FT                   VRLEAGVQTPEQTLELKLGSCRDSAWLLVQTLRHLGLAARFASGYLIQLKADVKALDGP
FT                   SGALHDFTDLHAWAEVYIPGAGWIGLDATSGLLAGEGHIPLACTAMPSSAAPVIGGTEV
FT                   CESQFEFSMSVTRIHEDPRVTRPYSEAQWQAILDLGHQVDVELDKNDVRLTMGGEPTFV
FT                   SIDDMEGPEWNFTALSDTKLTLAGELLTRMQMQYAPGALLHFGQGKWYPGEPLPRWALG
FT                   CYWRTDGTPLWNDRSLLVSSDGEGTRETADAKRFMQRLTQELALDERFVITAFEDVAQV
FT                   INDELRWPDNLDPLTADLKNSDERRRLARLLEQGLGEPAGYVLPLKALPPNKPVLAKKG
FT                   LISAGFRSSPWPLRREHLYLIAGDSPLGLRLPLDSLPWLPPEDQDTDSGRDPFDCTVDA
FT                   PDTPPEKKKFQTLKARYDPREIIHTALCCEVRAGVLCLFLPPVPILEDFITLIRAIEAT
FT                   ANALKLPVRLEGYTPPADPRVKAFRITPDPGVIEVNIHPCSSWAQLVENTQILYEAARL
FT                   TRLGAEKFMLDGRHTGTGGGNHVTLGAATPADSPCLRRPDILASLITYWQHHPALSYLF
FT                   SGMFIGPTSQAPRVDEARHESLYELEIAFQQMSEHLKPGAESEQPWLVDRLLRNLLVDL
FT                   SGNTHRAEFCIDKLYSPDSATGRLGLLEFRGFEMPPHAQMSLLQMLLLRALVVRFWQKP
FT                   YQGSLNRWGTELHDRYMLPHFVAQDMKDVVLDLQRAGYAFEFEWFTPFLEFRFPRFGTV
FT                   VYHGIEIELRQAIEPWHVLGEEVAAGGTARYVDSSIERMQVKVRNMNDNRHILTCNGRP
FT                   LPMTSTGTRGEFVAAVRYRAWAPPSGLHPTIGVQAPLVFDLVDSWSGRSIGGCTYHVVH
FT                   PGGRSYDTFPVNANEAEARRVARFWNHGHTPGLLHVRREGRNPDYPLTLDLRRAPEPAM
FT                   EGMPESPSELMQQNQQQ"
FT   gene            complement(92599..93324)
FT                   /locus_tag="Galf_0077"
FT   CDS_pept        complement(92599..93324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0077"
FT                   /product="20S proteasome, A and B subunits"
FT                   /note="KEGG: hna:Hneap_1310 20S proteasome, A and B
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54122"
FT                   /db_xref="GOA:D9SI65"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI65"
FT                   /inference="similar to AA sequence:KEGG:Hneap_1310"
FT                   /protein_id="ADL54122.1"
FT                   /translation="MTYCVATMIDAGIVFASDSRTNAGVDNISTFRKMKTFERKGDRVL
FT                   VVVNSGNLAITQATLNYLEQEIRHSTEANLMSVCSMYEVAELIGSALREVRHRDGPYLA
FT                   ENNVDCSANFIVGGQITGEPQRLFLIYAEGNFIEATPETPYFQIGEVKYGKPIIDRIIR
FT                   ADTSMNDAIKSVLVSFDSTMRSNLSVGLPIDMACYERDTLQLNHVHRFDDQNDYMQRLH
FT                   KSWGDGVRQAFAQLPNFDY"
FT   gene            complement(93344..94318)
FT                   /locus_tag="Galf_0078"
FT   CDS_pept        complement(93344..94318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0078"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   hna:Hneap_1311 protein of unknown function DUF403"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54123"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI66"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ADL54123.1"
FT                   /translation="MLSSTADHLFWMARSMERAENTARMLDVTYRMSLLKRALIEPHHE
FT                   WRAMLSISGLHEDFEARYDMPCAENVLHFMALDEKNPGSIYNSIFKARENARAVRGSIT
FT                   SEMWETLNSTWLEMRRIQGDGIAADGVSRFFDWVKERSHLSRGIAHGTMLRDNTFRFIR
FT                   LGNFLERADNTARILDVKYHILLPSPKDIGGAADYYQWSSVLRSVSAFESYRRVYRDQI
FT                   TPKRVAELLVLRPDMARSLITCVDEVNRLLHEIDGPRANELLRRCGLLRTSLHAETIDG
FT                   IFDYGLHEYLSEFLEQIYELGNLINTAYFWSTDELSVPDIIGH"
FT   gene            complement(94320..95750)
FT                   /locus_tag="Galf_0079"
FT   CDS_pept        complement(94320..95750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0079"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: app:CAP2UW1_0608 protein of
FT                   unknown function DUF404"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54124"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI67"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADL54124.1"
FT                   /translation="MKTAYNEMYATDGSVRENYRNYADWLSATPEEVIVRKREAADIAF
FT                   HRAGITFAVYGETNSQERLIPFDIVPRIIPAREWTRLEQGLRQRVRALNAFLHDIYHGQ
FT                   EILKAGRIPARQVLGNSQFRQEMVGVDVPENIYAHIAGVDLVRADHGSQLGEYYVLEDN
FT                   LRTPSGVSYMLENRKMMMRLFPDLFSGQKIAPVEHYPDLLLNNLRSVAPEGVTNPNVVV
FT                   LTPGQYNSAYFEHAFLAQQMGVELVDGNDLFVKNETVYMRTTEGPLRVDVIYRRIDDDF
FT                   LDPLTFNKTSMLGVPGLFSAYRAGNVTLANAVGTGIADDKAIYIHVPEMIRFYCSEEPI
FT                   LANVPTWELSKPDDQAYVLAHLPELVVKEVHGSGGYGMLVGPTSTKNEINLFRDKILAN
FT                   PDHYIAQPTLALSTCPTFVESGVAPRHIDLRPYVLSGKDITMVPGGLTRVALKEGSLVV
FT                   NSSQGGGTKDTWVLEGDN"
FT   gene            complement(95920..96687)
FT                   /locus_tag="Galf_0080"
FT   CDS_pept        complement(95920..96687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_2903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54125"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI68"
FT                   /inference="similar to AA sequence:KEGG:AFE_2903"
FT                   /protein_id="ADL54125.1"
FT                   /translation="MTYCLAINTETGFVLCSDSRTNAGFDNVSSYSKMHTFAWPGNRVF
FT                   GLLSAGNLATTQLVIKRLQADLDSGTIPNLLSVSNMQQAVDYVATVSTHVQNLHVVRDS
FT                   GNVNFEASFILAGQIGNARHETLMIYPQGNYIHESGEHPFLQIGEIKYGKPILDRVINR
FT                   TISLEAAARCALVSMNSTVRSNLTVAPPIELLVYNKDSLRITHQLCLNESDPFSKELSQ
FT                   AWNQGLVIALQNLPKFYWETPGLPEIAEFQSAK"
FT   gene            96974..98245
FT                   /locus_tag="Galf_0081"
FT   CDS_pept        96974..98245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hna:Hneap_1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54126"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI69"
FT                   /inference="similar to AA sequence:KEGG:Hneap_1308"
FT                   /protein_id="ADL54126.1"
FT                   /translation="MSQPLPDSTEIYYAEIMKNQTKLKSTEFLRNGDKVNSEFFEIYLK
FT                   RLLDARDACGLTEMIGEIEALMITVEPGNALEYIAELALMTPYHYLVTLESPRHWTHIL
FT                   RIDMDSPDILLREVKNPEYYDIFRSLNDLHPVGSKRPHSRYLGEILRVTDRESVLALQC
FT                   EREFRFFSPAALSALDLPSNVSISKPSPYTQNVLGYMERAIGEPRVYHPLGKCSILPKI
FT                   QKAYENAKLQQQSLNIADLILPVDHLATRVYCQNREAALLEYLALSSYYYWGSYDIVDQ
FT                   NSSTNVCKSVRPVPESLSPAKVFTANNLPYCVNHLDRLPSPTENFVRNYGARLHHIALS
FT                   VKDGEREGKENIEFLVDAIAGQGKGFLLEVVGSREEGLKQVFSNASQFSALIIEYVQRY
FT                   GDFQGFFTRENVALLTAAAGAEVS"
FT   gene            98306..99697
FT                   /locus_tag="Galf_0082"
FT   CDS_pept        98306..99697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0082"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: slt:Slit_2545
FT                   FAD-dependent pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54127"
FT                   /db_xref="GOA:D9SI70"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI70"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADL54127.1"
FT                   /translation="MNYDVIIIGSGPAGQHAAWQAARMGKRAAIIERKPNLGGAGLQTG
FT                   TIPSKAMREVAYQLTRSGGMRQAHDGRSRHGLLADAVRRKEGVIAQQESVILQRILRSG
FT                   VALIPGEACFVDAHTIAVTDQAGNTRQITADVIVLAAGSRPRRPADVPFNKKSVLDSTS
FT                   ILNLRHLPDSLLVVGGGVIACEFVSIFAALGVAVSVVDSHAQLLEYLSEDVVAVLADSF
FT                   LDMGVKFYMQERVAQISCDDSGTLTTLVSGAQIRADAVLYAQGREPNSEGLQVARAGIA
FT                   AKDGWIAVNQHFQTSVPNIFAVGDLIGRPALASTGMEQGRAAVLYAFGGEAHVTADNLP
FT                   MAVYTIPEISYVGKTEREVQQENIPYLIGRAYFKDSARGQIIGDAQGLLKLIIDTRNEK
FT                   LLGVHIVGEQASELVHIGQLVMNLNGTVRDLVANVFNYPTLAECYKLAALDCTHQLEQR
FT                   KLTGV"
FT   gene            complement(99752..101023)
FT                   /locus_tag="Galf_0083"
FT   CDS_pept        complement(99752..101023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0083"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: slt:Slit_2159 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54128"
FT                   /db_xref="GOA:D9SI71"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI71"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL54128.1"
FT                   /translation="MPELNDQHYLQAVTELGNTRMIVADRDIYSQNRIKLIASGMRINS
FT                   QLYDRLIKHKLLELDKTLSIDNMLNADRIRDDVASLLQENAKLAKMQAIIGKNFLYSRV
FT                   LAIQLPSPLAFKLTVARDKYNHIYRHSLMLMIIVVYLAHCNGMNSAEQECAATAALFHD
FT                   IGLLHIDPKLLAPSHVMSDTERHHLYSHPLTAYLLLCEFPELPRCIAEAVLVHHERMDG
FT                   SGYPRGLRGDKISRYGQILAVAEIAAKAFDSNHPKVSWKNLEVMLKLNFRQYGQGLIGH
FT                   LNIFRENDAPTALSDNMSHLITKVNLIAQLFENFNQHANAISCDQMFDLAKTRMVALRL
FT                   KLLEAGFDPHDPARLIQIFTDDLESRSDYSPLLNEALWQFKALLREISRRWPEVSVDEA
FT                   QPKRAENEWLNNMKRSLLSADINK"
FT   gene            complement(101236..102600)
FT                   /locus_tag="Galf_0084"
FT   CDS_pept        complement(101236..102600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0084"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; CBS domain containing protein; KEGG:
FT                   tbd:Tbd_1953 diguanylate cyclase; SMART: GGDEF domain
FT                   containing protein; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54129"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI72"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54129.1"
FT                   /translation="MNANTKLTMPKTTTFFPKAGEITHHDVVLALGAATIDEAVALMEA
FT                   NNLSDVIYSVGQAHAIFTVEALMIYRHQGRNMSASLSDLTHHQLIYVNEDDNILNLLSI
FT                   FEDDRCRYLGVKNAAGDLGGIISYTDVLASVDPVVMMEHKTLADVLGTSRVEMVNASTK
FT                   TQAVLEQLIYAEDAMLIVENRKLIGIVTAKDVIKMICDCVDMSLPIRNYMTQHVKTINQ
FT                   RATIKAAIEHLKVNHFKRAIVVDDHNDVVGRITQRELIGITYGRWAELMKLHAHELGEL
FT                   VQVLESKNIQLQEESVTDPLTGAGNRRLFNQVTEAEIGRFYRHQMATFSVLMLDIDFFK
FT                   KINDVFGHPFGDEVLKTLSNRVKRRLRTSDVFARWGGEEFVVLLPTADINAASVLAERI
FT                   RAEIADSPVFEHQVTVSIGVAEYQRGESQEALLQRVDIALYEAKNSGRNKVVKAE"
FT   gene            complement(102624..103868)
FT                   /locus_tag="Galf_0085"
FT   CDS_pept        complement(102624..103868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0085"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: slt:Slit_2270 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54130"
FT                   /db_xref="GOA:D9SI73"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI73"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL54130.1"
FT                   /translation="MSKFNINLHEAIYSLSDALDLVGVTHIHHGKHVAYMAAECGKGMG
FT                   WSGQRMKELFKAAMLHDCGVSKTTVHSRLAQFEWEKENDHCLIGASLLFTCPLMANLAP
FT                   IVRHHHTHWSELKEMDLPLEVKLSANCIYMVDRVDVLALGFLVDQSNLLLGSENIRKKI
FT                   LDKRGDWFCPELVDAFMDISRSEAFWLSLENEHVHGYLSSWLTETTIQEMDFQDLRSIV
FT                   SIFSHVVDAKSSFTKEHSDGVARLSRCIGQLLSLSERTCDMLELAGLLHDIGKLRQPDA
FT                   LLNNPGKLSAEETAQMHRHSFDTYTIIKNIHGLEEISLWAAQHHERVDGTGYPYHLGDG
FT                   GVSLEARIVAVADVFQALAQERPYRGALPPNEIVKILNGMVEDGKLDRTVVMHVDQNLA
FT                   ICWNAAVGALDHPHT"
FT   gene            complement(103939..105060)
FT                   /locus_tag="Galf_0086"
FT   CDS_pept        complement(103939..105060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0086"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: slo:Shew_2713 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54131"
FT                   /db_xref="GOA:D9SI74"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI74"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL54131.1"
FT                   /translation="MQEFEHQLQLSDLDTHHTLSKKISYIHDIVCQNYPHIDRLAIAKY
FT                   DRHDDILRTYVGSRKGNNPLTLYEAKLSEVPSLLKLARNRETRIINDLRVFPDSKSTHS
FT                   RRILDRGFRSSYTIPLYNDGQFIGMLFFNSNQCDAFNESNLTYLDMIAHLLTSLLATEL
FT                   NQFITLYGAMKTATQFTHHRDPETGMHLERMARYSRLIAFTLGAAHSIDDEFVERILRH
FT                   APLHDVGKISIPDRILLKPGPLTIEEFSEMKTHTTKGRKIIDAMLLNFNIKCVNDIEMI
FT                   RNIVAYHHESMDGNGYPEGLAGKNIPLEARIVAVADVFDALTSVRPYKAAWSNAQAFAE
FT                   LERMSHFKLDPDCVAALLGCQGEILKIQSDFAD"
FT   gene            105283..106056
FT                   /locus_tag="Galf_0087"
FT   CDS_pept        105283..106056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0087"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: rpt:Rpal_3839 two component transcriptional
FT                   regulator, LuxR family; PFAM: regulatory protein LuxR;
FT                   SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54132"
FT                   /db_xref="GOA:D9SI75"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI75"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADL54132.1"
FT                   /translation="MTINFTGHAEIDQQHELLESTVGQLALFCSEAKHNQDATCDGCNA
FT                   FKQKHCRVTLVLIASQLAGFLTGHAAYEEKMMELLPDTPICSQHIKAHKSAHQGIAKQL
FT                   KKLSLLVANENPREVSTRMRRIVGDWLGDHSTSFDTRLVRLGKFDSSKIDFDGELVAML
FT                   DEYVFPSRPTMSKASLKIGMALEGEKLEARGRFESLSPAQRQVFWLVAGGKTNREIGMV
FT                   LSISINTVKTHRAAIFHKMDVKSVLELVKKVDVLR"
FT   gene            106669..107136
FT                   /locus_tag="Galf_0088"
FT   CDS_pept        106669..107136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0088"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: tbd:Tbd_0008 rhodanese-like protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54133"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI76"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL54133.1"
FT                   /translation="MDLNAGSFVRKTGITLTSAAVLLFSSAVFAADTPASLKGATVVDA
FT                   VKAKSLVDSGVKIIDARVANEYAEAHIKGALSVPYKEKSAKSADFDVTQDSVDMSKLPV
FT                   DKNAGIIFYCNGAECWKGYKEATVAVKAGYKAVYWLRLGIPDWKAKGYPIE"
FT   sig_peptide     106669..106761
FT                   /locus_tag="Galf_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            107143..107235
FT                   /locus_tag="Galf_0089"
FT   CDS_pept        107143..107235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54134"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54134.1"
FT                   /translation="MLLATSFSVASLLHELLIGKFLLIIKSLCT"
FT   gene            107245..108870
FT                   /locus_tag="Galf_0090"
FT   CDS_pept        107245..108870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0090"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: gsu:GSU2942 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54135"
FT                   /db_xref="GOA:D9SI78"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI78"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL54135.1"
FT                   /translation="MNPNTLKFKLIAGFVLAVFSSLVLMIVDVYSVTKSNTALQYVYAN
FT                   QMQPTSALQDMDSSIKEIRFRMAGVLLDQMPAVGSRIHLKEVRGRIIDDWTAFKRGTKD
FT                   NAFSDDAKKQIEKIDKQIVLLPAFLDKLNEAYANEQKTLITPLLEDEWPSFHAGLIKPI
FT                   SLLLPEQQLAVKQTYEKSKADGNRLVIVGIAIFSISLLLLTLFGWRVLASINRGFNALQ
FT                   SAFSQIAQGNLLIHIGYDSQDEFGQMAKSLEATASRLQQIVASVKSAAESAVQHSASLS
FT                   EQVEVLIASDKQFSAKVTTVAANMEEITFANSEVAVMANSAADAVNRNEELARSGNANV
FT                   TENMTVIGNVVNIVNDSVSIVGQLNTSIQKIGQIAIVIKEIADQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRKLAERTSSSTQEISGVINSIRTETDSAVVAMNNIESEVKKGVHL
FT                   SEMTGEVLQKIVAAASNATQSVGNIVSSTKDQASVTENVAHNLQDISAVSEQNESSIQH
FT                   VGRMADEVAKIAAELQDIVEQFKV"
FT   gene            complement(109033..110115)
FT                   /locus_tag="Galf_0091"
FT   CDS_pept        complement(109033..110115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0091"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   slt:Slit_0662 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54136"
FT                   /db_xref="GOA:D9SI79"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI79"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADL54136.1"
FT                   /translation="MTHLFEPLKLRNLTLKNRIGIPPMCQYSAQDGIASDWHFVHYGSL
FT                   AAGGAALMIVEATAVSPEGRISPGDLGLWDDKQIEPLARIAQFSKTQGCVPALQLAHAG
FT                   RKASVTLGWQAQHTLTEDEGGWPVIAPSPVSFGDGYAIPCELDETGINQVIEQFVAAAQ
FT                   RALAAGFEAVEIHAAHGYLLHQFLSPLSNLRTDRYGGSFENRSRLVREIVSAVRLVWPD
FT                   HLPLLVRLSATDWMEGGWNADETVALCQQLKTLGVDLIDVSTAGLIPAAIVPAAAGFQV
FT                   EFAARVRNEAFIPSAAVGLITSPEQADQIIRTGRADLVLLGREMLRNHQWPLNAATALG
FT                   QTISWPVQYLRAAPPGTMAR"
FT   gene            110272..110943
FT                   /locus_tag="Galf_0092"
FT   CDS_pept        110272..110943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0092"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: slt:Slit_1191 transcriptional regulator, GntR
FT                   family; PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: GntR domain protein; regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54137"
FT                   /db_xref="GOA:D9SI80"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI80"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADL54137.1"
FT                   /translation="MLPNTPQQGTLADIASHRLAHSIVTGEFAQGQKLNEAELAERFGM
FT                   GRGPLREALRHLEGMRLVKRIPNAGARVVVLDYKTMSDLYAVREALEGMACRLAATKMT
FT                   TQEIEQLSRLLDTHETQIKQEGGGIYAQSEGDLDFHYQIVRGSRNEMLMDMLGSEQYQL
FT                   QRMCRFRTSRNAQRTYPALQQHRQIVEALAQRDPELAEMLMRRHIQGAWRSISETIAKE
FT                   E"
FT   gene            110946..111833
FT                   /locus_tag="Galf_0093"
FT   CDS_pept        110946..111833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0093"
FT                   /product="methylisocitrate lyase"
FT                   /note="KEGG: slt:Slit_1190 methylisocitrate lyase; TIGRFAM:
FT                   methylisocitrate lyase; PFAM: isocitrate lyase and
FT                   phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54138"
FT                   /db_xref="GOA:D9SI81"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI81"
FT                   /inference="protein motif:TFAM:TIGR02317"
FT                   /protein_id="ADL54138.1"
FT                   /translation="MTHPTPGQKFRLAVEQNQPLQVVGAVTAYCAILAEKTGHKALYLS
FT                   GGGVAASSLGIPDLGITTLHDVCEDARRITAVSSLPLLVDIDTGWGGSFNIARATREIA
FT                   QAGAAGFHIEDQVMQKRCGHRPNKAIVSQAEMVDRIKAAVDARVDSSFVIMARTDALAV
FT                   EGMSSAIERAQACVEAGADMIFPEAMITLEQYAEFTRVVSVPVLANITEFGATPLYTTE
FT                   QLASVGIKLVLYPLSAFRAMSQAALNVYQHILADGTQAQVIDKMQPRMELYDYLGYHAY
FT                   EQKLDRLFAEQGAE"
FT   gene            111854..113002
FT                   /locus_tag="Galf_0094"
FT   CDS_pept        111854..113002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0094"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.5"
FT                   /note="TIGRFAM: 2-methylcitrate synthase/citrate synthase
FT                   II; KEGG: slt:Slit_1189 2-methylcitrate synthase/citrate
FT                   synthase II; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54139"
FT                   /db_xref="GOA:D9SI82"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI82"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ADL54139.1"
FT                   /translation="MAEDTTLPKPKKSVALSGTVAGNTAICTVGRTGNDLHYRGYDILD
FT                   FAEKAEFEEIAHLLIHGNLPDAAQLAAYKAKLKSLRGLPDAVKQVLEAIPGNAHPMDVM
FT                   RTGCSVLGTCEQEPQAHSEADTKELIDRQLACFGSMLLYWHHFTTSGKRIDVETDDDTI
FT                   GAHILHLLHGKPAQASWVRAMHTSLILYAEHEFNASTFTARVIAGTNSDLYSCITGAIG
FT                   ALRGPKHGGANEEAFRIQNRYKDADAAEVDIRERVARKEIVIGFGHPVYTIADPRNEVI
FT                   KRVAKQLADEAGDTRLYDIAARLESVMWETKRMFPNLDWFSAVSYHLMGVPTMMFTPLF
FT                   VISRVTGWGAHVMEQRIDGKIIRPSANYVGPENLAWTPIEKR"
FT   gene            113127..115733
FT                   /locus_tag="Galf_0095"
FT   CDS_pept        113127..115733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0095"
FT                   /product="2-methylisocitrate dehydratase, Fe/S-dependent"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: 2-methylisocitrate dehydratase,
FT                   Fe/S-dependent; KEGG: psa:PST_2036 aconitate hydratase;
FT                   PFAM: aconitate hydratase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54140"
FT                   /db_xref="GOA:D9SI83"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI83"
FT                   /inference="protein motif:TFAM:TIGR02333"
FT                   /protein_id="ADL54140.1"
FT                   /translation="MNTQYRKPLAGSRLDYFDTREAVDAIESGAYAKLPYTSKVLAEQL
FT                   VRRCEPEALTDALKQLIERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIADQGGD
FT                   PSLVNPVVPTQLIVDHSLSVEAAGFDPDAFRKNREIEDRRNEDRFHFIEWTKTAFKNVD
FT                   VIPAGNGIMHQINLEKMSPVIQARDGVAFPDTCVGTDSHTPHVDSLGVLAIGVGGLEAE
FT                   TVMLGLPSMMRLPDIAGVKLTGQRQPGITATDIVLALTEFLRRERVVGAYVEFFGAGAD
FT                   SLTIGDRATISNMCPEFGATAAMFYIDAQTITYLKLTGREPEQVALVENYARTTGLWAD
FT                   QMVAAEYERELEFDLSTVVRNMAGPSNPHRRLPTSALHERGISDEAKLDAGRASEAQGL
FT                   MPDGAVIIAAITSCTNTSNPRNVVAAALLAKKANELGLLRKPWVKTSFAPGSKVAELYL
FT                   KEAGLLSELEKLGFGIVGFACTTCNGMSGALDPKIQQEIIDRDLYATAVLSGNRNFDGR
FT                   IHPYAKQAFLASPPLVVAYAIAGTIRLDIEQDALGMDKSGKPVMLKDIWPSDDAIDAIV
FT                   ASCVKPEQFRQIYIPMFDLGKIEVAKSPLYDWRPMSTYIRRPPYWEGALAGVRTLKGMR
FT                   PLAVLPDNITTDHLSPSNAIMANSASGEYLAKMGVPEEDFNSYATHRGDHLTAQRATFA
FT                   NPQLINEMAVVNGEVKQGSLARVEPDGRVMRMWEAIETYMDRRQNLIIIAGADYGQGSS
FT                   RDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKAGDTRKTYAIDGTETYDVE
FT                   GDIAPRAELVVVMNRANGVSVRIPVTCRLDTAAEVRVYNAGGVLQCFAQDFLKGAA"
FT   gene            115733..116914
FT                   /locus_tag="Galf_0096"
FT   CDS_pept        115733..116914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0096"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="KEGG: pap:PSPA7_4725 hypothetical protein; TIGRFAM:
FT                   AcnD-accessory protein PrpF; PFAM: protein of unknown
FT                   function DUF453"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54141"
FT                   /db_xref="GOA:D9SI84"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI84"
FT                   /inference="protein motif:TFAM:TIGR02334"
FT                   /protein_id="ADL54141.1"
FT                   /translation="MVQPQIRIPATYLRGGTSKGVFFRLEDLPQAAQVPGRARDRLFQR
FT                   VIGSPDPYAAQIDGMGGATSSTSKCVILSKSTRPGHDVDYLYGQISIDKDFVDWSGNCG
FT                   NLSTGAGAFAIHAGYIDAARLAGEGVCTVRIWQANINKTIIAHVPIANGQVQETGDFEL
FT                   DGVTFPAAEIVLEFMDPSDESDGGSLFPTGNLVDELEVPGVGTFKATMITAGIPTVFVN
FT                   AADIGYTGTELREAINTDPAALARFEKIRVAGALRMGLIKTPEEAATRQHTPKIAFIAP
FT                   PVDHVSSSGKPISASEVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGG
FT                   DRRSVTFGHPSGTLKVGAAARQNGGDWKVEKVTMSRSARVLMEGWVRIPGDSF"
FT   gene            116994..118880
FT                   /locus_tag="Galf_0097"
FT   CDS_pept        116994..118880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0097"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   slt:Slit_1187 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54142"
FT                   /db_xref="GOA:D9SI85"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI85"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADL54142.1"
FT                   /translation="MSYQTEYDRSMNDPEGFWRKQAEALEWFKFPQQIVKTEADGQGYW
FT                   FADGQMNTAYMALDHHVNTGRGDQLALIFDSPVTHTKATYTYSQLTDAVALTAGMLAGL
FT                   GVVKGDRVIIYMPMIPEAVIAMLAVARLGAIHSVVFGGFAPPELAVRIDDATPKVIMSA
FT                   SCGIEIKRTVEYKPLLDRAISLAVHKPESCVIYQRPQCIATMTERDYDWSTLLAGATPV
FT                   GCTPVLGSDPLYILYTSGTTGKPKGVVRENGGHAVALKYSMSAIYNVNPGDVFWASSDV
FT                   GWVVGHSYIVYAPLLQGCTTVVYEGKPIMTPDAGALWRVCAEYGVKALFTAPTAFRAVK
FT                   KEDPDALLMQNYDLSQLQTIFSAGERLDAPTETWLGEHSGKPVIDHWWQTETGWAITAN
FT                   LQGVEPMPVKLGSSTKPVPGFNVQILDEHGEVQPAGTQGYIALKLPLPPSCLNRVWGDD
FT                   NKFRDSYLAFLPGYYTSGDGGYIDEEGYVFVMGRVDDVINVAGHRLSTGEIEEVIASHP
FT                   DVAECAVIARDDEIKGQTPMALVVLKTGSAISEAELHKQLVARIRETIGAITCYKDTVV
FT                   LARLPKTRSGKTLRKTLCNIVNGREYSVPSTIDDTAVIPEIIEVLRSRQIVI"
FT   gene            118911..120425
FT                   /locus_tag="Galf_0098"
FT   CDS_pept        118911..120425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0098"
FT                   /product="malate/quinone oxidoreductase"
FT                   /note="TIGRFAM: malate/quinone oxidoreductase; KEGG:
FT                   slt:Slit_0446 malate/quinone oxidoreductase; PFAM:
FT                   Malate:quinone-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54143"
FT                   /db_xref="GOA:D9SI86"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI86"
FT                   /inference="protein motif:TFAM:TIGR01320"
FT                   /protein_id="ADL54143.1"
FT                   /translation="MSIKKVDVLLVGAGVMSATLGKLLALLDPSLKITMVERLSRVASE
FT                   SSHGLNNAGTGHAGYCELNYTPQQADGSVEIKRALAINAAYEVSLQFWSYLVEQGSLPS
FT                   PEKFINPIFHQSFVWGEENVAFLRKRYQALHPHHLFEEMEYSEDHAVLREWMPLVMAHR
FT                   DPKQPVAATQVKHGTDVDFGMLTRKLVKAMTKHSTFDLKLGHTITGMKQFPDGRWHVRL
FT                   KENHSEHSKTIEAGFVFLGAGGGALPLLQKSGIPESLGYGGFPVSGQWLICKNPEVVRR
FT                   HTSKVYGKAPLGAPPMSVPHLDTRIIDGEPALLFGPFASITTKFLKEGSVLDLFSSLKS
FT                   NNLKPMLAVARDNLDLTRYLITEAFKSHSERVASLQEFYADAKEEDWELASAGQRVQII
FT                   KGCDTKGGRLEFGTEIVTSQDGTLASLLGASPGASTSVQAMIEVIERCFSDRVATEHWQ
FT                   EKIKKMIPSYGESLDENEELLHLVRERTLATLGLEHRAGKLGSKPR"
FT   gene            120706..121290
FT                   /locus_tag="Galf_0099"
FT   CDS_pept        120706..121290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0099"
FT                   /product="Prolyl 4-hydroxylase alpha subunit"
FT                   /note="SMART: Prolyl 4-hydroxylase alpha subunit; KEGG:
FT                   slt:Slit_2272 2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54144"
FT                   /db_xref="GOA:D9SI87"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI87"
FT                   /inference="protein motif:SMART:SM00702"
FT                   /protein_id="ADL54144.1"
FT                   /translation="MNIIAEQLQDTGYIVLDNPLPASLMTALRERCQESQAGFEAAHIG
FT                   RGTDKKQINSIRGDVIRWLDESHDTDQAYLAWMENLRSKLNEALYLGLFDYECHYAIYG
FT                   AGTGYAKHSDVLNGKKNRVLTTVLYLNENWQRSDGGELVLFEPEGIDVLATVAPKFGTM
FT                   IIFLSESFPHEVLISHSTRRSITGWFRVSGS"
FT   gene            121274..122302
FT                   /locus_tag="Galf_0100"
FT   CDS_pept        121274..122302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR2694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54145"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI88"
FT                   /inference="similar to AA sequence:KEGG:HEAR2694"
FT                   /protein_id="ADL54145.1"
FT                   /translation="MSAAVNALPEYAIDLAEKNVHDILTLAVEHTQAAVVVWDAQCALS
FT                   IALASAYWRCLPDAIFIDFDSVAPEAVRAEFERLMPGDLVVLIQSTSFRLDAFRIRVEL
FT                   FKLQLKVIEHPHLSRMPGDQGLLYIESLAYDPVYVRGTGHALKARFDSARVGIINSFGE
FT                   QLIFSSGFEPAKLNVGDYSQMHNVGGQFPIGEVFTESKDLEGLNGRVRLSIFGDTSFTV
FT                   NKPERPITLIVDKGRVTGTVDSTPEFDLVLAKIREDEGEIWVRELGLGLNRTFTQERLV
FT                   SDIGTYERMCGVHLSLGAKHGSYNKPQIKKSAARYHVDVFAYTDTMTLDGEVIYRDGLW
FT                   AV"
FT   gene            complement(122299..123252)
FT                   /locus_tag="Galf_0101"
FT   CDS_pept        complement(122299..123252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0101"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: slt:Slit_2416 cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54146"
FT                   /db_xref="GOA:D9SI89"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI89"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADL54146.1"
FT                   /translation="MAASPTHIGNYSIVEKIGAGATSNVYHAQHVKTLASVAIKQLRRG
FT                   RQADVYLDMFATEVALGRKMSHKNIVRILDADLHESDGAYLVMEYINGNALDRSEQVNT
FT                   LPPILTVLSVVEQVASALRYAATLGIVHRDVKPGNIILMPNGLAKLTDFGCAVPSSELG
FT                   AVVAGSLAYMSPEQLEGDALDQRADIYALGAVTYRLLTGHHTFEADNAFDARIAIHNYP
FT                   ITPVETYRKKLPKKLIDVIGRAMEKNRDRRYADWDEFIADFGNAAHEIRMSDYDLDLYR
FT                   GFSMSTQSVLSSYMSADRAFSRSGFSRSTLPESYGI"
FT   gene            complement(123387..126242)
FT                   /locus_tag="Galf_0102"
FT   CDS_pept        complement(123387..126242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0102"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; histidine kinase HAMP region
FT                   domain protein; PAS fold domain protein; GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; KEGG:
FT                   diguanylate cyclase/phosphodiesterase with PAS/PAC and
FT                   CHASE sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54147"
FT                   /db_xref="GOA:D9SI90"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI90"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54147.1"
FT                   /translation="MNRRLSLLIPLILLIVTLGSSSLIYLQQDRATQAAIQRAAITDVT
FT                   QQMGGLQNILYNRLTADDEAEALLSLSIAATHPSIRTLMLVDERHHVLMANQYRWKGEA
FT                   ASSFSSYDDNEADRVLNRGVRKLEFDAHEPTLLQGYFPLITEYKQGGLEKTMGVLYVGY
FT                   DTRHELQKAKQETLMQTAIFVAISLFASFVIGILLHVLVTRRVNLLSAISKQFAAGNYN
FT                   ARSELKGNDELSELGRSFDTMALRVTENIALQQRAQDFLSEAQKIGHFGSWELDLHSGR
FT                   LNWSEEIFRLFEIDPAQFSPSHEAFLSIIHPEDREAVNQAYTNSLTNKQSYHITHRLIM
FT                   ADGRVKWVEARGSNYFDPEGRAIRSAGTVQDVTFREEAATQLRIAAVAFDTQEAIMVTD
FT                   KEANIIKVNHSFELTTGFSEQEVLGKNPRLLGSGRHNQDFYKSMWEVLNRVGSWSGELW
FT                   DRRKNGEIYPKWLTITAVKNRDEISHYVGVFVDITERKKAEEEIHNLAFFDPLTQLPNR
FT                   RLLLDRMRLALGLSARSKNFGALMFIDLDHFKVLNDTKGHEYGDKMLIEVSHRLTQSLR
FT                   DTDSVARFGGDEFVVLLESLSVNQDIAVAQAGSIAEKMRESLSQTYIIESYAHESTPSI
FT                   GVVLFNGDAIEIDELLKRADLAMYQAKESGRNTVRFFESAMQATLESRTLMERALRQAL
FT                   SNSEFELYYQVQTNQANELLGAEVLLRWHSQSLGPISPAQFIPLAEQTKLILPIGEWVL
FT                   ENACARLKAWETHPTLSKLRLAVNISPVQFHQPDFVRQVQAALTDSGVNPRRLELELTE
FT                   NLVLEDVDEAIQKMSALKALGVRFSMDDFGTGYSSLQYIKRLPIDQLKIDQSFVRDILT
FT                   DPGDAMMVQTIAGMARNFGYEVIAEGVEEHAQLLPLIERGCNTFQGYFFSRPVALAEFE
FT                   HLINHWVAFDSSSPSPSRRQL"
FT   gene            complement(126239..127231)
FT                   /locus_tag="Galf_0103"
FT   CDS_pept        complement(126239..127231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0103"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter"
FT                   /note="KEGG: tgr:Tgr7_1989 nitrate/sulfonate/bicarbonate
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54148"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI91"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1989"
FT                   /protein_id="ADL54148.1"
FT                   /translation="MVTARLKSLSSKLRLSTLLLLLSVGLLSSCSKESHEPLRIASSPW
FT                   PGYEPIYLARDIGYLPKNKASIFELPSSDITLESFRNHSADMATLTLDEALDLLAGGVK
FT                   FRILFVMDGSNGADAVMASPQVKSLADLKGKRIAIENIPLGVYMLSRTLNAAKLKREDV
FT                   HVIPSAESRQLEMYKQDKADAFITFDPFKTQLAALGAHAIFDSSQIPNEIFDLMLVHED
FT                   VFQARRQEVCDVAREWFHTLNYMKQSPADATHRISKRLGVSTQEYQTMVGGISTPTLQD
FT                   NLRLLSTKHPAIITPANNLVQVMLKEGQLKQQVDIRMALDADINTCIEP"
FT   sig_peptide     complement(127136..127231)
FT                   /locus_tag="Galf_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.722 at
FT                   residue 32"
FT   gene            complement(127456..128304)
FT                   /locus_tag="Galf_0104"
FT   CDS_pept        complement(127456..128304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0104"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="KEGG: slt:Slit_0071 formyltetrahydrofolate
FT                   deformylase; TIGRFAM: formyltetrahydrofolate deformylase;
FT                   PFAM: formyl transferase domain protein; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54149"
FT                   /db_xref="GOA:D9SI92"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI92"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ADL54149.1"
FT                   /translation="MNRHYTLTISCPDRAGIIAAVAGFIAQHGGFIVEASYHTEQESER
FT                   FFMRQEIRADSLPFDAAEFGLRFAALAQEFNMHWQLADSAQNKRLVILVSRQDHCLDDL
FT                   LHRWRSGELLVDIPCVISNHEDLRSFVEWHGIPFIKVDMQDKTAAFEHIAALFDEYQGD
FT                   TMVLARFMQILPPFLCQRYPGRIINIHHSFLPSFVGAKPYHQAYLRGVKLIGATCHYVT
FT                   DELDAGPIIEQDTVRIDHGDTVDDLVRYGRDIEKTVLSRGLRYHVEDRVLVCGNKTIVF
FT                   K"
FT   gene            complement(128301..128702)
FT                   /locus_tag="Galf_0105"
FT   CDS_pept        complement(128301..128702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0105"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: slt:Slit_1693
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54150"
FT                   /db_xref="GOA:D9SI93"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI93"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ADL54150.1"
FT                   /translation="MIKLFFKALRLILMPFMLLWAKLAMPRGIVRPPRIQDKIDAECRQ
FT                   LALYHFKTCPFCIKVRHEMARLSLPITLLDAQHDPKHRADLLEGGGKIQTPCLQITDQA
FT                   GGVQWLYESKVIISYLQALSSPPTPEINT"
FT   gene            complement(128721..129521)
FT                   /locus_tag="Galf_0106"
FT   CDS_pept        complement(128721..129521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0106"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; KEGG: slt:Slit_0096
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54151"
FT                   /db_xref="GOA:D9SI94"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI94"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ADL54151.1"
FT                   /translation="MTHTSGAIGVFDSGVGGLSVLRHIRQLLPNERLIYVADSAHVPYG
FT                   DKSARYIEQRSIELTRFLISQGADAIVIACNTATAAAAATLRRDFSCPIIGMEPAVKPA
FT                   VAATKNGIVGVLATIGTLESARFSALLERYAGNVTIVTQGCPGLVEQVERGDLTGPLTR
FT                   ELVERYTTPLLEQGADTLILGCTHYPFLAGLIRDIAGQDIQLIDTGEAVARHLLRRLQT
FT                   ELSDRAPTQASVQFWTSGDEARASTIISALWHHPVNVQQLPLYN"
FT   gene            complement(129540..131138)
FT                   /locus_tag="Galf_0107"
FT   CDS_pept        complement(129540..131138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0107"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: slt:Slit_0097 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54152"
FT                   /db_xref="GOA:D9SI95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI95"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54152.1"
FT                   /translation="MLSTANITMQFGAKPLFENVSVKFGNGNRYGLIGANGCGKSTFMK
FT                   ILGRDLVQTSGEVMLDKSERLGKLRQDQFAYENNRVLDVVMMGHDEMWQVMSERDAIYA
FT                   NPDASEEDYMHAADLEAVFAEYDGYTAEARAGELLLGLGIAIELHNGPMSEVAPGFKLR
FT                   VLLAQALFSNPDILLLDEPTNNLDINTIRWLENILNARTCTMVIISHDRHFLNSVCTHM
FT                   SDLDFGKITTYPGTYDDYMLASTQAREQQSADNTKAKEKVAELKAFVARFSANASKAKQ
FT                   ATSRARQIDKIKIEDIKPSSRQYPFIRFEYDDREKLHRTAVEVENLSKGFDRVLFSNVN
FT                   FRVDAGEKIAIIGPNGIGKTTLLRCLAGELTPDYGIIKWTEKAKVGYYAQDSYSEFAED
FT                   KIMTDWMTYWRGPNDDDQTVRATLGRLLFSGDDAHKPVSVLSGGEKGRLLFGKLMLQRN
FT                   NVLLMDEPTNHMDMESIESLNTALLEYKGTVVFVSHDREFVSSLATRIIEISAKGVTDY
FT                   HGTYEEYLRDQGMSV"
FT   gene            131292..132179
FT                   /locus_tag="Galf_0108"
FT   CDS_pept        131292..132179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0108"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="KEGG: OmpA/MotB domain protein; manually curated;
FT                   PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54153"
FT                   /db_xref="GOA:D9SI96"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI96"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADL54153.1"
FT                   /translation="MSTPVKAKPFKRKIIIRRIRKQVREAPRGAWKIAYADFVTALMAF
FT                   FLMLWLISSTSADYRQAISEYFETPLMVVFSGGQSNDVTSSLIVGSYGEDKTFSSGQVN
FT                   KGEGAVEDIAISVSDAGRLLHMQEVVRLKLLKAQLEQLIRTDPNLNQFKEQLQIDLTSE
FT                   GLRIMIIDAKNRPMFEIGSAILQPYTVEILRSIGSTLNRVPNKIGLSGHTDAANYQGGS
FT                   AGYSNWDLSADRANASRRTLIAGGMGQEKILRVVGLSDSVLFNPADPYDAHNRRISIIV
FT                   MNQKAMDAVLVDGE"
FT   gene            132240..133511
FT                   /locus_tag="Galf_0109"
FT   CDS_pept        132240..133511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0109"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="KEGG: slt:Slit_0100 glutamate/cysteine ligase;
FT                   TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54154"
FT                   /db_xref="GOA:D9SI97"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI97"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ADL54154.1"
FT                   /translation="MVPHLTTALNGPLLDLERRFLSAMPNIEHWFRRQWLDHAAPFYAS
FT                   VDLRNSGFKLAPVDTNLFPGGFNNLNPDFLPLCVQAMQGTVQKICPEARGVLLIPENHT
FT                   RNLFYLQNVAQLVTILRQAGMLVRVGSLLPEITSVTEIALPGGAVVKLEPLVRRGNRLG
FT                   LEGFDPCVVLLNNDLSAGVPDILKNLEQAVLPPLSAGWYTRRKSEHFAAYDRVANDFAG
FT                   LLSIDPWLINPYFATCSQINFQERIGEECLAARVDEVLQKMRLKYAEYGVKHDPFVIVK
FT                   ADAGTYGMGIMTVKDASEITGLNRRQRNKMSVVKEGLQVHDVLVQEGVYTFENINEAVA
FT                   EPVVYMIDHSVVGGFYRVHTGRGVDENLNAPGMHFVPLAFESCCTLPNPDCGPDDTPNR
FT                   FYAYGVVARLALLAASLELEGGED"
FT   gene            133525..134559
FT                   /locus_tag="Galf_0110"
FT   CDS_pept        133525..134559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0110"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: slt:Slit_0101
FT                   ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54155"
FT                   /db_xref="GOA:D9SI98"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI98"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADL54155.1"
FT                   /translation="MTFWYGLLLVVLLTACGKEPLYQEQGYVFGTLVEVTVYGEAEPRA
FT                   KQAVASVMQEFQRLHERLHAWKPSELSDLNAAIARGESQIVSQELAAMLQDAALVSKQS
FT                   AGLFNPAIGNLVRVWGFHADEFKPVEPDAKQIAQLIASQPKMSDLSYAPSGSGFTVRST
FT                   NRAVQLDLGGYAKGYALDRAALLLTQQGVHHALINIGGNILALGQHGKQPWRVGIQHPR
FT                   KAGALAALTLHDGEAIGTSGDYQRYFMLNGVRYCHLIDPRTGFPMQGVQAVTILTRGPH
FT                   AGVLSDAASKPVFISGVKDWRAASERMGLMDVMIVDAAGGIHLTRSMHKRLEFTDKKIN
FT                   VQVE"
FT   gene            134571..134957
FT                   /locus_tag="Galf_0111"
FT   CDS_pept        134571..134957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0111"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: slt:Slit_0103 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54156"
FT                   /db_xref="GOA:D9SI99"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D9SI99"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADL54156.1"
FT                   /translation="MVGILLVTHNGLGDCLADCVKHVFGEIPKNLRVLSVWSKDDPQHK
FT                   LTEGEELIKELDSGSGVLILIDVFGATPSNIGRRLCHADRVEGVAGVNLPMLLRVVSTT
FT                   NKNLTELANIAFEGGRECIVHMEH"
FT   gene            134959..135225
FT                   /locus_tag="Galf_0112"
FT   CDS_pept        134959..135225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0112"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: slt:Slit_0104 phosphotransferase system,
FT                   phosphocarrier protein HPr; TIGRFAM: phosphocarrier, HPr
FT                   family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54157"
FT                   /db_xref="GOA:D9SIA0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA0"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADL54157.1"
FT                   /translation="MQQDALIINKLGLHARASAKLTQLAGSFKCEVMLSRNSRRVNAKS
FT                   IMGVMMLAAAKGTTITIETLGEDEAAAMQAILGLINDYFGEGE"
FT   gene            135222..136946
FT                   /locus_tag="Galf_0113"
FT   CDS_pept        135222..136946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0113"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: slt:Slit_0105 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54158"
FT                   /db_xref="GOA:D9SIA1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA1"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADL54158.1"
FT                   /translation="MSFTLHGIAVSSGIAIGYAHLLSHSSLEVAHYVLPKQFIADEIAR
FT                   FDAALLATRNEFSSLRSNRPSYAAAEFDAFLELHQMILDDPLLSVGPREMVERENCNVE
FT                   WAIKVQTDALAAQFDEFEDAYLRERQADVKQVAERLLKQLSGQPGHQPTHLRHDIDTIL
FT                   VAHDLSPADMIQFKPQQYAAFITDAGSATSHTAIVARSLNTPCVVGLHHARELIYEDDL
FT                   LILDGEQGVLIVNPGKVILAEYKLLQSEWELERKKLKRLRSARANTLDGAAIELHANIE
FT                   KPQDIVEAKENGATGIGLFRSEFLFLNRDQLPDEEEQFEAYRAAAVGMKGMPVTIRTFD
FT                   LGADKQIKGATQVSSNPALGLRAIRLCLAEPQLFRTQLRALLRATHYGNIKILIPMLSS
FT                   VSEINQTLQFINATKQLLDDEGVPYDKAVKIGGMIEIPAAALSLGVFAKRLDFLSIGTN
FT                   DLIQYTLAIDRTDEEVAHLYDPLHPAVLHLLSHVIATSNKLGVPVSVCGEMAGDPAYTR
FT                   LFLGMGLRQFSMSSAQVPAIKQRVLSTSLPEIVALIQKILRTEEPMKIRELLDKLNA"
FT   gene            137074..137754
FT                   /locus_tag="Galf_0114"
FT   CDS_pept        137074..137754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0114"
FT                   /product="histidine kinase"
FT                   /note="KEGG: nmu:Nmul_A0727 putative signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54159"
FT                   /db_xref="GOA:D9SIA2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL54159.1"
FT                   /translation="MSGVFVLIPDITDPKHGEAIALEEDRLRSFGQELHDNLGQQLAAI
FT                   AYQASALEKMILSADRADTAKFAASIAMQAQSAVMECKQLAQGLLPFELEARGLMTALQ
FT                   ALAARAVSHYQIVCEFVCATSDVRLNNAALTLNLYRIAQEAVSNAIRHGRAQNVTLLLA
FT                   SDSAGLRLSIFDDGCGFAKTAECAAGGMGVKIMHSRAQALGGTLVFLVRAEGGTEVRVD
FT                   IRGG"
FT   gene            137759..138409
FT                   /locus_tag="Galf_0115"
FT   CDS_pept        137759..138409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0115"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: nmu:Nmul_A0728 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54160"
FT                   /db_xref="GOA:D9SIA3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54160.1"
FT                   /translation="MLKTQVMLVDDHAMLRHGMAMLINAEADMEVFAEAEDGGEAVALL
FT                   ESEYHPDIVLVDLSLKTLSGFELIKSMHILIPAMPVLVVSMHDETVYAERALRSGARGY
FT                   VMKQEPGGVLIAAIREVLKGNFYLSQPMYTKLMDRFVTGNSQAELLINSLTPSEFEVLH
FT                   LIGAGHSSQEIARLLSRSIKTIETHRANIRAKLQLKDGADLIRYATHWITAEH"
FT   gene            138544..143229
FT                   /locus_tag="Galf_0116"
FT   CDS_pept        138544..143229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0116"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; PAS fold-4 domain protein; MCP
FT                   methyltransferase CheR-type; PAS fold domain protein; GGDEF
FT                   domain containing protein; CheB methylesterase; KEGG:
FT                   app:CAP2UW1_2118 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; MCP methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54161"
FT                   /db_xref="GOA:D9SIA4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54161.1"
FT                   /translation="MTKAQTGVVLPVIRRIKEKAELPIDSSAEERNFIAEMASKKPRKP
FT                   RKPAVKAEIPVAPVEERNFIVGIGASAGGLEALSDLIGSLPDDLGVPYIVVQHLSPTHR
FT                   SMMVPLLARETSMLVKDAEDGEIPLANVVYVTPANWNIILKDGVMRLLVPGKTVMPKPS
FT                   ATALFNSMAEEKGEDAIGVILSGTGSDGAAGIAAIKAAGGFTFAQDPEAAKYSGMPQAA
FT                   ISTGCVEWVLTCRGIAEEITAIARAHGLINRATKQENAPATMKGLLQMVYKHSKIDFSG
FT                   YKEATLSRRVERRMAANRLNNLAAYFDYCSKNPDELNKLSKDILISVTAFFRDRNSFEG
FT                   LRKILADIVALKQTGDEIRIWVPACATGEEAYSIGILLSDILGSKLSDYRIQIFATDID
FT                   MDAMAVARKGIYNESSLTEVSADTTARYFSKHADTYEIARPIRDMVVFARQDLVLDPPF
FT                   LRLDLVSCRNLLIYFQPLLQTRVLSIFHFALRPAAYLFLGKSESIVHQDNLFSPVSKEA
FT                   RIFVRVASKDQMIPIPLYTSQEAGVKQPITIAERTSRKPESRLQKALSEIYAPPSVLIN
FT                   REMDIVEVHGDMQSYLHFPAGKLEMNLAQLLRREWRTEVQTLVHHAELKRTNAMGRIRP
FT                   VKHSAGLSVQIEVHPVASRDDQKLFLISFISLTAEPGEVHPEDRMPVNSSELEDELIAT
FT                   REHLQTVIEELETSNEELQALNEEMQAANEELQSSNEELEASNEELQSTNEELTTVNEE
FT                   LIVKGGELSLVNTELENLQNSTGFSLILLDQELRLQRYNKEAASLFGFSVHTLGKSIPG
FT                   LAVPVIDVLETAKLAMSDGIKRQKQMSFGGKHYNVLCFPYTSQDQTLGGVIVTFIDQTE
FT                   LMEAQQEILSSKDRLTGVMQNSPMLISIKDPAGRYQFVNNAFESIFALTPGSAIGNTDT
FT                   QIFPESIAVLFEKLHFDVLHKKNRVEAEERILIGDQQHWLSFICYPINDEKGSVGAVCS
FT                   QVIIVTARRELDEQKKLTTKFFDAASEGLMITDSHQNIIKVNHAFVRMTGYDEADVIGK
FT                   NPSLLSSGKHEDTFYSAMWQEINQHGWWQGELWNRRKDGTHYLEWLTIHTLRDEHGHLT
FT                   NYIAIFSDITLIKAAQRRLEYMVAHDELTSLPNRNELRGRMAQTFARAQRHGGTFALMF
FT                   IDLDNFKNVNDNLGHDYGDVLLQQVAERLGLCVRTEDTVARIGGDEFNVLLDDVSETQI
FT                   ANTAQRILDHVSKPYLIKEQQVFVSASIGIAVYPKDAEDIETLTKNADSAMYQAKDKGK
FT                   DSYQFFTSDLKEKINHRIEIGNALHKAIDANELKLVYQPEFNLQTGELIGAEALLRWHS
FT                   SLFGIVGPDEFIPIAEESDLILELGEWVIEQAARQLNLWRKADTPLPGTLFVNVAPRQL
FT                   ARQPLLAIITRQLQKHRLPSGSLGIEITERTLVNSSEDISVKLHKIELEEIPIAIDDFG
FT                   TGYSSLSYLKSFPISFLKIPNQFIDGITTDESDKGIATAIHGVSVALKLQTIAEGIETE
FT                   DQLIMLREMGCQSGQGYLLGRPVDPNQFVELFISNRKSHVR"
FT   gene            143219..143434
FT                   /locus_tag="Galf_0117"
FT   CDS_pept        143219..143434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: osa:4348862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54162"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA5"
FT                   /inference="similar to AA sequence:KEGG:4348862"
FT                   /protein_id="ADL54162.1"
FT                   /translation="MSDNSTDPDRKNRCWGISRGRPRTEAKPVERAADIPVELTYRRPT
FT                   RLGLLMTVRAKSTQAKVPDASGIDEE"
FT   gene            143449..144894
FT                   /locus_tag="Galf_0118"
FT   CDS_pept        143449..144894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0118"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="KEGG: ppw:PputW619_1796 GAF sensor signal
FT                   transduction histidine kinase; PFAM: Phytochrome central
FT                   region domain protein; GAF domain protein; SMART: GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54163"
FT                   /db_xref="GOA:D9SIA6"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA6"
FT                   /inference="protein motif:PFAM:PF00360"
FT                   /protein_id="ADL54163.1"
FT                   /translation="MAHCEAEPLAYSGAIQPHGGLLCLDVHLSMSHVSEQIEKFVTTPL
FT                   RAGDTLSDELGAVLFPVIATLPQVPGSRCELFAVDSIGPLPLDIVVIRSNASIIVELIP
FT                   HTVRVDAVEFAQQTVRPPANDGEVQALHEKISARFYELTGFDRVMVYVFRDDGDGDGEV
FT                   LAETRREAVYGSYLGLRFPGSDIPAIARALYMKNPWRLIQDCQAEAVSLCSNGSAPPDL
FT                   TWSDLRSVSPMHLRYLANMGVSASLSFPIVAGGVLWGLIACHHARPRNLPLVTLCLAAR
FT                   EASHYSLEISNWQVRLQMRFNDELTDRLNTIRRALLRHGHALSALTEISSIVMAQFDGC
FT                   GLAVCQGDVWGVAGEVPALYELELLDEWLESQGDELINGCDCIGHAIHALVPVAGVLAF
FT                   RLMTRRRELLSIFIFRREILHEVEWGGNPHKPVEYQQGDIMISPRRSFEKWIEKRIGYS
FT                   RPWQKQDRISAMRLRLLLVNLYC"
FT   gene            145087..145683
FT                   /locus_tag="Galf_0119"
FT   CDS_pept        145087..145683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0119"
FT                   /product="heme oxygenase-like"
FT                   /note="PFAM: Haem oxygenase-like; KEGG: msl:Msil_2021 heme
FT                   oxygenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54164"
FT                   /db_xref="GOA:D9SIA7"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA7"
FT                   /inference="protein motif:PFAM:PF01126"
FT                   /protein_id="ADL54164.1"
FT                   /translation="MNHIVQVRLRAVSHASHVRLNHHPLLAGLAGRAYSLSAYRTVLVA
FT                   YYHLYQLLEMRIEQFIRVNRTPFDYSVRLKLPWLVDDLQFFNENPHVHRPVPQLDFPEI
FT                   TGIGQLIGVLYPVEGATLGGQVISRHLFDKHGLTQGARFFNGYGNVTQENWQQFCLFAE
FT                   SIGGDERQCQAAEAAALLTFNRFEEVLNAYHRADC"
FT   gene            145658..149623
FT                   /locus_tag="Galf_0120"
FT   CDS_pept        145658..149623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0120"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; PAS fold-2 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; Phytochrome
FT                   central region domain protein; GGDEF domain containing
FT                   protein; GAF domain protein; KEGG: sfu:Sfum_2209 response
FT                   regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein; PAC repeat-containing protein;
FT                   GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54165"
FT                   /db_xref="GOA:D9SIA8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54165.1"
FT                   /translation="MLTTEPIANAPEVEEALKNCEREAIHQVGKIQPVGLLLALNDDGL
FT                   IITHVSDNVSEWFDLTPSTLLGKTFSSLVGETQALSIRQLIGLEDWRRTAITTFKITRG
FT                   GRTLSLDAQVSRTGKCWIIEIEPDESDRDDLFHKLFIPIRDSLWQLDAEVDLFRYTQKV
FT                   VEQVRLLTGYDRVMMYQFDDNWDGEVIAESRADDIGSYLGNHFPAADIPPQARSLYTKN
FT                   LVRMISDVDAIPVQIQSQDSEPLDLTYSSLRALSPVHLQYLRNMGVNATLSISLIQNDR
FT                   LWGLIACHHREPKYISMRVRELDEFIGKTVSLKLSNLENGRKVQFHDQIHQLLEKLTEK
FT                   IRQNCDIGSVIDIFDAELLSLVHADGAIINLGGNRYHIGSTPSDELMLDIESWLKTMSP
FT                   KGVFQTDNLSGIYPNLGVYQEVACGLMIAPLDRNMHSYISWFRNEITKTIKWAGNPDKV
FT                   VKNEQGRLTISPRESFATWVEIFRDKSPQWTQMEIDAANSLALALIEVLTHHALEQSEE
FT                   NYRFLTDNSSDMIARFDLDGVYIFLSPSCQSLFGFSAQHMTGCAVTDFIMPEDCVTFQN
FT                   ALLLMGSTDQAQTLLFRSQHDRSKTVWIEYTLKRIINPRSGAIEIVANGRDVTQRHTYQ
FT                   LAIEDLHRRNAKILEAAGDGLVSISPDGKIVYTNERVRQILGWGGSELAGKSCCQLFHA
FT                   RDADTSHDYPCDCPLIAQNLNKEVGVSATGYFSHKEGRAIRVDYSCTQMTDHGKLSGAV
FT                   LVFRESTEQSMTFDQKQTSDVIFNAASEAVMVTDANRRITSVNRAFIKITGYAAEEMIG
FT                   QTPKLLSSGVHTQNFYDAMYASLEASGYWAGEIWNRRKNGEIYPQWGSITAIFGELGDL
FT                   RSYIAVFSDVSKAKQAEEHLYHLANHDSLTGLANRSKFVDYLNHTLDLARRNRGHKVAV
FT                   AFIDMDRFKIINDTLGHTIGDQFLKAIATRISSQCRNEDLLSRWGGDEFVLVMDRVDGP
FT                   DSVAEAVRRMMEVVRKPLLIDGHELEPTLSVGISFFPDDAQNTTDLVKAADTAMYRVKE
FT                   NGRNGYAFFTELQADESKKKFEIVSELNRALRLNEFVLNYQPQVKPDTGEIVGLEALIR
FT                   WEHPERGYLSPANFIPLAEELGMINQVGEWVIKAVCQQMSAWKLGGVTYPRVAVNVAPS
FT                   QLDSGLADYVQRTLALYGLTADCLEIELTEGALERGGEVAPVLKQLRELGITLSIDDFG
FT                   TGYSSLGHLKNFPINCFKIDKSFVDGLPDSVQDAAIVKTILTLGENLNVEVVVEGVETL
FT                   AQRDFLTSIGAKIIQGYCYGKPLSVEKITERLKIGHF"
FT   gene            149745..151166
FT                   /locus_tag="Galf_0121"
FT   CDS_pept        149745..151166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0121"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: mmb:Mmol_1892 deoxyribodipyrimidine
FT                   photo-lyase; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54166"
FT                   /db_xref="GOA:D9SIA9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIA9"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADL54166.1"
FT                   /translation="MQSYNRSICWFRRDLRLDDHAALYHALKNSRAVHCVFVFDTVILD
FT                   ALSDKHDRRVEFIWHSLYELNALLQQHGSTLQILHGNPVELIPHLARELEVQAVFCNRD
FT                   YEPLAVRRDAAVAASLSDIDFHQYKDQVIFEQSEILTGGGTPYSVFTPYKNAWLKKLDD
FT                   FYLRAYPVERYFSSLAKSAPQAFPALALLGFLPGKLNVQALPTGASGAATLFENFVSRI
FT                   DAYGEARNFPAVKGVSYLSVHLRFGTISIRRVASFAYYSGGAGGQVWLSELIWRDFYQM
FT                   QLHHHPQLGQGAAFKAQFNDIRFPNEEGKFAAWCEARTGYPLIDAAMRQLNGSGYMHNR
FT                   LRMVVASFLVKDLHIDWRWGERYFAQHLIDFDLAANNGGWQWAASTGCDAQPWFRIFNP
FT                   VTQSEKFDGAGRFIRRYVPELAGCPDKWIHAPWLMPAAEQQRCGVLVGKTYPLPVVDHA
FT                   VARITTLALFKAAVG"
FT   gene            151306..153204
FT                   /locus_tag="Galf_0122"
FT   CDS_pept        151306..153204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0122"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver;
FT                   Metal-dependent hydrolase HDOD; KEGG: tmz:Tmz1t_3851
FT                   response regulator receiver modulated diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54167"
FT                   /db_xref="GOA:D9SIB0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54167.1"
FT                   /translation="MSKVVDQQFEAFKAHGSLPSPRGVALQIIQLADRDDTTIGQIARL
FT                   IGSDPALAGNIVKVANLLTHRGSRPIASVADAVTIQGIKSVRQLALSLSLVDAHRHGAC
FT                   AGFDYQKFWAHSVCTGIAAQQIVAKMQVGVADEAFLLGLLSKIGRLALATVFPAEYARV
FT                   LTADNLTEAEHAAFGIDHNQITAGMLADWGMPKLFQEISLYIERPEASEFHEGERNWRL
FT                   LQLMHFSDRLAAVCTAEASERYRLIPRLMLLATRVGIESGTLIEIGDRVIASLREWSAL
FT                   LGIFVPALPPFEEMLNADSMASELLGLDALPGSLPVGFKLRILLVDDDRAIRLLYKTLL
FT                   EKSGHTVTTACNGREALESLQASVPQLIISDWMMPEMDGIEFCRELRKNPEWHKIYVFI
FT                   VTAQESTDRLIEAFEAGANDYLSKPINPKVLAARLRSAQRIVQMQEAQEEDRLQLRQFA
FT                   DELALSNKRLQTLALTDALTGLPNRRYGMERLEQEWAIAMRAGRPVCCMMVDIDHFKAV
FT                   NDNYGHQLGDEALKLVALSLQQAARKQDVVCRLGGEEFMVICPDSDLRAGYTYAERLRQ
FT                   HVAAQPIQAQGKSLQLTVSIGLTDNANLDSTEAMLHQADTRLYAAKASGRNCTVVG"
FT   gene            153306..153650
FT                   /locus_tag="Galf_0123"
FT   CDS_pept        153306..153650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0123"
FT                   /product="HopJ type III effector protein"
FT                   /note="KEGG: slt:Slit_2296 HopJ type III effector protein;
FT                   manually curated; PFAM: HopJ type III effector protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54168"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB1"
FT                   /inference="protein motif:PFAM:PF08888"
FT                   /protein_id="ADL54168.1"
FT                   /translation="MKLSDFLQKLRNTPGQIEFSDTMAVIDAVYEFTPVTFRNGNLVNQ
FT                   AGTNSGSCKLFSFASLHGLSQQQTLDCFGAYYRDDVLQHPDGTDHQNIRNFSVTGWGGI
FT                   VFDACALAAK"
FT   gene            153940..155073
FT                   /locus_tag="Galf_0124"
FT   CDS_pept        153940..155073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0124"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="TIGRFAM: homoserine O-acetyltransferase; KEGG:
FT                   slt:Slit_0036 homoserine O-acetyltransferase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54169"
FT                   /db_xref="GOA:D9SIB2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB2"
FT                   /inference="protein motif:TFAM:TIGR01392"
FT                   /protein_id="ADL54169.1"
FT                   /translation="MANSIGIVKAQRAVFDTPLTFRSGAVLPCYELVYETYGTLNEDKS
FT                   NAILICHALSGHHHVAGCYEDEPNNIGWWDNMVGPGKPINTDKFFVLGLNNLGGCHGST
FT                   GPSSINPETGEPFGASFPVITVEDWVESQARLADLLGIRRFAAVVGGSLGGMQALQWSL
FT                   AFPERVAHVLAIASAPRLTAQNIAFNDVARNAILTDPDFHGGNYYQHGVVPTRGLRLAR
FT                   MLGHITYLSDDVMADKFGRNLRTEQYNYGYEVEFQIESYLRYQGDKFAAYFDANTYLLM
FT                   TKALDYFDPAHLSGGNLNQAFSRAKAGFLVISFTTDWRFSPQRSREIIRPLLHNKRPVS
FT                   YAEITSNHGHDSFLMEHPHYFDVVRAYLANVYHEVTA"
FT   gene            155070..155675
FT                   /locus_tag="Galf_0125"
FT   CDS_pept        155070..155675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0125"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="KEGG: slt:Slit_0035 methionine biosynthesis protein
FT                   MetW; TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54170"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB3"
FT                   /inference="protein motif:TFAM:TIGR02081"
FT                   /protein_id="ADL54170.1"
FT                   /translation="MSIESLAAERPDFAAIAAWIPKGASVLDLGCGDGSLLRYLKETRS
FT                   VRGYGVEISDMDIVSCIANGVNVIQNDLDSGLSDFEDNTFDFVILSQTLQATRHTEALI
FT                   QEMLRVGREGIVSFPNFGYWKSRLNVMLGNMPVSRELPYQWYDTPNVHLCTLNDFESFC
FT                   RKYCVSISARSVMTGGVEVGLLPNLLGSTAVYRFQRGV"
FT   gene            155672..156934
FT                   /locus_tag="Galf_0126"
FT   CDS_pept        155672..156934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0126"
FT                   /product="AmpG-related permease"
FT                   /note="KEGG: slt:Slit_0034 AmpG-related permease; TIGRFAM:
FT                   AmpG-related permease; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54171"
FT                   /db_xref="GOA:D9SIB4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB4"
FT                   /inference="protein motif:TFAM:TIGR00901"
FT                   /protein_id="ADL54171.1"
FT                   /translation="MSVFKQLFTRRMAICVFTGFSSGLPLYLLFNLLPAWLRSEHVDLK
FT                   TIGLFALIQFPYTWKFIWSPFLDRYALPVLGRRRGWMVLTQLGLLAVIASMGGFSPASQ
FT                   LATIAWCATLLAVLGATQDIVLDAYRRELLSDSELGLGNAVHVNAYRVAGLVPGSLSLI
FT                   LADFLPWDLVFIITALFMLPGIAMTLIIREPKIAAAPKTLREAVVEPFREFINRQGWRS
FT                   AGLILAFLLFYKLGDSLCTALATPFYLDMGFSKTDIGLIAKNAGLWPAVIGGMLGGLWM
FT                   VKIGINRALWIFGVVQVLAIFGFVWLASVGHHSEIGALERTQLAVVIGLEALGVGLGTV
FT                   AFVAFIARTTHPAYTATQFALFTSLMAMPRTFANAATGWLVESMGWSGFFLLCAVMAIP
FT                   GMLLLLKVAPWNDEQRLATSD"
FT   gene            complement(156965..158287)
FT                   /locus_tag="Galf_0127"
FT   CDS_pept        complement(156965..158287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0127"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; KEGG:
FT                   slt:Slit_2948 amino-acid N-acetyltransferase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54172"
FT                   /db_xref="GOA:D9SIB5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB5"
FT                   /inference="protein motif:TFAM:TIGR01890"
FT                   /protein_id="ADL54172.1"
FT                   /translation="MHINTTPADFVAWFRSVAPYINSFRGKTFVIAFGGEMVEDGKFTA
FT                   LTHDFNLLAALGIRLVLVHGARPQIEQHSARKNLEDNYHQGIRLTDTQTMQCVKESVGR
FT                   VRVEIEALLSMGLANSPMANADIRLAGGNFITAQPIGVINGVDLQHTGCVRKVDVAALK
FT                   NRLNFGEVVLLSPLGYSPTGEVFNLTLEDVATSTAIALDADKLVFLMDTDGVQSDHGDT
FT                   LKELTVAQAQAALASKRVQSDDINLFLPCAIRACEAGVARTHLISRHTDGAVLQELFSD
FT                   DGIGTMVVESTLNTLRDASIEDVGGILQLLRPLEEQGILVRRSRELLEQEIERFVVLEH
FT                   DHRIVGCAALYPFPDEAAAELACLAVDAQCRDKGYGEAILDHMAVLAKSQKLKKLFVLT
FT                   TRTAHWFLERGFIESPVTALPAQKKSLYNYQRKSKVFVRKI"
FT   gene            complement(158304..158492)
FT                   /locus_tag="Galf_0128"
FT   CDS_pept        complement(158304..158492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0128"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   slt:Slit_2947 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54173"
FT                   /db_xref="GOA:D9SIB6"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB6"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ADL54173.1"
FT                   /translation="MPYVNIRIAGTLSREQKAAIASEVTDTLERIAHKPASYTYITFDE
FT                   VAEENWAVAGKLLDSDA"
FT   gene            complement(158511..159242)
FT                   /locus_tag="Galf_0129"
FT   CDS_pept        complement(158511..159242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0129"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   slt:Slit_2944 protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54174"
FT                   /db_xref="GOA:D9SIB7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB7"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ADL54174.1"
FT                   /translation="MPRFYCPPPIPAQGAFNLPADAAHHASRVLRLREGDSVQLFDGTG
FT                   HEYHGAITDMTGKQVVVGDIVHIEADRESPLQIVLAQALCSSEKMDWVIQKATELGATE
FT                   IQPLATGRSVAKLSADRAAKRTEHWQQVAISACEQCGRNVLPVIHPPVEIGTWLQHMLD
FT                   SDMSKYILLPQGAKSLQEQEKPQSGAVLLIGAEGGFTEAESDNALRCGFTPVRLGARVM
FT                   RTETAAVAGLAVLQTLWGDFC"
FT   gene            159347..159901
FT                   /locus_tag="Galf_0130"
FT   CDS_pept        159347..159901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0130"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: slt:Slit_2943 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54175"
FT                   /db_xref="GOA:D9SIB8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB8"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADL54175.1"
FT                   /translation="MVSLQPPLCDFGWKARDFDLLGVDGVRYTLANARGPNGLLVMFIC
FT                   NHCPYVKSIRDRLVRDAGQLKRQGINTIAIMSNDPADFEEDSFENMKRVATEFAYPFPY
FT                   VWDETQQIAKDYGAVCTPDFFGFNADLELQYRGRLDASRKEAVENAPRDLYDAMVQVAK
FT                   TGRGPQEQIASMGCSIKWKTE"
FT   gene            159940..160743
FT                   /locus_tag="Galf_0131"
FT   CDS_pept        159940..160743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0131"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: nmu:Nmul_A0377
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54176"
FT                   /db_xref="GOA:D9SIB9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIB9"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADL54176.1"
FT                   /translation="MSALLKATIAAVKLVAAEEIMPRYLKVAHKHKSDGSLCTDADIAT
FT                   QTALIRKLQAICNVPVLGEEMPEAEQLAIWENAEEGLWCVDPIDGTSNFVHGLPYFAVS
FT                   VALLREGRSVLGVVYDPVADEMFAAEAGKGAYLNGEKLFGRVTAAAMSESLANVDLKRL
FT                   SSKLAGTLASTPPYASQRNFGASTLDWCYTAAGRYDLYLHGGQKLWDYAAGMLILSETG
FT                   GYACCIESDDFASCDIWQRSVIAARSEALFNEWKDWIRAQHATEK"
FT   gene            160754..162127
FT                   /locus_tag="Galf_0132"
FT   CDS_pept        160754..162127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0132"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: slt:Slit_2942 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54177"
FT                   /db_xref="GOA:D9SIC0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC0"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADL54177.1"
FT                   /translation="MKILILGAGQVGSTVAESLVSEANDITVVDSDSGKLALLQERLDL
FT                   RTLVGNASHPSVLEQAGIADTDMLLAVTQSDEVNMVACKLAASLYNTPTRIARIRSADF
FT                   LARPELFNKDNFCVDFSICPEQILTDYISKLIEFPEALQVLRFSQGKASLVAVRAFKGG
FT                   PLVGQPLSFLHEHMPHVDTRVAAIFRKDSPLIPKGDTVVEDGDEIFFIAATKNIRTVLK
FT                   EMRRMDKPTRRVMIVGGGNIGRRLAKALEGDYQVKLIEYNKKACENLAGELTNTLVLNG
FT                   DGTDEKLMQQENVGEVDVFCALTNDDENNIMSALLAKQGGARKVIALINRSAYVDLVQG
FT                   GKIDIALSPAHVTIGSLLAYVRQGDVAAVHSLRRGAAEALELVVHGDRKSSSVVGRCID
FT                   EIDLPSGATIGAVVRGDEVMMGHRDLVIESEDHVIVFVINKAMVKKVEKLFHVHIGFF"
FT   gene            162127..163587
FT                   /locus_tag="Galf_0133"
FT   CDS_pept        162127..163587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0133"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: slt:Slit_2941 cation
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54178"
FT                   /db_xref="GOA:D9SIC1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC1"
FT                   /inference="protein motif:PFAM:PF02386"
FT                   /protein_id="ADL54178.1"
FT                   /translation="MQRTLTVIHALGLMLAVFSFAYLMPLLTALLYGHEEVFQDFLLAM
FT                   IWTLATGVLMWMLTRRYKGELSIRHGYLLVVAMWTAMPAVATLPLLLLLPELSFTDAYF
FT                   ETMSGLTTTGATVLVGLDTLPPALNIWRHELNWLGGMGIIVLAVAILPLLGIGGRQLFK
FT                   AETPGPMKDSALTPRITETARNLWLVYLGITIACIASLKLAGMNWLDAVCHSFSAMGLG
FT                   GFSTHDASVGYFNSPLIEFVLMVFMLIAVMNFAVHFLALRERTLSVYRTDPEAIPTLIL
FT                   ILGSCVGIAFCLWIWEIYPTYWIALRHASFNLISIATSSGYASVDYAQWPIFAPLWMMF
FT                   LTATVASSGSTGGGIKMIRTLVLLKQAGREFVKLLHPAAINPMKIGGQVIPNGVVFSVL
FT                   GFIFLYFMSIMTLTFALLLSGMDFISAFTAILASINNCGPGLGSVGPASNYAGLTDFQT
FT                   WVCTAAMLIGRLEIFTVLILFTPHFWRR"
FT   gene            163593..164483
FT                   /locus_tag="Galf_0134"
FT   CDS_pept        163593..164483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0134"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: dar:Daro_3895 response regulator
FT                   receiver:CheW-like protein:ATP-binding region,
FT                   ATPase-like:Hpt; PFAM: ATP-binding region ATPase domain
FT                   protein; Hpt domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54179"
FT                   /db_xref="GOA:D9SIC2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL54179.1"
FT                   /translation="MSAGQFSSAQQDDVLAQLNGHLAQRSESDEVDAGLLPVFLEEADE
FT                   LLAKIALGLDSSDQAPLRRLLHTLKGSARMAGVLSISQIAHQMEERLHDEAAAQADFAN
FT                   ITRLLDALRNEFVDGGAANSDERFYRTVWQAAKETGREVHLELVGIDTGQLLTAPIEHL
FT                   LRNAVVHGIESPLHRIACGKPPVGEVRIEVGRVGNEIVIELADDGRGLDLAALRTRAVS
FT                   MGVLREADGLMDDNTLAQLIFIPGLSTAGEITQLAGRGIGMDVVKNCVEERSGRISVSS
FT                   VRGQGTTFTLYLPGD"
FT   gene            164559..165119
FT                   /locus_tag="Galf_0135"
FT   CDS_pept        164559..165119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0135"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   slt:Slit_2935 protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54180"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC3"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ADL54180.1"
FT                   /translation="MSKFDLTHHFLIAMPAMQEGFFAGTLTYICEHDENGALGLVVNRP
FT                   VSLTLADMFNQINIPLHQPRLAKMPVHVGGPVQTERGFVLHDTSRDWQSTMRINDKLAL
FT                   TTSKDILEAIGEGRGPDNLLVTLGYSGWEQGQLEHEINENIWLTVPANEHILFDLPAEE
FT                   RLAAAMSLLGVNYSMLVEDAGHA"
FT   gene            165103..165615
FT                   /locus_tag="Galf_0136"
FT   CDS_pept        165103..165615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0136"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="KEGG: slt:Slit_2933 Holliday junction resolvase
FT                   YqgF; PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54181"
FT                   /db_xref="GOA:D9SIC4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC4"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ADL54181.1"
FT                   /translation="MPDMPEVAGLIVNPVVGTLLAFDFGTQRIGVAVGNTFSSSAEPLT
FT                   TIAEEKNELRFSAITKLVAEWQPCALVVGLPCSDDGSPHELTALCQRFAKRLHGRYGLT
FT                   TLLVDERYSSLAASEQLNRQGVRGRDQKALIDQYAAQQILQAYFDEPAACVIVNADRGI
FT                   HEKSATQ"
FT   gene            165593..166549
FT                   /locus_tag="Galf_0137"
FT   CDS_pept        165593..166549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0137"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="KEGG: slt:Slit_2932 aspartate carbamoyltransferase;
FT                   TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54182"
FT                   /db_xref="GOA:D9SIC5"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC5"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ADL54182.1"
FT                   /translation="MKNPQLNKHGELQHLLTTEGLPVRIMRDILDRAATFLDIDEGREI
FT                   KKVPLLHGKSVFNVFFENSTRTRTTFEIAAKRLSADVVNLNIGSSSTSKGETLLDTVDN
FT                   LCAMHADMFVVRHSQSGAAHLIARHVAPEIHVINAGDGRHAHPTQALLDMFTIRHYKKE
FT                   FHNLRVAIVGDVLHSRVARSQIHALTTLGVPEVRVIAPKTLLPTMVENLGVRVYHDMAQ
FT                   GLRDVDVVLMLRLQNERMQGAALPSGQEYFKNYGLTEEKLAYAKPDAIVMHPGPMNRGI
FT                   EIDSRVADGMQSVILSQVTFGIAVRMAVMSTLAGSNK"
FT   gene            166546..167820
FT                   /locus_tag="Galf_0138"
FT   CDS_pept        166546..167820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0138"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="KEGG: slt:Slit_2931 dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54183"
FT                   /db_xref="GOA:D9SIC6"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC6"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADL54183.1"
FT                   /translation="MNIQIKNGRLIDPRNNIDAQLDLFITDKCIAAIGRAPAGFKPDEV
FT                   IDATGLIVCPGLIDLAARLREPGFEYMATLESEMNAAVAGGITSLACPPDTDPPLDEPG
FT                   LVEMLKHRAKNLHQARLYPVAALTTGLMGKELTEMAELVDAGCVAFSQADAPLTDTRVM
FT                   MRAMQYAATFGFSVWLRPQDSFLSKDGVAHDGEVATRCGLPAIPVCAETIALSTMLTLA
FT                   KETGVKLHICRISSAAGVEMIRAARQQGLSVSCDVTANHVHLSEMDIGFFDPNCRLTPP
FT                   LRSLRDRAALRAGLLDGTIDAICSNHAPVDEDAKQLPFAEAESGATGLELLLPLVLKWA
FT                   EQDKVGLADALSRVTLQPAQILGLDAGHLSIGALADVCVFDADAYWKVEAAALKSQGKN
FT                   TPFTGMEVQGLVRYTLVDGKIVYQA"
FT   gene            167898..169931
FT                   /locus_tag="Galf_0139"
FT   CDS_pept        167898..169931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0139"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="KEGG: slt:Slit_2930 oligopeptidase A; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54184"
FT                   /db_xref="GOA:D9SIC7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC7"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ADL54184.1"
FT                   /translation="MNPLLDFSGLPRFAEIQPEQVAPAIETLLGECRELTARLLAESSE
FT                   PDWDNFVAPMEDAHERLSRAWGPVGHLNAVMNSPELREAYNATLPVMTQYYAELGQNLA
FT                   LFNKFKALRSSAAFAGLSVARQKIIENELRDFRLGGAELPEDKKARYLEIQERQSELSS
FT                   RFSDNLLDATNDFTLLIENKDELSGLPEDVLQAASDAASAQDKPGWLFTLKAPSYMPVM
FT                   QFADNRELRAKLYRAYATRASEFGNPSWDNSALMDEIVQLRGEEARLLGFANYGELSLA
FT                   AKMAQTPAQVVEFMRELAQRSRPFAEKDLTELRQFAAKELGLAELHSWDVTYASEKLRE
FT                   QRYAFSEQEVKEYFPEDAVLKGLFSLVETLYGLHIVASIAPVWHESVHFFDIRDAQGQL
FT                   VGQFYFDLYARASKRGGAWMDDVITRRRVDGRIQTPVAYMNCNFAAPVGDKPAVFTHDD
FT                   VITLFHEFGHGLHHLLTEVEDLGVSGINGVEWDAVELPSQFMENYCWEWEVLSGMTRHV
FT                   ETGAPLPRTLFDKMLAAKNFQSGLQSLRQIEFALFDMLMHSDFEAGGKKSILELLDEVR
FT                   AEVALLIPPEFNRFPHSFSHIFAGGYGAGYYSYKWAEVLSADAYSLFEEQGVLNPAVGA
FT                   RFRAEVLAVGGSRPAMQSFAAFRGREPAIDALLRHNGLTEAA"
FT   gene            169931..170698
FT                   /locus_tag="Galf_0140"
FT   CDS_pept        169931..170698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0140"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="KEGG: slt:Slit_2928 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54185"
FT                   /db_xref="GOA:D9SIC8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC8"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADL54185.1"
FT                   /translation="MKLATWNVNSLKVRLPQVLDWLAANPVDVLCLQETKQQDADFPDT
FT                   ELAAAGYHTVFAGQKTYNGVAILSREAAIDVQIGIPGFEDEQKRVIAATFGDIRVVDVY
FT                   IPNGQSPDSDKYQYKLGWLAALHDWLKEELVRYPKLVLLGDYNIAPEDRDVHDPAAWVG
FT                   NVLVSPPERDAFKSLLALGLTDSYRLFEQADKTFSWWDYRMMGFRRNLGMRIDHILISA
FT                   PLVAQCKSCIIDKAPRKLERPSDHTPVVVELAS"
FT   gene            complement(170695..171849)
FT                   /locus_tag="Galf_0141"
FT   CDS_pept        complement(170695..171849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0141"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="KEGG: slt:Slit_0049 ubiquinone biosynthesis
FT                   hydroxylase, UbiH/UbiF/VisC/COQ6 family; TIGRFAM:
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54186"
FT                   /db_xref="GOA:D9SIC9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIC9"
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /protein_id="ADL54186.1"
FT                   /translation="MTDYDIAIIGGGPVGTALALALRGSGLQVCVLEARPSAGSTDARA
FT                   LALSYGSRLLLDRLGVWDKLQDVSLIQTIHISQKKSFGRAVLQARDMQVPELGYVLPYP
FT                   MLQNTLTTALQGSTTKTIYGASVTGLLTQEEHAVIDYQLDGAPHTLTTRLAVVADGGKL
FT                   LAERHPPDLRDYGQSALITHVTCANPKAGTAFERFTPQGPVALLPYKDGYEIVWTAPHQ
FT                   DMEAMLAWDDEQFLSELHRHFGDRVGVFLTVGTRTCFPLGLKKAPAQSPMPHVVLLGNA
FT                   AQTMHPVAGQGFNLGLRDAWDLAQEIRDAAPASLGSDEMLAGYRKRRKLDREAGITFTD
FT                   SLVRLFSNDLPMMSAARAASLTALDCLPFAKRFVAKRMMFGANG"
FT   gene            complement(171842..173152)
FT                   /locus_tag="Galf_0142"
FT   CDS_pept        complement(171842..173152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0142"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   slt:Slit_0048 peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54187"
FT                   /db_xref="GOA:D9SID0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID0"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADL54187.1"
FT                   /translation="MFDKSLYAQRRARLLAKMQHGLCILPNAPEQQRNADADYPYRFDS
FT                   SFHYLSGFAEPESVLVLIADQTGCHQSILFCREKNLDREIWDGYRYGPEAAQEKFGFDA
FT                   TFPIAKLDEKLVELMGNLPAIYSPLGASPLWDQRLLKLRSAVQEKARSGIRAPDELRDV
FT                   RALIHEMRLFKDTHELSILRRAADISTSAHRRAMQFTRPGQFEYQVEAELLHEFCRNGA
FT                   RDPAYTSIVAGGANACVLHYIANDAQLRDGDLLLIDAGCELEGYASDITRTYPVSGRFL
FT                   GAQKELYELVLAAQYAAISAAQPGNNWEAPHNAALKILAQGFIDLKLCHGTVDGVLESE
FT                   SYKKYYMHRTGHWMGMDVHDVGDYKVEGQWRNLQEGMVLTVEPGCYIRPADDVPLALWN
FT                   IGIRIEDDLVITKTGHEVLTAAAPKTINEIEEIMRHD"
FT   gene            complement(173145..173861)
FT                   /locus_tag="Galf_0143"
FT   CDS_pept        complement(173145..173861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0143"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: slt:Slit_0047
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54188"
FT                   /db_xref="GOA:D9SID1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID1"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADL54188.1"
FT                   /translation="MIAMILAAGRGERMRPLTDHTPKPLLEVGGKALIVWHIENLVAAG
FT                   IVQLVINHAHLGAQIEASLGDGSRFGAQIRYSAETLALETAGGIAYARPWLNEEPFAVI
FT                   NGDIWCDYDFSRLPEHAANMQARGDLAHLILVDNPPQHPKGDFCLTGNRITSFSTPVAA
FT                   PNPESLLTFSGIGLYQPALFESIARGSVAPLAPLLRAMIEQGKVSGERHAGLWVDVGTP
FT                   QRLAELDAKLRKEAHV"
FT   gene            complement(173871..174869)
FT                   /locus_tag="Galf_0144"
FT   CDS_pept        complement(173871..174869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0144"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   slt:Slit_0046 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54189"
FT                   /db_xref="GOA:D9SID2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID2"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADL54189.1"
FT                   /translation="MKREQQLTVWLQGQFPEATFTLAPASADASFRRYFRATFDDGTTR
FT                   IIMDAPPEHEDCQPFLHVGKLFEQAGTHVPHVYAEDLEQGFLLLSDLGNTTYLQALTPD
FT                   NARALYAKATDALIKIQRASNEAELPPYDEALLLREMRLFPEWYINKHLNITLTEAQNA
FT                   KLESVFARIVANNLSQPRVYVHRDYHSRNLMVTEPNPGIIDFQDAVYGPITYDLASLFK
FT                   DAYIKWEEPQIIDYLIGYWQNARRAGLPVHEDFGQFYWDFEWMGVQRHIKVLGIFARLC
FT                   HRDGKDGYLKDMPLVMSYLRAAAARYVDLKPLFNLLNELEPPAEAPTGYGF"
FT   gene            174932..177256
FT                   /locus_tag="Galf_0145"
FT   CDS_pept        174932..177256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0145"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; OstA family
FT                   protein; KEGG: slt:Slit_0045 organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54190"
FT                   /db_xref="GOA:D9SID3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID3"
FT                   /inference="protein motif:PFAM:PF04453"
FT                   /protein_id="ADL54190.1"
FT                   /translation="MRFSLKPVLFTLLCVFAHSVAAEALRAPVAAESESEEPVFVEADN
FT                   LTGDKKNQMEATGNAILLKSDQTIRADRLLYDQETADLDGTGSVVVEQRGSTMSGPHLE
FT                   LNLDTHAGFMEKPVFFLKENDGRGKGDMLHIQDQQHYTLDNGTYTTCPADREDWLMKMS
FT                   SLEIDREAQVGVARHAWVEFKGVPILYSPWMDFPLNNRNKSGFLSPVIGSTTKGGAELT
FT                   VPYYLSLAPNYDLTLSPRIMSKRGVMLGNQFRYLQPQYRGEVNLDVLPGDAITQTNRTR
FT                   FGLKHDQALGGGFSGQINFNRVSDNAYYRDLSSEMSVTSKINLLQDASVSYGGGWWSST
FT                   ARVQRYQTLQDPLAPVGEPYARLPQVNVNAAQKYAGANFALMGEYVSFTHTTAVNGQRM
FT                   VVAPSVSVPLLRTPGYYVTPKFTLHSTSYAMGSNNTTLLPDASRVLPLFSLDSGAVFER
FT                   DINLFGKGYLNTLEPRAYYVFVPYQNQDKLPVFDSAQAPFSFVQMFTENRFFGNDRIGD
FT                   ANQLTLAVVSRFLGQDDGAENLKLTVGERFSLSAPQVNLVAPTTTTNKSDILLAASGRL
FT                   NAALSFDTELQYSPALARIQHYNVMARYRPEAGKVLNLGYRFVSDSLGALIPGAVTATG
FT                   SMVINGVVYPTFGGVPYTTLGGNNYSVASAGLRQINVSGQWPLSGRWHAVGQWNYSYLD
FT                   QRLLSGVAGLEYEQSCWMLRLVAHSFTVGTQQTSTGIFVQLELNELVKVGSDPLVLLKQ
FT                   SVPGYKKLNEKPASQPGAVLR"
FT   sig_peptide     174932..175000
FT                   /locus_tag="Galf_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.724 at
FT                   residue 23"
FT   gene            177276..178598
FT                   /locus_tag="Galf_0146"
FT   CDS_pept        177276..178598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0146"
FT                   /product="SurA domain"
FT                   /note="PFAM: SurA domain; PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase; KEGG: slt:Slit_0044 SurA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54191"
FT                   /db_xref="GOA:D9SID4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID4"
FT                   /inference="protein motif:PFAM:PF09312"
FT                   /protein_id="ADL54191.1"
FT                   /translation="MSKIKFPVLLSVLSLMSTPVLAVEKHVIEPQQQVATIDAVVAVVN
FT                   DDVITRLELNERLRMVVSQLKKQGTPLPEGAVLETQVLERMIAEMLQAQFAKENGVRVD
FT                   DTQLDMAITRIAQQNNFPSLVEFMAKLESDGVNVKKFREEIRAEIVSTRLREREVESKL
FT                   VISDTEVDNYLSNKSKMGLDNDEYHLAHILVVVPEQASAEKIRAARERADQAFAQLSGG
FT                   ADFSQVSAGFSDAKDALKGGDLGWRAGDRIPPAFMNELQNLKPGQNTAVLRSPSGFHIL
FT                   KLVEKRGGSAPVVITQTHARHILIKTSEIVTEAEAKKQLLEIKQRIDGGAGFAEQAKRY
FT                   SQDGSAQQGGDLDWLSPGQTVPEFEGAINKLQVGQMGMVQTQFGWHLIQVLARRNTDVS
FT                   EQQKRQQARVSIGTFKSEELYQDWLRQLRDRAFVEYRLEEK"
FT   sig_peptide     177276..177344
FT                   /locus_tag="Galf_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            178595..179608
FT                   /locus_tag="Galf_0147"
FT   CDS_pept        178595..179608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0147"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; KEGG: cvi:CV_4231 pyridoxal phosphate
FT                   biosynthesis protein; PFAM: Pyridoxal phosphate
FT                   biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54192"
FT                   /db_xref="GOA:D9SID5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID5"
FT                   /inference="protein motif:TFAM:TIGR00557"
FT                   /protein_id="ADL54192.1"
FT                   /translation="MNVRYAPLVITAGEPAGIGPELCVQIAAAALNVVVVADKHLLQQR
FT                   AQQLGIDLKIREWDRAKWEGACAGRLDVIHVPLAVPSVAGELNAANSPYVLETLRRALL
FT                   GCQSGEFSGMVTAPVHKGIINDAGIPFSGHTEFLAELTQTPQVVMMLAGGGMRVALVTT
FT                   HMALRDVPDAITVELLARVLRIIHRDLACRFGVAAPRILVAGLNPHAGEGGHMGREEIE
FT                   VMIPVLDRLRAEGMNVSQPLPADTLFTQHKLSTCDCVLTMYHDQGLPVLKHASFGQGVN
FT                   ITLGLPVIRTSVDHGTALDLAGTGRANSGSLLEAILVAAQMAQFERLSSGPLHERT"
FT   gene            179595..180383
FT                   /locus_tag="Galf_0148"
FT   CDS_pept        179595..180383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0148"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   slt:Slit_0042 dimethyladenosine transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54193"
FT                   /db_xref="GOA:D9SID6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID6"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADL54193.1"
FT                   /translation="MSAHKAKKKFGQNFLVDQNIIADIISAIRPEADDNLVEIGPGLGA
FT                   LTRPLLKSLAHLHVVEIDRDIIARLEADYPQPHTKMTIHAGDALKFDLASLGAPLRIVG
FT                   NLPYNISSPLLFYFAEYADRITDMHFMLQNEVVERMVADHSTPAYGRLSVMLQYRFFME
FT                   KLLDVPPDSFRPAPKVNSAIVRMIPIPADQIVVKNEKLFGEIVGTAFGQRRKTLRNTLK
FT                   SFLNEAEFENLGINPQLRAENLSVDEFARIAAYVDDRVVA"
FT   gene            complement(180472..181080)
FT                   /locus_tag="Galf_0149"
FT   CDS_pept        complement(180472..181080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0149"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: slt:Slit_0889 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54194"
FT                   /db_xref="GOA:D9SID7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID7"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL54194.1"
FT                   /translation="MQLEDWIFNSLLKYTKGLSAALGYRDLSTQLHSERVQGLSVEIGN
FT                   YCGLQSDEINALNIAASFHDIGKIGIPDRILLKPAQLDEAEWAQMKLHSEIGEKIMLST
FT                   ELEGSQQAAILIRHHHEHYNGRGYPDQLSAENIPICSRIISIADSYDAMAVTRSYHHAR
FT                   THLEIMAILHQETGEKHDPELMQVFCKLIESSKFKSKRI"
FT   gene            complement(181389..181772)
FT                   /locus_tag="Galf_0150"
FT   CDS_pept        complement(181389..181772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0150"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="TIGRFAM: lactoylglutathione lyase; KEGG:
FT                   net:Neut_1541 lactoylglutathione lyase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54195"
FT                   /db_xref="GOA:D9SID8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID8"
FT                   /inference="protein motif:TFAM:TIGR00068"
FT                   /protein_id="ADL54195.1"
FT                   /translation="MRILHTMLRVVNLETSIAYYSDVLGMKLLRRTDYPEGKFTLAFLG
FT                   YTEEAQGAVIELTHNWGVTQYEIGNAFGHIAIEVDNAYEACEKIKQRGGKVVREAGPMQ
FT                   HGSTVLAFVEDPDGYKIELIQTR"
FT   gene            181866..182705
FT                   /locus_tag="Galf_0151"
FT   CDS_pept        181866..182705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0151"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: slt:Slit_0041 phosphomethylpyrimidine kinase;
FT                   PFAM: Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54196"
FT                   /db_xref="GOA:D9SID9"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9SID9"
FT                   /inference="protein motif:PRIAM:2.7.4.7"
FT                   /protein_id="ADL54196.1"
FT                   /translation="MSEPFPLVMSFAATDPSGGAGLQADMLTISSMGCHPLSVVTAITV
FT                   QDTSGVEDVLPMEAEWVIDQARAMLEDVPVAAFKIGMLGSVENVVAIAEILADYPDVPF
FT                   VLDTVLASGRGDELADEDMLDAMCELLIPQATIVTPNSIEARRLAINEDDEEDDPSLEE
FT                   CARRILAMGCEYVLITGTHEQSAKVINTLYSDRGVVRSDAWARLPGSYHGSGCTLASAI
FT                   AALLAQGVDVPEAVKEAQEYTWQSLNSGFRPGMGQFIPDRLFWARGEDDETPLDVGS"
FT   gene            182702..183334
FT                   /locus_tag="Galf_0152"
FT   CDS_pept        182702..183334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0152"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /note="KEGG: slt:Slit_0040 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54197"
FT                   /db_xref="GOA:D9SIE0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE0"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADL54197.1"
FT                   /translation="MKAKISGLYAITPEEPDTVQLLDKVRCALQGGVNLLQYRNKLSVP
FT                   AVRGEQASALRQLTREFGVPLIINDDAVLAQQVDADGVHLGGEDGSIAAARQVLGFDKI
FT                   IGVSCYNRLSLAQQAEDLGADYVAFGAFFASSVKPDASVAELSLLQKARGVIALPVVAI
FT                   GGITLENGASVLEAGADALAVISALFSAPDITLAARQFANLNTQLSV"
FT   gene            183346..184641
FT                   /locus_tag="Galf_0153"
FT   CDS_pept        183346..184641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0153"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="KEGG: slt:Slit_0039
FT                   glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54198"
FT                   /db_xref="GOA:D9SIE1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE1"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADL54198.1"
FT                   /translation="MTSHPISQNQSLFDASQLRIPGGVNSPVRAFRSVGGTPLFFQKGS
FT                   GAYVWDADGKRYTDYVGSWGPMIAGHCHPDVVKAVQDAAANGLGFGAPTASELEIAELL
FT                   CKLLPSLEMVRLVSSGTEATMTAIRLARGFTNRSRIIKFEGCYHGHSDGLLVKAGSGAL
FT                   TFGQPSSSGVPAEIAALTTVLDYNDAAGLERAFAESGNEIAAVIVEPVAGNMNLITPKR
FT                   EFLDALRNLCTKYGAVLILDEVMTGFRVSLQGAQGYYGIKPDLVTLGKVMGGGLPAAAF
FT                   GGRRDIMQCLAPLGSVYQAGTLSGNPVAVAAGMATLKLVQEPGFYENLSKLATRLTTGL
FT                   TASAKKHGVEFCAQSVGGMFGLYFSRAVPTSYAEVMACDKEAFNRFFHAMLDAGVYLAP
FT                   SAFEAGFVSSAHTEADIDETIAAADSIFSVWK"
FT   gene            184641..185267
FT                   /locus_tag="Galf_0154"
FT   CDS_pept        184641..185267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0154"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="KEGG: slt:Slit_0038 ribosome biogenesis GTP-binding
FT                   protein YsxC; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54199"
FT                   /db_xref="GOA:D9SIE2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE2"
FT                   /inference="protein motif:TFAM:TIGR03598"
FT                   /protein_id="ADL54199.1"
FT                   /translation="MGLFSLAAFYTTVNHIKDLPMHGGREVAFVGRSNAGKSSAINTLA
FT                   NHVRLAYTSKTPGRTQHLNYFSLGNDGYIVDLPGYGYAKVPPEAKRHWEALLSTYLQKR
FT                   EELSGLIVIMDIRRPLLELDETMLDWFATTGKPVHILLTKSDKLSRQQSTLTLMKVKAY
FT                   LAENYPQCSVQLFSSLKKQGLEEAEAVIAGWLKADVVAEDETAEE"
FT   gene            185419..186420
FT                   /locus_tag="Galf_0155"
FT   CDS_pept        185419..186420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0155"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="KEGG: slt:Slit_0037 porphobilinogen synthase; PFAM:
FT                   delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54200"
FT                   /db_xref="GOA:D9SIE3"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE3"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADL54200.1"
FT                   /translation="MQTLGQYPNKRMRRMRHDAFSRNLMRENVLTSADFIYPVFVLEGT
FT                   NTVEDIKSMPGVQRKTLDLLLKDAEACVKLGIPVMAIFPVVDASKKSLDAREAYNPDGL
FT                   VPRVVATLKKHYPELGIMTDIALDPYTSHGQDGLIDEAGYVLNDETIAVLTRQAQTHAA
FT                   AGADIVAPSDMMDGRIGAVRAALDEHGHIHTRIMAYSAKYASSFYGPFRDAVGSSTNLG
FT                   AGNKYTYQMDPANSDEALWEVGMDLQEGADMVMVKPGMPYLDILRRVKDEFKAPTFVYQ
FT                   VSGEYAMLKAAAQNGWLNEEACVLESLLAFKRAGADGILTYFALDAARWLQK"
FT   gene            complement(186514..187107)
FT                   /locus_tag="Galf_0156"
FT   CDS_pept        complement(186514..187107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54201"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE4"
FT                   /inference="similar to AA sequence:KEGG:Slit_0106"
FT                   /protein_id="ADL54201.1"
FT                   /translation="MPHSSKRDLMREQLAHQAAKLIAEAGAADFASAKHKAARQLGATD
FT                   TRHLPSNKQILDALQSYRALYQSDSHPDVLQRLRREALDCMHLFSVFNPYLTGSVLNGA
FT                   AGENSDINLMLFSDDAKAVLLFLLKTKLDFEDGEWRLKLGGTESTVPSYTLTGESGTQI
FT                   HIVVLPENARHSGARHPETHADIAALTKMLERQD"
FT   gene            complement(187120..189429)
FT                   /locus_tag="Galf_0157"
FT   CDS_pept        complement(187120..189429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0157"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="KEGG: slt:Slit_0107 penicillin-binding protein, 1A
FT                   family; TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54202"
FT                   /db_xref="GOA:D9SIE5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE5"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADL54202.1"
FT                   /translation="MTTRRWLLPVIVLLTLLSLPVLLLGMAVMLTYPSLPSLEVLTDYH
FT                   PKVPLRIYSAEGTLLGEFGEERRALVKIADVPDAMKKAILAAEDDRFYQHGGVDYMGVM
FT                   RAALSNFTAGGSKQGASTITMQVARNFFLSKEKTFTRKFNEMLLAFKIEHYLSKDDIFQ
FT                   LYINQIYLGQRSYGFAAAAQIYFGKPLNQISIAEAAMLAGLPKAPSSYNPVVNPKRAKL
FT                   RQMYVLRRMHELHFINDEQFKIAQNQPLSTKHGNQEFSVKSDYLTEMVRQAVYQKYQEA
FT                   TYTEGFKVYTTIRSQDQLAAYQAVRRGVLEYDRRHGYRGPEGYTDLQQNHGEEAFEEAL
FT                   QETTDNDDLLPAIVLATSATQIQAYCKGGEHISISGEALRFAQRALTDKVALNQRIVPG
FT                   SIIRVQKTDQGTWQISQLPQVESAFVSGNPVDGAIYALVGGFDFNHNQFNHITQAWRQP
FT                   GSSFKPFIYSAALEKGFTPATLINDGPLTFGSDQTGSEPWQPKNYDGKFEGPMRMRQAL
FT                   IKSKNMVSIRILQSITPRYAQDYITKFGLDAAKHPPYLTMALGAGSVTPLQMLTGYSVF
FT                   ANGGFRVYPYFIQRIEDAQGRKLSQAMPTVANVNAEPVIDVRNAFTMVNMMQDVVKHGT
FT                   AIRAMQLGRQDLAGKTGTTSDSIDAWFCGFQPTVVGIAWMGFDQPRSLGDKETGGGAAL
FT                   PIWINYMEKVLKNVPQAEYSMPENMVAARINESGHRDENGARVEYFYQENVPGGQGSPV
FT                   IPDGDKPAEAIKDQLL"
FT   gene            189580..190683
FT                   /locus_tag="Galf_0158"
FT   CDS_pept        189580..190683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0158"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="KEGG: slt:Slit_0108 type IV pilus assembly protein
FT                   PilM; TIGRFAM: type IV pilus assembly protein PilM; PFAM:
FT                   cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54203"
FT                   /db_xref="GOA:D9SIE6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE6"
FT                   /inference="protein motif:TFAM:TIGR01175"
FT                   /protein_id="ADL54203.1"
FT                   /translation="MPKVNFDFFVDFIQSKAPPLIGVDISSSSVKLVELSQAPNNGGYV
FT                   VERYVIETLPKDAFFDGNINNLDALADALQRAWKRLGTKIKNISVALPASAVITKKILL
FT                   PAGMRDEDLEFQVESEANQYIPFALDEVNLDFQVLGPAPGNADEVEVLLAASRKANVED
FT                   RVAAAQAAGLKVSVVDVEPYAAEAAFSQIRAQLPDNADDKCVALIDIGATVMNVNVLRN
FT                   GQSIYTRDQQIGGEQLTLQIQNAFGMTAEQAEVAKRSGDLPANYDSEVLSPFRENLVME
FT                   IARALQFFFTSSQHYNEIDYIVLAGGCAVLPGLDDAVATRTQVSTMVANPFALMTLSGK
FT                   IKNRQLQADAPALIVACGLAMRRFDPS"
FT   gene            190680..191270
FT                   /locus_tag="Galf_0159"
FT   CDS_pept        190680..191270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0159"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   slt:Slit_0109 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54204"
FT                   /db_xref="GOA:D9SIE7"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE7"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ADL54204.1"
FT                   /translation="MIRINLLPHREEKRRIKQVQFITLGVLSFVLGLVVWGVVHAVISA
FT                   QIGYQERRNDYLKQETLILDKQIAEIRKLREQTRSLLERKDAVEKLQSDRSNVVHLLDQ
FT                   MLRILPDGVYIKSIKQTGDAINLVGFAQSNARVSTLMRAIEDSPWLESPALVEIHASSA
FT                   NGARVSEFTLTFRLTKLPGAEAAKSAEGRNQVQ"
FT   sig_peptide     190680..190805
FT                   /locus_tag="Galf_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.775 at
FT                   residue 42"
FT   gene            191267..191893
FT                   /locus_tag="Galf_0160"
FT   CDS_pept        191267..191893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0160"
FT                   /product="pilus assembly protein PilO"
FT                   /note="KEGG: slt:Slit_0110 pilus assembly protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54205"
FT                   /db_xref="GOA:D9SIE8"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE8"
FT                   /inference="similar to AA sequence:KEGG:Slit_0110"
FT                   /protein_id="ADL54205.1"
FT                   /translation="MMNLEELKNLNPKTPGAWPWSAKILSFVMMFVAVVIAGALLDWQE
FT                   QWDSLNAAKAQEETLKETFLSKKRQAVNLDLIKKQLLETQESFGALLKQLPNKSEMDAL
FT                   LTDINQAGLGRGLQFELFRPGPESIQGSFAEQPISIKVTGSYDDLGKFSSDISMLPRIV
FT                   TLNEIAITPNAGILTMDAIAKTFRYLDDEELASQKKANKPAGGGK"
FT   gene            191890..192405
FT                   /locus_tag="Galf_0161"
FT   CDS_pept        191890..192405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0161"
FT                   /product="Pilus assembly protein PilP"
FT                   /note="PFAM: Pilus assembly protein PilP; KEGG:
FT                   slt:Slit_0111 pilus assembly protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54206"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIE9"
FT                   /inference="protein motif:PFAM:PF04351"
FT                   /protein_id="ADL54206.1"
FT                   /translation="MKLISVVLASLLLTGCVGEEFSDLREFVKNSGNDLRGKIPPPPVV
FT                   KIFEPYAYVNDTNLADPFKPRKPEENLGDKRGENEPDRNRPKEALEEFSLESLKMVGYV
FT                   LKAKVGHAVIRAPDKKLYQVKVGNYIGMNFGLIKKLTDTEITIKEVVQDSTGDWSERTS
FT                   SLQLVDKE"
FT   gene            192409..194526
FT                   /locus_tag="Galf_0162"
FT   CDS_pept        192409..194526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0162"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="KEGG: slt:Slit_0112 type IV pilus secretin PilQ;
FT                   TIGRFAM: type IV pilus secretin PilQ; PFAM: type II and III
FT                   secretion system protein; NolW domain protein; Localisation
FT                   of periplasmic protein complexes; Secretin/TonB short
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54207"
FT                   /db_xref="GOA:D9SIF0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF0"
FT                   /inference="protein motif:TFAM:TIGR02515"
FT                   /protein_id="ADL54207.1"
FT                   /translation="MDMTRKIAVIAAKAAIVSLLMMFGQAAQAQNKITALSVSEAGPGL
FT                   TVIKVEMAEALSNPPAGFTINVPPRIALDFPNTENALGRSAQDFSAGDLRSANIVQAGS
FT                   RTRLVINLNQMLGYETRTDGKNILITLHAKQAAQAAPSATRFADARQTAQKHTVSAVDF
FT                   RRGKNGEGRIQVDLSDSGVGIDIHRQGNKLIVDFMKANLPGKLQRKLDVVDFATPVQLV
FT                   DTFAQGDNIRMVIEPKGIWEHAAYQTDNKFIVEVKPVIEDPNKLVKGVQAGYAGEKLTL
FT                   NFQDISVREALNVIADFTELNMVISDTVAGNLTLRLKDVPWDQALDIILQSRGLAMRKN
FT                   GNVIQVAPIGEIAASEKSDLTAKQDISELEELRTESFQLGYQTATAAAALLNGISAPGA
FT                   TAQGAAPAAAVPVAGAPNQAALARILSKRGSAMADVRTNTLFVKDTPSRLEEVRKLLKQ
FT                   IDVPVRQVMIEARFVSAGDSFARSLGGKLGYASPANAANGGAATTGAINGVNVNLPNSL
FT                   AGTGGGLLLSLFNPAATKVLTLELNASETDGITKNIASPRVVTADKTKASIKSGVEIPY
FT                   TIAGTVGSPPTTAFKTAALSLDVTPRITPDNNINMTLVASQDTVGALYSGVPSINSKMV
FT                   TTEVLIENGGTVVVGGVFTQDVADTVNKVPLLGDIPVLGWMFKNKVKTDAKNELLIFIT
FT                   PKIMQDSMNLR"
FT   sig_peptide     192409..192498
FT                   /locus_tag="Galf_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.753 at
FT                   residue 30"
FT   gene            194604..195167
FT                   /locus_tag="Galf_0163"
FT   CDS_pept        194604..195167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0163"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: slt:Slit_0113 3-dehydroquinate synthase; PFAM:
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54208"
FT                   /db_xref="GOA:D9SIF1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF1"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADL54208.1"
FT                   /translation="MQNSPTNSTRKIQSGNLILVGMMGSGKTTMGRILARHLNKVFVDS
FT                   DEEIQFRTGVTIPHIFDVEGEPGFRQRETDALAALVVRNDLVLATGGGAVLAPENRAMM
FT                   SENGIVIYLKANVHDLWLRTRNDRNRPLLQTGNVHAKLAELLQQRNALYQQVADIVMPT
FT                   GRQSVHALMLKLVNEIELYRKNNQ"
FT   gene            195164..196288
FT                   /locus_tag="Galf_0164"
FT   CDS_pept        195164..196288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0164"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; KEGG:
FT                   slt:Slit_0113 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54209"
FT                   /db_xref="GOA:D9SIF2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF2"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ADL54209.1"
FT                   /translation="MMQTLTVGLSDRSYPIHIGTGLLSNAALLAASIPRKRVAIVTNTT
FT                   IAPLYLSQLQATLREIGVQSVEIILPDGEVYKTGETLNLIYDGLLTHRCERTTPLIALG
FT                   GGVIGDMTGFAAASFLRGVPFIQIPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPKL
FT                   VLADISTLNTLSDKELSAGLAEVIKYGLIRDLPFLEWLERNIEKLLARDTEALQYAVMR
FT                   SCQNKAEVVAADERESGERALLNLGHTFGHAIESGMGYGNWLHGEGVAAGTMMAADLSQ
FT                   RMGWISTDDVLRIRDLFLRANLPVVSPDLGIDRYLDYMGLDKKVEGGKLRFVLLKQVGV
FT                   AALVSDVPLALLQQTLVACCSKGGPGTNWLHEDK"
FT   gene            196288..197424
FT                   /locus_tag="Galf_0165"
FT   CDS_pept        196288..197424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0165"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase; PFAM: metal-dependent phosphohydrolase
FT                   HD sub domain; KEGG: slt:Slit_0114
FT                   deoxyguanosinetriphosphate triphosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54210"
FT                   /db_xref="GOA:D9SIF3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF3"
FT                   /inference="protein motif:TFAM:TIGR01353"
FT                   /protein_id="ADL54210.1"
FT                   /translation="MTELASYAVSEVNSRGRRYAEASPSGRSEFQRDRDRIIHSGAFRR
FT                   LEYKTQVFVNHEGDLFRTRLTHSIEVAQIARSIARRLNLNEDLAEAISLAHDLGHTPFG
FT                   HAGQDALNGCMKAYGGFEHNLQSVRVVDILEERYATFDGLNLCFETREGILKHCSALHA
FT                   TQMGELGERFLADRRPSLEAQIANLADEIAYNNHDVDDGLRSGLITLEQLAAVPLVAEH
FT                   LQEVRCAHPDLTQRRVVHETVRRMINTLVSDLICQSAANIAAQNLLTLEDVRCAPALIA
FT                   FSDELYLKQRELKKFLHTHLYRHYRVMRMSAKAQRIIRDLFGVFMEDSRLLPTQFQTAA
FT                   AKDEASRARVVADYIAGMTDRYAIREHKRLFAVEEDAI"
FT   gene            complement(197502..201557)
FT                   /locus_tag="Galf_0166"
FT   CDS_pept        complement(197502..201557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0166"
FT                   /product="putative Tfp pilus assembly protein
FT                   tip-associated adhesin PilY1"
FT                   /note="KEGG: dar:Daro_3036 putative Tfp pilus assembly
FT                   protein tip-associated adhesin PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54211"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF4"
FT                   /inference="similar to AA sequence:KEGG:Daro_3036"
FT                   /protein_id="ADL54211.1"
FT                   /translation="MSHHLKNHLSLYIALSISLMSPLPASAASITLATSPLATSTTSSV
FT                   KPNVLLVMDNSGSMDWDHMPDDSGDGGSAVTFSYGYYGLRSSQCNQVYYDPTDTYLPPV
FT                   YADGTSYPNASFTAAWTNGFNTGSGTVNLSTSFRASQSLSGDSINQPAYYYRYSGTQTT
FT                   ALQKNYNTPGNTFSTECGNSSGGSGGSTAPASGVGGLFTKVTVSATSGPGATDERTNFA
FT                   NWYSYYRTRLLMMKTATGRAFKNLDKNYRVGFMKISSSGAPTTYVDTFWNNTDSSLGAV
FT                   SSQRSNWYNALYNTSSSGSTPLRTALSDAGLYYAGQLYTIDSTHPDPVQYSCQQNFAIM
FT                   STDGYWNTGNGYQMDGSSAVGNQDGTAARPMNDGAQTGTTVVTTYTQNVYSAVKSNCSS
FT                   KKKKLQTQPKTGTCSVTTVGGVTGAESCSWVNDGSASVSGSCVSTVSLPNPNPSARVQV
FT                   GSPVTTPGSVGGTSNNLADVAMYYYQTDLRPGTCTLCTDNVFISSTDNNVKQHMTTFTL
FT                   GLGASGWMNYSSSYTVDTLGDYVSVKQGYTANSAANPPICSWQANGTTCNWPIPGMTDT
FT                   AGTCTNASTGSNGCIANIDDLWHAAVNGHGVYFSATNPATLSAGLSGALAGINSRKGSA
FT                   AAAATSTLNPVTGNNFAYVASYTTVAWKGNLEARGINVDTGIVSENATWCIEDVVATTC
FT                   AAPSTIFTDTTGGTTIYDCVTPGVASCPNGYLVPANTNDANGILIPEGCHVPLATACNG
FT                   TLPAMVGSSSDSRTIYTSNGTTLTPFNAAYATANPTNFSSAHINTLSQWPLLTATQQTA
FT                   AAGTNLINFLRGQKAYEANAAIATNQLYRYREAVLGDALESQPAYLGAPVYSYTYPGYS
FT                   AFKSLYASRAGTVYMGANDGMMHAFAADTGIERWGYVPSMVIPNMWKLADKNYGAQHAN
FT                   FVNGSPITNDICTANCNNANYAATATTADDPVWKTILVGGLNGGGRGYYALDISNPDAP
FT                   SLLWEFSPASDSDLGYSYGPPVVTQKADGTWVVLLTSGYDNGTLSHDPAVNNSPAGNGQ
FT                   GYLYVLNAGTGAIISKISTGVGTATTPSGLAKIAAWNNDVAGNLAGYVYGGDLLGNVWR
FT                   FDINSTASAALGTGSVLKFAALYSDTAGTLPQPIMTTPVLGSVTGRRVIFVGTGKYLEQ
FT                   ADLSTTQTQTQYAILDDNAASTLVNPRNSLVAQTLSTNGAIRTVSSNGMSFSTSRGWYI
FT                   DFPESGERVNIDSQLVLGTLLVPTIVPSNTVCSPGGHGWLNYIDFQTGAAVDLTSNMSS
FT                   LKFDSTIVGVNVIYIDGKPKVRIVTSTNPTPEVPKDSSGNDLSDKMFNLNQGYGFTGKR
FT                   VLWRELIP"
FT   gene            complement(201567..202232)
FT                   /locus_tag="Galf_0167"
FT   CDS_pept        complement(201567..202232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_3037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54212"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF5"
FT                   /inference="similar to AA sequence:KEGG:Daro_3037"
FT                   /protein_id="ADL54212.1"
FT                   /translation="MKHLSKSASYAKQRGIALFFALIALLAISLAAVALIRSVDTSTLI
FT                   AGNLAFKQSATTSGDAGVEAAMSWMSTIETANAGLSVLTQIAHPFNNTGGIAGALNPGY
FT                   YSSLDATLSLTDGTGIQWNANDSCGTGPNCADAVDPSGNTTRYIIQRMCRNANQLVPAA
FT                   NCLFSGAALDNGGHATPLPQNVCIGEGCPSSGQAPQNRITSRTTGPRNTVSYIQAFVY"
FT   sig_peptide     complement(202128..202232)
FT                   /locus_tag="Galf_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.734 at
FT                   residue 35"
FT   gene            complement(202229..203323)
FT                   /locus_tag="Galf_0168"
FT   CDS_pept        complement(202229..203323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54213"
FT                   /db_xref="GOA:D9SIF6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF6"
FT                   /inference="similar to AA sequence:KEGG:M301_2618"
FT                   /protein_id="ADL54213.1"
FT                   /translation="MSSKHLPLRQSGFTLVELMVGMTIGLLVAVIILQVLSVFEAQKRT
FT                   TTGTADAQTNGSIALFNIGRELQQGGYPLVPITNPALKCTAVTVGGIADTISRLSPVTL
FT                   TDGTSDSLTVRYGDSLMGGVPTQTAALPAGSLSTAAPARDVTVLNNFGCSTSSDVILIS
FT                   SGSNCALSSGFATSGTTSTITFADATDADTLTTAAIIAAPPGVTNIACLGSWHEVSYRV
FT                   NAGNLERQDGIASAFVANVAGIVNIQAQYGISATANSNQVIQWVDPSGGTWAAPTTANR
FT                   NLIKAIRIAVVARNAKMEAGNVSSACSSTTASSPTGLCAWAGNAVSPAPAIDLSADANW
FT                   RRYRYRVFETILPLRNMIWSKDTL"
FT   gene            complement(203328..203699)
FT                   /locus_tag="Galf_0169"
FT   CDS_pept        complement(203328..203699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmb:Mmol_2272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54214"
FT                   /db_xref="GOA:D9SIF7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF7"
FT                   /inference="similar to AA sequence:KEGG:Mmol_2272"
FT                   /protein_id="ADL54214.1"
FT                   /translation="MIPAPNLKSSQQGIVILEAMIAILIFSMGVLAIVGLQAAMLKNTV
FT                   DSEFRTDASYIAQQRIGQMWTDPANLASYVQAATAIPELPNGTLAVTQSGTQYTVTVTW
FT                   QQPGQIQHNITTTANINGG"
FT   gene            complement(203714..204226)
FT                   /locus_tag="Galf_0170"
FT   CDS_pept        complement(203714..204226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0170"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: dar:Daro_3040 general secretion pathway
FT                   protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54215"
FT                   /db_xref="GOA:D9SIF8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF8"
FT                   /inference="similar to AA sequence:KEGG:Daro_3040"
FT                   /protein_id="ADL54215.1"
FT                   /translation="MNTYNKSRGFSLIELMVTIVVMAILASVAVPNFQSWLRNTQIRNA
FT                   AESVTNGLQRARAEAVSRNTKITFVLGADTGWTVTVVSTATDIERRLAAEGSKNVTRTV
FT                   LPATSSTVTFNSFGLIDAANADGSVPFNQVDLTATGSNQPLRVTIGTGGNAKMCDPALP
FT                   SSNPRGC"
FT   gene            complement(204223..204618)
FT                   /locus_tag="Galf_0171"
FT   CDS_pept        complement(204223..204618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0171"
FT                   /product="type IV pilus biogenesis protein PilE"
FT                   /note="KEGG: tmz:Tmz1t_2663 type IV pilus biogenesis
FT                   protein PilE"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54216"
FT                   /db_xref="GOA:D9SIF9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIF9"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_2663"
FT                   /protein_id="ADL54216.1"
FT                   /translation="MSKQRGFTLVELLVVIAVIGILASIAIPSYSDYSIRGKLIEGTSQ
FT                   LSDARVKMEQFYQDNRTYAGGTCPAATANFTYACSNLTTTTYTITATGKSALSTYSYTI
FT                   NESNVKASTTPWGDNTTCWVTNKGGGC"
FT   gene            complement(204788..205333)
FT                   /locus_tag="Galf_0172"
FT   CDS_pept        complement(204788..205333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_2910 TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54217"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG0"
FT                   /inference="similar to AA sequence:KEGG:Lcho_2910"
FT                   /protein_id="ADL54217.1"
FT                   /translation="MKSRFLHNESARIAIALGLSVLAHIAILTLQPHFNAAPFAHQTTG
FT                   KTLSVTLNKNSAKTPPRPSTINLTSTLKPAITPSSPAAAATSDTHYFNTNELDQPPHTD
FT                   QDQLAFNLPDPPKQIDIVMRLWIDKSGKVVKVEPVTAELSQALISEIRSHLMNSRFSPG
FT                   HRLGYPANSVVEITLHYE"
FT   gene            complement(205385..205834)
FT                   /locus_tag="Galf_0173"
FT   CDS_pept        complement(205385..205834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sha:SH0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54218"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG1"
FT                   /inference="similar to AA sequence:KEGG:SH0326"
FT                   /protein_id="ADL54218.1"
FT                   /translation="MTNISGLSSSNIAAYSAPAQKPSAVSSAATSASPSTVSLLNSSTS
FT                   STPLTYNATGQLNASTQSTTNAMQAAQNAMLATQNALTQTLDSLMSGSQSGASTIDMFG
FT                   NTTDTNDPLAANTPAATSGGITAQAAQSAYLATQNIVTQSLNSIK"
FT   gene            206126..210784
FT                   /locus_tag="Galf_0174"
FT   CDS_pept        206126..210784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0174"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: slt:Slit_0115 glutamate synthase (ferredoxin);
FT                   PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase; ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54219"
FT                   /db_xref="GOA:D9SIG2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG2"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADL54219.1"
FT                   /translation="MVNSSLPMQQGLYDPRQERDACGVGFVAHIKGKKSHDMVSQGLQI
FT                   LENLTHRGATGADPLAGDGAGILLQIPDAFFRVQCAARGLALPEVYGVGMLFLPTDVAA
FT                   RAACEQIIADKIAAEGQILLGWRDVPVNSAILGESVKLVEPTVRQVFIGCGANCIDTDS
FT                   FERKLFVIRKTAEHAVNALPNVQGFYIPSLSARTIVYKGMLLADQVGKYYPDLQDSTLV
FT                   SALALVHQRFSTNTFPSWDLAHPFRMIAHNGEINTVRGNVNWMAARHAAMSSKLLGEDL
FT                   EKLWPLIVDGQSDSACFDNALELLVAGGYSLPHAMMLLIPEAWAGNPLMDEERRAFYEY
FT                   HAALMEPWDGPAAVAFTDGKMIGATLDRNGLRPARYLITDDDVVLLASEMGVLNIPQHK
FT                   VVKKWRLQPGRMFLIDMEAGRIIDDSELKTQLATAKPYRQWIDESRFFLGDLPSTVSEV
FT                   KLAASLLDTQQAFGYSQEDIKFILAPMIAAGEEPTGSMGTDAALAVLSNKNRSFFDYFQ
FT                   QLFAQVTNPPIDPIREEIVMSLTSFIGPKPNLLGIEETVPSLRLEVHQPVLSNDDIARL
FT                   RNIDALTQGRYRSLVLDITYPATEGAAGCEASVMALCAAADRAVADGYNVLILSDRSMS
FT                   AERVAIPALVACSKVHQHLVREGLRTSTGLVVDTGSAREVHHFALLAGYGAEAVCPWLA
FT                   FETIMAMSAASGTDAKEAKKRFIKAIDKGLMKVMSKMGISTYQSYCGAQIFEAIGLNAS
FT                   FVAQYFTGTATQIEGIGLSEVAEEALRNHKDAFGKDPVLANALDAGGEYAYRVRGEEHM
FT                   WTPDSIAKLQMATRTNNASTYKEYAKLINDQSTKLKTLRGLFEIKSVGASVPLDEVDSA
FT                   ASIVKRFVTGAMSLGSISTEAHTNLAIAMNRIGGKSNTGEGGEDAARFAVLKGGEMLSD
FT                   IIGKSRIEADREMLAGDSLRSKIKQVASGRFGVTAEYLASADQIQIKMAQGAKPGEGGQ
FT                   LPGHKVSEYIAKLRFSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNSNPSASISVKLVS
FT                   EVGVGTVAAGVSKAKADHIVVSGFDGGTGASPLSSIKHAGTPWELGLAEAQQTLVLNQL
FT                   RGRVALQVDGQLKTGRDVLIGALLGADEFGFATAPLVVQGCIMMRKCHLNTCPVGVATQ
FT                   DPELRRKFTGQPEHVVNYFFFVAEEVRELMAQMGIRRFVDLIGRSDLLDVKHSIAHWKS
FT                   QGLDFSKVFHQPAVAASVARQHAEQQDHELDRALDNTLIAGAKAALENQVAVVIESPIR
FT                   NVNRTVGTMLSHQVARRYGNAGLPADTIRVNFKGTAGQSFGAFLSHGISFELRGEGNDY
FT                   VGKGLCGGRIAIMPPAEAKLVASENIIVGNTVLYGATSGECYFNGVAGERFAVRNSGAI
FT                   AVVEGLGDHGCEYMTGGMVIVLGQTGRNFAAGMSGGVAYVLDETGDFEKRCNLTMVALE
FT                   PVEEELATLDSTDELPSSHGRVHFNHLNKADEHALREQIEKHLLYTGSERARMVLENWA
FT                   DYLPKFTKVMPTDYRRALQEQAAENVKNGEAA"
FT   gene            210784..212238
FT                   /locus_tag="Galf_0175"
FT   CDS_pept        210784..212238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0175"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="KEGG: mei:Msip34_2804 glutamate synthase,
FT                   NADH/NADPH, small subunit; TIGRFAM: glutamate synthase,
FT                   NADH/NADPH, small subunit; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54220"
FT                   /db_xref="GOA:D9SIG3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG3"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ADL54220.1"
FT                   /translation="MGKPTGFMEFDRLSEASLPVADRLANYNEFVLHLTDDQAKTQGAR
FT                   CMDCGVPFCTSGCPVNNIIPDWNDLVFRGNWRAALDVLHSTNNFPEFTGRLCPAPCEAA
FT                   CTLNINNDAVGIKSIEHAIIDKGWENGWVVPQVPAQKTGKKVAVVGSGPAGMACAQQLA
FT                   RAGHDVTVFEKNSRIGGLMRYGIPDFKMEKSHIDRRVAQMEAEGVTFKTSTFIGSECEA
FT                   GVNNMAVATISPEALLAQFDAVVLSGGAETPRDLPVPGRELSGIYNAMQFLPQQNRVNA
FT                   GDVLPEQLRATGKHVVVIGGGDTGSDCVGTSNRHGALSVTQIEVMPRAPEQENKPLTWP
FT                   NWPLKLRTSSSHEEGCNRDWAIATKEFVGSNGKLEKIRAVRVEWQAGKMIEIASSEFEL
FT                   KADLVFLAMGFVSPVQKVLEAFGVEKDARGNIKANTDDYRTSVERVFTAGDMRRGQSLI
FT                   VWAIREGRQCARSVDEFLMGSSVLPR"
FT   gene            212288..213352
FT                   /locus_tag="Galf_0176"
FT   CDS_pept        212288..213352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0176"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="TIGRFAM: uroporphyrinogen decarboxylase; KEGG:
FT                   slt:Slit_0117 uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54221"
FT                   /db_xref="GOA:D9SIG4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG4"
FT                   /inference="protein motif:TFAM:TIGR01464"
FT                   /protein_id="ADL54221.1"
FT                   /translation="MNFKLKNDTFLRALLRQPTEYTPLWMMRQAGRFLPEYRATRARAG
FT                   SFLGLCKNPDFATEVTMQPLDRYPLDAAILFSDILTVPDAMGLGLYFADGEGPKFERPL
FT                   RDEAAIMALQVPDIDKTLRYVTDAVSQIRKTLDGRVPLIGFSGSPFTLSCYMVEGGGSD
FT                   DYARVKTLMYNEPKLMHHILEVTTQAVIAYLNAQIEAGAQAVMIFDSWGGVLSHSAYHE
FT                   FSLPYTQRIVEGLIKEKDGVRIPNVVFTKGGGLWIDSIAATGCDAIGLDWTMDIGVARQ
FT                   KVGNKVALQGNLDPAVLFANPNAIRNEVEKVLSSYGYGSGHVFNLGHGISQHTNPEHVA
FT                   AMVAAVHELSRKYH"
FT   gene            214049..215572
FT                   /locus_tag="Galf_R0001"
FT   rRNA            214049..215572
FT                   /locus_tag="Galf_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            215639..215715
FT                   /locus_tag="Galf_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            215639..215715
FT                   /locus_tag="Galf_R0002"
FT                   /product="tRNA-Ile"
FT   gene            215734..215809
FT                   /locus_tag="Galf_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            215734..215809
FT                   /locus_tag="Galf_R0003"
FT                   /product="tRNA-Ala"
FT   gene            216152..219045
FT                   /locus_tag="Galf_R0004"
FT   rRNA            216152..219045
FT                   /locus_tag="Galf_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            219212..219325
FT                   /locus_tag="Galf_R0005"
FT   rRNA            219212..219325
FT                   /locus_tag="Galf_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 51.10"
FT   gene            219447..221621
FT                   /locus_tag="Galf_0177"
FT   CDS_pept        219447..221621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0177"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; KEGG:
FT                   slt:Slit_0118 primosomal protein N'; SMART: DEAD-like
FT                   helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54222"
FT                   /db_xref="GOA:D9SIG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG5"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ADL54222.1"
FT                   /translation="MQIVRVALDVPLPTLFDYTVDDAVVLGQRVIVPFRRSQLVGVVME
FT                   CVMFSELAVEKIKPVVRILSDSEPISSKLLALLRFCSEYYHYPIGQTVIPALPARLRSD
FT                   KPITVKHEYHYRLLDGAPPIDLIPQRKTAARNMVKMLALQPCNLQQLKTVALTASAQLK
FT                   WLIEAGWVEAFEVNPLACLPRMHCFANAHKLTDEQQQVVDAVTQTSGYRCFLLHGITGS
FT                   GKTEVYVHLINRVLQTGGQVLLLVPEINLTPQLEHYFLSRFPVATLVSLHSGLSENERL
FT                   KHWQQAQSGAAGIVLGTRLSVFAELPKLSLIIVDEEHDASFKQQDGLRYSARDVAIFRA
FT                   KQCGVPILLGSATPSFESYHNALNGRYEMLKLTGRALADANLPEIKFIHSKQTVMVDGI
FT                   SEVLLREIAHRITRGEQSLLFINRRGYAPVLMCTECGWLSDCKNCAGKMVLHTKDQRLR
FT                   CHHCGYQIHVPTLCPECRHPELLPVGSGTQRVERVLIDRFPEARILRVDRDSTRNKRTW
FT                   EAMRSKITANEVDIMVGTQMLAKGHDFPALTLVGILNPDSALYSSDFRAAEKLFSQLMQ
FT                   VSGRAGRADKPGEVLIQTEFPDHPMYRCLQQHDFEGWAASQLAEREMADFPPFAFQAML
FT                   RAEGLVEADVYAYLNMAKLAGVKLNHPVEIFGVVPASLARRANHVRAQLLIQANSRRVL
FT                   QQFLRVWQPGLADLASNKLRCSLDIDPLEF"
FT   gene            221650..222393
FT                   /locus_tag="Galf_0178"
FT   CDS_pept        221650..222393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54223"
FT                   /db_xref="GOA:D9SIG6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG6"
FT                   /inference="similar to AA sequence:KEGG:MCA1787"
FT                   /protein_id="ADL54223.1"
FT                   /translation="MAAVEGHIVPKRFYDRTISEKLLYTCFLSLVGLGYLMATAYLYVT
FT                   HEMNDTKPGLSVADVANSYYGNRSGTRLEAAIRGPMSGNISPEDSEVMVAWLKDGAEEE
FT                   HFAKDIKPILDKTCLACHVQASGMNIADFSTYQGLHKFAEVDTGMSMASLLKLSHIHLF
FT                   GISLLLFMLGSIFIQCEINVWFKRFLVVSPMLAVFVDVLSWFLTKYDSHYAVIVIAAGG
FT                   LLGMSMALQILISLYQIWTLKRPVH"
FT   gene            222396..223799
FT                   /locus_tag="Galf_0179"
FT   CDS_pept        222396..223799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0179"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   slt:Slit_0120 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54224"
FT                   /db_xref="GOA:D9SIG7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG7"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADL54224.1"
FT                   /translation="MQEAFIQSAITIAGREAVLTGDAMTAYCEDWRGRYSGAALAVLFP
FT                   ANTLQVSEIVKLCVANQVAIVPQGGNTSLCGASVPVSQGRQVVLNLSRMNKIRVVDAIN
FT                   YTMTVEAGCKLAALYEAAEQANRLFPLGLTAIAAHCEIGGNLSTNAGGIGVLRYGSARD
FT                   LVLGLEVVLPDGRIWNGLRSLRKDNTGYDLKQLFLGAEGTLGIITVAVLKLFPRPQSTA
FT                   TACVAVASPEVAVRLLATIRASCGQALSGFEIISRNCLDLVFKHIEDAHEPFKKRYEWY
FT                   LLIKIDDVQQSSPAEAIRSALLNFGGDVLTFGIACDARQAELWWHLRKNISEAQKLEGV
FT                   SIKHDISVPVSRVAEFIAEASRVLRNRFVDLRIVAFGHMGDGNIHFNVSLLDAAVNDAF
FT                   IGQHEIEVNRLVYQVVQKLGGSISAEHGLGQLKRETIRDYKDPLELEMMRTIKHAFDPG
FT                   NLMNPGKVV"
FT   gene            224111..225787
FT                   /locus_tag="Galf_0180"
FT   CDS_pept        224111..225787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0180"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   slt:Slit_0126 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54225"
FT                   /db_xref="GOA:D9SIG8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG8"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADL54225.1"
FT                   /translation="MSVVLNFKSHITELFVEAMREVAPEQGSVSVLIERPKQASHGDYA
FT                   CNLAMQLAKPLRKSPRDIAHALIAALPKSDVIEKVEIAGAGFINLFVTHAAKQAIVHAV
FT                   LHAGAGYGHLHVGQGRRVQVEFVSANPTGPLHVGHGRGAAVGDCLCNVLQAAGWNVTRE
FT                   FYYNDAGAQIDNLMRSVQLRCKGITPDDPSWPEAGYRGDYIADVARAYMACETVEADDQ
FT                   RTTGCGDVDDVVAIRHFAVAYLRREQDLDLRAFHVEFDVFSLESALYSEGKVDETVAGL
FT                   IASGHTYEQDDALWLRTTDFGDDKDRVMRKSDGGYTYFVPDVAYHLDKWRRGFVRVINE
FT                   QGADHHSTITRVRAGLQALDVGIPKGWPDYVLHQMVTVLKNGEEVKISKRAGSYVTLRD
FT                   LIDEVGCDATRYFLAARHPDSQLVFDIDLAKSKSNDNPVYYIQYAHARISTVLETWGGE
FT                   RLSLLNANVSLLDSEYETALLQQIIDYPQVIENAAQELAPHLIAFYLKELAAAFHSYYN
FT                   ASRFLVEDEAVKCARLALIAAAAQVMKNGLALLGVGAPEKM"
FT   gene            225831..226421
FT                   /locus_tag="Galf_0181"
FT   CDS_pept        225831..226421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0181"
FT                   /product="Sporulation domain-containing protein"
FT                   /note="PFAM: Sporulation domain-containing protein; KEGG:
FT                   slt:Slit_0127 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54226"
FT                   /db_xref="GOA:D9SIG9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIG9"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADL54226.1"
FT                   /translation="MSKVTGSKPSSPKKSGSPLLAGILMGMVVGVALAAGLAWFILKSP
FT                   SPFVNKEVATRPAAEVSIVDVARPESVKPKVDVAAVSSVDEAKPRFEFYKVLTDKPDAA
FT                   DAQLKPAEKPKAEEFKSVPKFLQAGSFASATDAENLKATLAMKGMEASVQKVTIPGRGE
FT                   MHRVRIGPFTSEQELNSARGTLKLNGLDATPAR"
FT   sig_peptide     225831..225935
FT                   /locus_tag="Galf_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            226465..227103
FT                   /locus_tag="Galf_0182"
FT   CDS_pept        226465..227103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0182"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: slt:Slit_0128 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54227"
FT                   /db_xref="GOA:D9SIH0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIH0"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADL54227.1"
FT                   /translation="MKLSLKGLLVALALLMCGTSYAAVQGKEFTLLAAPQIANAKKIEV
FT                   LEFFFYECSHCYHLHPELARWEKALPADVELTLVPTIFRDSTEPLARAYYALDSIGKIK
FT                   QLDDAIYQAIHVKQANLYDMDTISAFVASNGVDKAKFAAAYNSFSVNSRIMRAKQMIRE
FT                   YHIEGTPTLVVDGRYAITGLQPADTIRVLNEVVAMVRKGRASGKVKAKP"
FT   sig_peptide     226465..226533
FT                   /locus_tag="Galf_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            227103..227867
FT                   /locus_tag="Galf_0183"
FT   CDS_pept        227103..227867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0183"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   slt:Slit_0129 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54228"
FT                   /db_xref="GOA:D9SIH1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIH1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL54228.1"
FT                   /translation="MSLKVVISGASSGLGLALARHYLMSGAIVGAIARRDELLQVLSAE
FT                   FPGQVYGYALDVRDAAGLQLAAANFIARVGVPDVVIANAGVSVGTLTEYAEDFDAFAQV
FT                   MEVNVLGMVKTFQPFLAAMRRERCGTLVGIASVAGFRGLPGAGAYSASKAAAVSYLESL
FT                   RVELHGSGVKVVTICPGYIKTAMTAVNPYPMPFILDADDAAARMVRAIGRQVAFAVIPW
FT                   QMGWVGRVLRCLPRWLYDRLFANAPHKPRGLL"
FT   gene            228183..228515
FT                   /locus_tag="Galf_0184"
FT   CDS_pept        228183..228515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0184"
FT                   /product="Protein of unknown function DUF2782"
FT                   /note="PFAM: Protein of unknown function DUF2782; KEGG:
FT                   slt:Slit_2835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54229"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIH2"
FT                   /inference="protein motif:PFAM:PF11191"
FT                   /protein_id="ADL54229.1"
FT                   /translation="MRILSLLIFAGFALPVFAAQPVPANLEPLSPPPEFTPEAAAGDEP
FT                   EVTIVKQTELTVEEYRSGGRIYMIKVTPKVGPPYYLVDDRGDGKFARQESLDSGFRPPR
FT                   WIIKTF"
FT   sig_peptide     228183..228239
FT                   /locus_tag="Galf_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            228519..229460
FT                   /locus_tag="Galf_0185"
FT   CDS_pept        228519..229460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0185"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; KEGG: slt:Slit_2836
FT                   homoserine kinase; PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54230"
FT                   /db_xref="GOA:D9SIV4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIV4"
FT                   /inference="protein motif:TFAM:TIGR00938"
FT                   /protein_id="ADL54230.1"
FT                   /translation="MSVYTTVSDAELTVWLNDYSLGELQELQGIASGIENTNYFVTTSN
FT                   GRFVLTLFEKLRADELPFYLNLMAHLARHGIPCPAPMANRHNQFLGVLKDKPACIVSRL
FT                   SGKSTTAPTLAHCAAMGAMLGQMHIAGQSFSQIMPNPRGGAWRMATAPQVRPFINTGQA
FT                   ALLDSEIALHAQRNYSLLPQGLIHADLFRDNVLLEGERVGGLIDFYFACTDALLYDVAI
FT                   TVNDWCMRPDGILDTTQAQTFLRAYHTVRPLQDSEHQAWPLMLRQAALRFWLSRLFDKY
FT                   LPRDGELIHAHDPAHFERILKNHIDTSQAVWI"
FT   gene            229451..230227
FT                   /locus_tag="Galf_0186"
FT   CDS_pept        229451..230227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0186"
FT                   /product="transmembrane protein"
FT                   /note="KEGG: nmu:Nmul_A0564 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54231"
FT                   /db_xref="GOA:D9SIV5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIV5"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A0564"
FT                   /protein_id="ADL54231.1"
FT                   /translation="MDLKTDKQGLGEKMEPLRLEAAQGMQWIKKGYALFMKAPLLWIVL
FT                   LAICFVTAAGVTAVPVIGEPLVSLLMPVVVIGLMAGCRSLELGDDLELMHLFCGFQRHT
FT                   SHLITLGGIALVGQYLIFGVMMMVGGAALVGILMNSQAAVPPDVIQQAVAGAGASVMIG
FT                   VALFGLLLMSMQFAPMLVFFRDVPPYEAMKLSLRAFTHNVGAMFVYGMAFLLLAILASM
FT                   PMMLGWLILMPMVFTSLYASFCDIFPEPVIPASAVE"
FT   gene            230335..230823
FT                   /locus_tag="Galf_0187"
FT   CDS_pept        230335..230823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54232"
FT                   /db_xref="GOA:D9SIV6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIV6"
FT                   /inference="similar to AA sequence:KEGG:Slit_2838"
FT                   /protein_id="ADL54232.1"
FT                   /translation="MQFEIDPSVIKRAQFPHNLLISALFGFNLLMAPAVIALKFGMVGL
FT                   LVPFLSTGALIGAIYLRSRKNTLWFVDAHWQLAFKNSRWLMLGYAITALLILAAWLVSL
FT                   AAANPSMGHIIWTALTRIAILPTLAGVMITAIMEAGAISLASKREVPDSLVASFPPQV"
FT   gene            complement(230825..231268)
FT                   /locus_tag="Galf_0188"
FT   CDS_pept        complement(230825..231268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0188"
FT                   /product="MEKHLA domain protein"
FT                   /note="PFAM: MEKHLA domain protein; KEGG: slt:Slit_2843
FT                   MEKHLA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54233"
FT                   /db_xref="InterPro:IPR013978"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIV7"
FT                   /inference="protein motif:PFAM:PF08670"
FT                   /protein_id="ADL54233.1"
FT                   /translation="MTTDTPPDTALTDPRLPLILDSYQRLTGKILLADTQSMWHAPFAI
FT                   VAHDTASDPVFFYGNKLALQQFEMSFEEFVKLPSRLSAEPLAQEARAKLLHKVSLQGYI
FT                   DDYCGMRISGKNTRFMIRNATVWNLIDEAGLCHGQAATFITHK"
FT   gene            complement(231265..233436)
FT                   /locus_tag="Galf_0189"
FT   CDS_pept        complement(231265..233436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0189"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: slt:Slit_2844
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54234"
FT                   /db_xref="GOA:D9SIV8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIV8"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADL54234.1"
FT                   /translation="MSAPLWDNPPMNTTLLSGLNPPQLQAVTLPRQSALILAGAGSGKT
FT                   RVLTTRIAYLISTGAVSPHGILAVTFTNKAAKEMVTRLSAMLPINTRGMWIGTFHGLCN
FT                   RLLRAHYREAALPQTFQILDSGDQLSAIKRIMKALEIDDEKYPPREMQNFISGSKEQGL
FT                   RAHDVEAFDPYTRRKVDVYAEYDAQCQREGVVDFSELLLRCFELLSRNESLRTHYQERF
FT                   HHILVDEFQDTNPLQYQWLKLLAGQHNALFAVGDDDQSIYAFRGANVGNMKDLLRDFKV
FT                   EAVIKLEQNYRSHGNILDAANALISNNRNRLGKNLWTSEQGGEKLRVYEAPTDVEEANF
FT                   IVGEIRQLKTEGLKLTEMALLYRSNAQSRVLEHALVSAGLSYRVYGGLRFFERQEIKHA
FT                   LAYLRLMQNTDDDNALLRIINYPTRGIGARSIEQIQDSAKMHGTTLWDAAARAGGKVSA
FT                   FVGLIEAMRSATSALPLPEIMEHVLVHSGLIEHYQSEKGAKKREAEERLENLKELVTAA
FT                   TLFVHENEDDSLTSFLTHASLEAGEHQAGDQDDALHLMTVHAAKGLEFNAVFITGLEEN
FT                   LFPHQNSQRVDGGLDEERRLMYVAITRARRRLYMSFAQRRMLNGQVSYGAPSSFLKELP
FT                   EDLLQWLSAREAPRNPFASFGYSAPAAPVQHSVSSTGWRTGQRVMHLKFGEGVITGVEG
FT                   SGTDGRVQVNFKHAGSKWLALEYAKLTAL"
FT   gene            complement(233767..234609)
FT                   /locus_tag="Galf_0190"
FT   CDS_pept        complement(233767..234609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0190"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: slt:Slit_0169
FT                   PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54235"
FT                   /db_xref="GOA:D9SIV9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIV9"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADL54235.1"
FT                   /translation="MTLIAQPIQFDHSGNFNKLKNRLEHQVGKAIFDFNMIEEGDSVMV
FT                   CLSGGKDSYTLLDILLTLRKRAPIDFRIVAMNLDQKQPGFPADILPGYLKALGVEYHIE
FT                   TQDTYSIVKEKIPEGKTTCSLCSRLRRGIIYKVAGELGANKIALGHHRDDMIETLFLNM
FT                   FFAGKLKAMPPKLVTDKGDHIVIRPLAYCVEKDIARYARGMEFPIIPCNLCGSQENLQR
FT                   QNIKEMLTNWERQYPGRSQTIFTAMQNVAPSHLLDGTLFDFKGMQMGQDVAEGDVVFD"
FT   gene            complement(234620..235360)
FT                   /locus_tag="Galf_0191"
FT   CDS_pept        complement(234620..235360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0191"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   slt:Slit_0168 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54236"
FT                   /db_xref="GOA:D9SIW0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL54236.1"
FT                   /translation="MQGKVMLVTGGGKRVGAAICRRLHAAGATIALHYRTSTQEAMALK
FT                   DELNALRPDSAAAFSADLLDLADLPRLIEAVIARFGRLDALINNASSFYATPLPELNEM
FT                   QWHDLLGTNLRAPLFLAQAAQGELRHRHGCIVNIVDIHAERPMQGHLLYSVAKAGLVAL
FT                   TRALAQELAPCVRVNAVAPGVILWPENADWEDAAQRGNIVAHTLLKREGEPDDIAKTVK
FT                   FLIADAPYITGQVISVDGGRSITL"
FT   gene            235406..236572
FT                   /locus_tag="Galf_0192"
FT   CDS_pept        235406..236572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0192"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   slt:Slit_0167 protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54237"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW1"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ADL54237.1"
FT                   /translation="MPITPDTSLPQPGPAAAQHSARLIEAIHREIADQGGWISFARYME
FT                   LALYAPGLGYYTAGAHKFGEAGDFITAPELSPLFGRTLARQVAQIMEESAPHILELGAG
FT                   SGKLAVDMLGELERLGRLPDSYCILEVSADLRARQQALIGQCLPHLLGRVHWLDALPEQ
FT                   VKGAVVANEVLDALPVHLVRWQDSALSEIGVALDESGFVRVERAIADAQLLQAAQQIKV
FT                   PDNYVSEICLAARGLVTSLACRLTQGTLLFIDYGFGAREFYHPQRLNGTLMCHYRHRAH
FT                   DDAFFLPGLQDITAHVNFTDIAETGIDAGLELSGYTSQAFFLINNGIADLMVETSPEDL
FT                   RAYLPLSAQLQKLTSPAEMGELFKVIALSKNRANPLSGFARGDFSRLL"
FT   gene            complement(236574..237026)
FT                   /locus_tag="Galf_0193"
FT   CDS_pept        complement(236574..237026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0193"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="SMART: Calcium-binding EF-hand-containing protein;
FT                   KEGG: rso:RSc3104 putative calcium binding signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54238"
FT                   /db_xref="GOA:D9SIW2"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW2"
FT                   /inference="protein motif:SMART:SM00054"
FT                   /protein_id="ADL54238.1"
FT                   /translation="MKWIIGMLFVALPCLAFSAEKSGKKEIEAKFEQLFKSVDADGDGK
FT                   ISKEEAALKAPAMADGFEVIDTNHDGGLTKAEIKTFTLALEKKRREFSQQLEKADKNKN
FT                   GTLSREEAAVLPNLDAHFDEIDSNLDGQLNIKEISDFLRALTAPAK"
FT   sig_peptide     complement(236970..237026)
FT                   /locus_tag="Galf_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.934 at
FT                   residue 19"
FT   gene            complement(237023..238267)
FT                   /locus_tag="Galf_0194"
FT   CDS_pept        complement(237023..238267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0194"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   KEGG: slt:Slit_0165 polynucleotide
FT                   adenylyltransferase/metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54239"
FT                   /db_xref="GOA:D9SIW3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW3"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ADL54239.1"
FT                   /translation="MTANAQIYCVGGAVRDRLLGLPVKDHDWVVVGSTPEAMIAQGYQP
FT                   VGRDFPVFLHPKTHEEYALARTERKTAPGYKGFVVHAAPDVTLEQDLMRRDFTVNAIAQ
FT                   DTAGNLIDPHGGMTDLRAGILRHVSSAFNEDPVRILRAARFAARFGFHIAPETQALMCD
FT                   MVNNGEVDALVSERVWQELSRALMEQTPARFFTTLRDCGALAKIMPEIDALFGIPQVAK
FT                   YHPEIDCGLHTLMVIEDAAQHDYALEVRYAALTHDLGKATTAPDMLPRHLGHELRSVAL
FT                   VKTLSERIRATGECRDLALLAARFHGDIHRASELRSDTIIKLFQSSDAWRRPERFSQLL
FT                   QACASDARGRLGFEQSLYPQAAYLLQLLSAARAVNLGEIARLCQDKGTIPAAVAHARKD
FT                   AIENLVKNHQKDLKI"
FT   gene            complement(238257..240242)
FT                   /locus_tag="Galf_0195"
FT   CDS_pept        complement(238257..240242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0195"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   slt:Slit_0164 lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54240"
FT                   /db_xref="GOA:D9SIW4"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW4"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADL54240.1"
FT                   /translation="MLINSLVSQPVLMSLIKFLFLLLSLITFNAEAAQDDDFLAARDAF
FT                   RSGDAAKLATFSQRLRNTPLEVYTAYYQLRMKLDTADISEISAYLARPDDTPMIDKMRS
FT                   EWLKSLAKKQQWELFERERPRLIAEDTELACYTLQSRIKTRELLSDVRSLWLNAKDQPS
FT                   NCTVLFDAAISSGVISQQDIWQRMHKALQAGNVSQAKNLAEHLTGSRAIPSGALDRAMD
FT                   NPGRYLDKQTLDNASLGQRAVALFALQRLARLSPDLAADRWGHLSAHFSDAEQQYFLGW
FT                   LAFEAARKQDPRARKWFKQAGSSQLTDQQAAWRVRAALRVQDWPEVLAGVNAMTEPQRS
FT                   ESAWRYWSARALQATGHRDEALKIFLPLSAEHTFYGQLSAEELGDTPVLSATPSSYQPG
FT                   TRELTAMEQLPGIKRAIAMYKMDLRTDAMREWNWLIRNFNDHELITAAEIAKRHEMYDR
FT                   AINTADKTVLVHDFSLRYLAPYRTAMREHLQENGLEEAWVYGLMRQESRFVTSAKSGVG
FT                   ASGLMQVMPSTARWIAKKLGLKDYRESLLHQLDTNLMLGTYYMKNMLSSLDDSPVLASA
FT                   AYNAGPGRARRWRSDKPLEGAIYAESIPFDETRDYVKKVMSNTVYYARQFGAPPRSLKA
FT                   RIGTIAARTGDIPLTDDKSPGGSNDR"
FT   sig_peptide     complement(240144..240242)
FT                   /locus_tag="Galf_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.632 at
FT                   residue 33"
FT   gene            240374..241276
FT                   /locus_tag="Galf_0196"
FT   CDS_pept        240374..241276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0196"
FT                   /product="exonuclease RdgC"
FT                   /note="PFAM: exonuclease RdgC; KEGG: putative exonuclease
FT                   RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54241"
FT                   /db_xref="GOA:D9SIW5"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW5"
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /protein_id="ADL54241.1"
FT                   /translation="MWFKNIFIYRLPVDCAITAAALQEKLALKPLLPCSGLDKQSRGWV
FT                   SCRGDDRLVHAANGQILFALGVEQKLLPATIITRFAKERVADIEAQQGYKVGRKEMKDL
FT                   KEAITEELLPRAFALLRTTYAWIDTANGFLVIDAASAAKAEELLEFLNKTLDDLPVKPL
FT                   HTELSPVAAMTDWLAGEAAPAGFTIDRELELRATGESRATVRYANHALEGDEILAHIAA
FT                   GKRATRLGLTWNDRVSFVLTEQLQIKRLEFLDIIKEESTTLADTADELFELDFTLMTGE
FT                   LAKMLVDLTDALGGEKSNQ"
FT   gene            complement(241318..242034)
FT                   /locus_tag="Galf_0197"
FT   CDS_pept        complement(241318..242034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0197"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="PFAM: Conserved hypothetical protein CHP00730; KEGG:
FT                   slt:Slit_2834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54242"
FT                   /db_xref="GOA:D9SIW6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW6"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADL54242.1"
FT                   /translation="MNNTPKLPLSDIPAAWDAKEAWRVFGIMSEFVSATDRLAQIHPAV
FT                   SIFGSARTRPDQPYYKLAEEIARLLSDAGFSVISGGGPGIMEAANKGAFYGKSPSVGLN
FT                   IQLPHEQSNNPYQNISQSFQHFFARKVMFVKFANAYVVMPGGFGTLDELMEALTLVQTG
FT                   KTRRIPIILVGSKFWGGMIEWFKTALIEEKVIHPEDMELIQLIDEPQEVVRAIFKHYET
FT                   AGFEPTEAERERQLYL"
FT   gene            242057..244780
FT                   /locus_tag="Galf_0198"
FT   CDS_pept        242057..244780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0198"
FT                   /product="DNA polymerase I"
FT                   /note="TIGRFAM: DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 3'-5' exonuclease; 5'-3' exonuclease,
FT                   N-terminal resolvase-like domain; 5'-3' exonuclease,
FT                   SAM-fold domain; KEGG: slt:Slit_2833 DNA polymerase I;
FT                   SMART: DNA-directed DNA polymerase; 5'-3' exonuclease;
FT                   3'-5' exonuclease; Helix-hairpin-helix domain protein class
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54243"
FT                   /db_xref="GOA:D9SIW7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW7"
FT                   /inference="protein motif:TFAM:TIGR00593"
FT                   /protein_id="ADL54243.1"
FT                   /translation="MSTKTLLLVDGSSFLYRAFHAIPEMRNQHGEPTNAIYGVHNMLRR
FT                   LRQDFPADYSLCVFDAKGKTFRDDLYPQYKANRPSMPADLVAQIEPLHQLIAASGWKIA
FT                   MVEGVEADDVIGTLARQASRDGVRCIVATGDKDLAQLVDEHVTLINTMNNETLDMAGVK
FT                   AKFGVPPELIVDYLALMGDTVDNVPGVEKVGPKTAVKWLLQHGSLDNLMRNADTISGVV
FT                   GANLRNALEWLPQARQLVTVKCDVPDLPLYAELVAPTPDKAALRQLFERLNFKTWLREL
FT                   NAATEVAKAPEQAEVSAVPELVSTAQVQYQKILTGEQLDAWLARLLAADLVCLDTETTG
FT                   LDVMDARLVGMSFAITPHEAAYLPLAHRYPGVPDQLDLDATLARLRPWLESEQHKKLGQ
FT                   NLKYDKHIFANHGIALRGISDDTLLESYVLESHKSHDMDSLALRHLGVKTISYEEVAGR
FT                   GAKQICFDQVDLDIATRYAAEDADITLQLHQSLAPEITGKTGLQHVYRDIELPAMQVLF
FT                   VMERNGVLLDANLLHVQSHELGVKLIALEARAHEAAEQPFNLNSPKQIQEILFDKLKLP
FT                   VKKKTPSGAPSTDEEVLQELALDYPLPKILLEYRGMAKLKSTYTDKLPKMVNRATGRVH
FT                   TSYSQAVAVTGRLASSDPNLQNIPIRSAEGRRIREAFIAPSGSCIVAADYSQIELRIMA
FT                   HLSGDAGLLQAFAKNEDVHRATAAEIFMTTPVDVTTEQRRYAKVINFGLIYGMSAFGLA
FT                   KQLGIERGAAQAYIARYFARYPGVRDYMDSTREQAKQQGYVETVFGRRLWLPEINSSNA
FT                   MKRQGAERAAINAPMQGTAADLIKLAMIQVQGWLETEKLKTRLIMQVHDELVLEVPDDE
FT                   LSLIKASLPGLMCHVANLNVPLLVEVGSGKNWDVAH"
FT   gene            244870..246093
FT                   /locus_tag="Galf_0199"
FT   CDS_pept        244870..246093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0199"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   slt:Slit_0315 glycosyl transferase family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54244"
FT                   /db_xref="GOA:D9SIW8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW8"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADL54244.1"
FT                   /translation="MDINFQRAVDRLAGVPICALLSGYDRFRNFLFGAPAQAAIPRRIL
FT                   IILLSEMGSLVLAHAMFAQLKRQYPDAALHVMLFKKNREVLDLLGVVPEANVLTIDDRT
FT                   LTQFLPDIWRAIRLMRALKFDVVIDCELFTRVSSIFAYLSAAPVRVGFSRHTQEGLYRG
FT                   TFINRPVMYNPYRHLSEQFLTMVAAIGSASVPKGKSAPVLRVERPPQLVFRDGELEEVA
FT                   SALYADFPAISGKKLVLVYPSGGILPIRAWPPESYKLLCVSLLADGYAVGLIGMKDDAP
FT                   LAQEIVEYAQSQYCVDLTGYTRTVRHLLCVFQYASLLVTNDGGPGQFAALTRLPTLVFF
FT                   GPETPALYSPLTDNIHCLYSSWSCSPCLTAYNHRLSPCDGDNQCLKQITPEQVLSKSRE
FT                   LLSVDNTV"
FT   gene            246090..246596
FT                   /locus_tag="Galf_0200"
FT   CDS_pept        246090..246596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0200"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: slt:Slit_0316 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54245"
FT                   /db_xref="GOA:D9SIW9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIW9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADL54245.1"
FT                   /translation="MKSALNLSISIPSLLRRIFSRRFLKFGTVGASGTVVNIGVLYLAQ
FT                   EHLFNTVQHVELKLNLSLAVAILLATLNNFFWNRLWTWSDRTQQHHRSWLSQFGQYTLA
FT                   CWLSIALQVLFTNLLAPHFYYQFANLIAIASTSVLNFVLNDIWTFGRVKLLPARAPAKS
FT                   VDEAH"
FT   gene            246583..248310
FT                   /locus_tag="Galf_0201"
FT   CDS_pept        246583..248310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0201"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   slt:Slit_0317 glycosyl transferase family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54246"
FT                   /db_xref="GOA:D9SIX0"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX0"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ADL54246.1"
FT                   /translation="MKRISPAAWRFIYYGLAVVLAVFTYFYALDSAHIPKNGDEFPYTH
FT                   ITRLTAESGHLLPLQSQLHGMRNTKPPLLFWQGILSTHWGAQWTWWNLRYPSVIYTLLT
FT                   ALLVFLLAHRLAGERRSEGVDPVETGFIAALTYLAFFSTYRFGRPFLVNPAEIFWFFLP
FT                   FFTLLYWRTQAFDSRLIVPLLLGVEVGMGLLYKSFALVAPVSLALSLWYLHQRQYRWSA
FT                   FILKDALKVAITVIVALALFGLWFVFDPDPAAVWREFIVGENAGKFGAQGGSYLGHLLW
FT                   GGSSVWALLLGYPMNAGLLAFPVAALGWVAYRRPLSDAEKLLWIWMGVLFVVFCVPSQR
FT                   SARYLLEAMPVLAVLCALSWQRISRWAFVASLLLCGGVLVLLAFLSWRLQQAMPGEDLY
FT                   SAGYWLLLLMTATLLLLGIFHARTTRLVTNVVVLLVMLSLAAFLRPFDGIAGNFSAGAQ
FT                   RYAAGKEVWVPCDFRAVDEGYRFILPGAKIHGYFAGAPLSVGELASRYDLFAVQLPLQT
FT                   PCDGCKIIGERLEIRGRHSPDELKRILAGEVFEQLFVKELLIESSGVSQVAAKEEGCR"
FT   gene            248310..249608
FT                   /locus_tag="Galf_0202"
FT   CDS_pept        248310..249608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0202"
FT                   /product="BNR/Asp-box repeat protein"
FT                   /note="KEGG: slt:Slit_0318 BNR/Asp-box repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54247"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX1"
FT                   /inference="similar to AA sequence:KEGG:Slit_0318"
FT                   /protein_id="ADL54247.1"
FT                   /translation="MSWQRRILLNLVLLAFSCGFYKAMSRPAAASFKMQATVPVKVTSA
FT                   RYETHFASSKLFTQVHAASSIELKDGRIRAFWFSGSREGAKDVAIHSAVFDPATGQWSA
FT                   ELIAATREQTQSTLHRYIAKLGNPIVGRMSDGRLRMYYVAVSLGGWAGSSITTMTSSDE
FT                   GTTWTTPRRLITSPFMNISTLVKGAPFLYSDGTLGLPVYHEFISKFGEMLHLSQEGVVL
FT                   DKQRLAAGGQGTLQPVVLMQNEHSAKVLMRYSSASGPHRVVAVSTQDAGLHWSAPEKTA
FT                   LRNPDAAVTGVTLPDGRMLAVLNDQELGRDTLSLVLSQDGGVTWRVVQLLEDQQQASSQ
FT                   PDEANFIKNAAQMIESSDAISTSRLEPAVESARRTVCHDGHCRYEFSYPYLIQASGGDF
FT                   HLVYTWNRTFIKHVWFNFAWLDQRAGEVDHALH"
FT   gene            249595..250200
FT                   /locus_tag="Galf_0203"
FT   CDS_pept        249595..250200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54248"
FT                   /db_xref="GOA:D9SIX2"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX2"
FT                   /inference="similar to AA sequence:KEGG:Slit_0319"
FT                   /protein_id="ADL54248.1"
FT                   /translation="MRFTDISALAGIAFAIMVLALHLPLINRLKQISLFGVLLFIAALI
FT                   PADGLSVAEFVRGMLGDLSFSTLLLLAIAYGRILSARLHRNEIRHDIDGSLPVLSVIAL
FT                   AALALYPFALGIGMTDPYRLGYGDMGFLGGLLLAALLAWALRYSLITLIISLAVLGWSA
FT                   GWYESNNLWDYLLDPWVAIYALVALIKKSVLRVRKKII"
FT   gene            complement(250193..250549)
FT                   /locus_tag="Galf_0204"
FT   CDS_pept        complement(250193..250549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0204"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: slt:Slit_0346
FT                   dihydroneopterin aldolase; SMART: dihydroneopterin
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54249"
FT                   /db_xref="GOA:D9SIX3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX3"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADL54249.1"
FT                   /translation="MDIIFIRELKVTTLIGIYEREKHVPQTLQLDLDIALPNSRACYSD
FT                   DINDALDYAKVAQHIQTVLSEGHFSLVETLAEHIAQIILKDFNAPWVKVSVAKLQAIRN
FT                   CRMVGISIERSQIR"
FT   gene            250622..251215
FT                   /locus_tag="Galf_0205"
FT   CDS_pept        250622..251215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0205"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   slt:Slit_0347 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54250"
FT                   /db_xref="GOA:D9SIX4"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX4"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADL54250.1"
FT                   /translation="MLTLIFVVAAYLLGSVSFAVVTSRIFGIADPRTYGSGNPGATNVL
FT                   RSGKKAAAALTLLGDAAKGWVAVAAAQHYAPDDLQLVAFVFMAVFLGHVFPIFLRFKGG
FT                   KGVATALGVLLALNGWLGLAALVTWLVIAVVFRLSSLAALMAAATAPVYAYEMNLPQEW
FT                   VFACFVMSMLLIWRHKSNIQNLLAGKESRIGKKA"
FT   sig_peptide     250622..250681
FT                   /locus_tag="Galf_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.946 at
FT                   residue 20"
FT   gene            complement(251235..252245)
FT                   /locus_tag="Galf_0206"
FT   CDS_pept        complement(251235..252245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0206"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: nmu:Nmul_A2061 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; PFAM: peptidase M22
FT                   glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54251"
FT                   /db_xref="GOA:D9SIX5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX5"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADL54251.1"
FT                   /translation="MITLGIESSCDETGIALYQTGRGLLAHALHTQIAMHSEYGGVVPE
FT                   LASRDHVQRAIPLIRQVMQDANLTFEQLDAIAYTQGPGLGGALLVGASVANSLAFALDI
FT                   PTIGIHHLEGHLLSPLLSDPAPEFPFVALLVSGGHTQLMRVDGVGRYELLGETVDDAAG
FT                   EAFDKSAKLLGLGYPGGPALAKLATSGRPGLYKLPRPMLHSGNLDFSFSGLKTAVLTLV
FT                   RQNELDEQTRADIAYATQEAIIDVLAHKARAALVKTGLSQLVVAGGVGANQMLRQRLSE
FT                   DIGRRGGCVFYPDLEFCTDNGAMIAFAGALRLSEGQGTKDYRFNVKPRWNLEEFA"
FT   gene            252895..254418
FT                   /locus_tag="Galf_R0006"
FT   rRNA            252895..254418
FT                   /locus_tag="Galf_R0006"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            254485..254561
FT                   /locus_tag="Galf_R0007"
FT                   /note="tRNA-Ile2"
FT   tRNA            254485..254561
FT                   /locus_tag="Galf_R0007"
FT                   /product="tRNA-Ile"
FT   gene            254580..254655
FT                   /locus_tag="Galf_R0008"
FT                   /note="tRNA-Ala2"
FT   tRNA            254580..254655
FT                   /locus_tag="Galf_R0008"
FT                   /product="tRNA-Ala"
FT   gene            254998..257892
FT                   /locus_tag="Galf_R0009"
FT   rRNA            254998..257892
FT                   /locus_tag="Galf_R0009"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            258059..258172
FT                   /locus_tag="Galf_R0010"
FT   rRNA            258059..258172
FT                   /locus_tag="Galf_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 51.10"
FT   gene            complement(258421..259461)
FT                   /locus_tag="Galf_0207"
FT   CDS_pept        complement(258421..259461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0207"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mms:mma_3530 hypothetical
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54252"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54252.1"
FT                   /translation="MLLPDLNSSLNHALQSLAAMTGQRDRELLARTLVATLSELMEQSV
FT                   ITLYRLVGDEAILVAQAGTAIPPDQIAEPSIIISDRLEFKSVIDSRCESITSLDAHTTS
FT                   VTIPIYGQQEITALLVIITNANFDQSLSLPRDILTIYSNYLNLLDESETDTLTGLLNRR
FT                   TFDNNLEKMLTECTDAEVQKIEINSHSRKPPSSELPHWLAVMDIDHFKRINDEFGHLYG
FT                   DEVLLLLSRCMRRNFRQTDKLFRFGGEEFVVVLDRTCEVDASKVLERFRTAIECYDFPQ
FT                   VGRVTISIGFTCLNGKDDPSTLVGRADQALYYAKEHGRNQVCFYEGLIAEGNLTAEHFT
FT                   DDVQLF"
FT   gene            complement(259551..260300)
FT                   /locus_tag="Galf_0208"
FT   CDS_pept        complement(259551..260300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0208"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: slt:Slit_2669 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54253"
FT                   /db_xref="GOA:D9SIX7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX7"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADL54253.1"
FT                   /translation="MDDFQLQRYGRHILLDEIGIEGQQRLIESRVLIVGLGGLGSPASL
FT                   YLAASGVGQITLCDDDSVDLSNLQRQIAHRTSSIGQSKVGSAAAAILDINPETHCIQFE
FT                   SRVNQTDLNQLVALHDVVLDCSDNFSTRYAVNQACKTHHTPLISGAAILFSGQASVFDF
FT                   RDPNAACYNCLFPEDSDAENLRCATTGIFSPLAGIIGTIQAAETLKLLIGIQPGLSGKL
FT                   LTVNALDMSFRHSVITKDHHCSRCSSS"
FT   gene            complement(260310..260714)
FT                   /locus_tag="Galf_0209"
FT   CDS_pept        complement(260310..260714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54254"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX8"
FT                   /inference="similar to AA sequence:KEGG:Slit_2623"
FT                   /protein_id="ADL54254.1"
FT                   /translation="MINPFDLEKKRELLFATEPAGQAERALTILSGLANLKACASSRAY
FT                   AVEIQYNLQNYTLAGLEHALEQEGFQLDQSFLHHVGRNIIHYCEDTSRHNMEIRGHITK
FT                   KNEKEVFVGIGGQHSHTDPAGKPPALREFE"
FT   gene            complement(260732..262117)
FT                   /locus_tag="Galf_0210"
FT   CDS_pept        complement(260732..262117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0210"
FT                   /product="carboxyl-terminal protease"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM: peptidase
FT                   S41; PDZ/DHR/GLGF domain protein; KEGG: slt:Slit_2622
FT                   carboxyl-terminal protease; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54255"
FT                   /db_xref="GOA:D9SIX9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIX9"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADL54255.1"
FT                   /translation="MRRMEKAGLVGFGLVAGVALSLHFAALADKETLVSPLPIEELRAF
FT                   TEVFGHIKNSYVEPVSDQKLFTEAINGMLNGLDPHSAYLDADAFKDLQVGTQGEFGGLG
FT                   IEVGMEDGLVKVISPIEDTPAYLAGVKSGDLILKLDDALVKGMSLNDAVKRMRGKPGSK
FT                   IVLTILRKNELKPLTITVVRAVIKVQSVKAKLAEPGYGFVRITQFQEHTGENLATALDK
FT                   LVKENKGALSGLVLDLRNDPGGLLDGAVAVSAAFLAKDALVVYTEGRTEDAKMRLTASP
FT                   EYYLRGSNKNDYIKNIPASIKSVPLVVLVNGGSASASEIVAGALQDHKRGVIMGTQTFG
FT                   KGSVQTVLPLGNSTAIKLTTARYYTPGGRSIQAKGIVPDILADDPSTSASDNLFRLREA
FT                   DLEKHLANDKQPEEKTPNTVKSDSSTKSNTEKLPPTEYGSKNDYQLNQAFNLLKGMKIL
FT                   QGK"
FT   sig_peptide     complement(262031..262117)
FT                   /locus_tag="Galf_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.888 at
FT                   residue 29"
FT   gene            complement(262129..263286)
FT                   /locus_tag="Galf_0211"
FT   CDS_pept        complement(262129..263286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0211"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: slt:Slit_2621 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54256"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY0"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADL54256.1"
FT                   /translation="MKFALILSLCLLAGQASASQQEELENLRQRIKEMQSEIAKTSESK
FT                   SEAADSLRASELAISDSNRRLAQLSEQKRDADRKLGVLEIQRQQLEQHITDQQALLEKL
FT                   LYQQYLGGKHDYLKLMLDNQDPNKVARDLQYFQYIARNRAIWLDSLRRDLKELDAVAAA
FT                   VHTQSETLTNLRTEQATQKEKLRQDQRDRQLVLGQISKQLLQQRKEISRLQHDENRLAN
FT                   LVSKIAQMLAKPKTKSLFHNTNIPDSRFDGKPFEELMGKLALPVKGEITNQFGTTRPDS
FT                   TVIWKGLFISTAHGQPVRSIAAGRVVFADWLRGFGNLLIIDHGNAYMSLYGNNETLYKQ
FT                   VGDEIHGGDAISTVGNSGGNADSGLYFELRHESRPLDPAKWLAKK"
FT   sig_peptide     complement(263230..263286)
FT                   /locus_tag="Galf_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 19"
FT   gene            complement(263283..264821)
FT                   /locus_tag="Galf_0212"
FT   CDS_pept        complement(263283..264821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0212"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; KEGG: slt:Slit_2620
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54257"
FT                   /db_xref="GOA:D9SIY1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY1"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADL54257.1"
FT                   /translation="MKATPVLLLILDGFGYREETDSNAILAARKPNWDALWQTYPHTLI
FT                   NASEKHVGLPSHQMGNSEVGHLNIGAGRIVYQDLSRVDVAIEDGSFFKNPALSDAISVA
FT                   KSNDSALHIMGLLSAGGVHSHESHIHAMLEMAAKNGLKKVYLHAFLDGRDTPPKSAAPS
FT                   LLALQDKCAALGVGKIASIVGRFYVMDRDNRWERVQPAYELLTQGRADYYATDAISGLD
FT                   AAYARDESDEFVKPTRISGAGEPTVTMQDGDVVVFMNFRADRAREITRALTDEAFSGFE
FT                   RACLPKFGRYVTLSNYGSEFTLPCAYTAEAIHNDIGEYVANLGLKQLRIAETEKYAHVT
FT                   YFFSGGKEQPYPGEDRILVPSPKVATYDLQPEMSAFTVTEKLEAAILSQQYPLIVCNYA
FT                   NGDMVGHSGNMEAAIKAIETLDVCIGRIVKAMQSIGGEVILTADHGNAEQMMDNTTHQA
FT                   HTAHTLNPVPFLYVGRSCTLTDGGSLRDLAPSLLYMMGLPQPAEMTGHSLIKLL"
FT   gene            264904..265206
FT                   /locus_tag="Galf_0213"
FT   CDS_pept        264904..265206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0213"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: slt:Slit_2619 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54258"
FT                   /db_xref="GOA:D9SIY2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY2"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL54258.1"
FT                   /translation="MTNRLIDKEEDIQQASQAIKAIAHPLRLKILCVLDDQEISVQDIV
FT                   EHVGTSQSNISQHLAILRDKGVLSTRKEANKVYYRIGDLRTLKLVSMMREVFCTS"
FT   gene            265417..266874
FT                   /locus_tag="Galf_0214"
FT   CDS_pept        265417..266874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0214"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: slt:Slit_1147 sulfide-quinone
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54259"
FT                   /db_xref="GOA:D9SIY3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY3"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADL54259.1"
FT                   /translation="MARVVILGAGIAGHTAARHLNKMIGRHHEIVVVSPNAKWNWIPSN
FT                   IWVGVGQMKEEEVTFDLADVYKKTSVSFRQARALSISPAGDAGSDSPFVMVEYTHPDKA
FT                   GVTEKITYDYLINATGPKLNFGATEGLGPEHGHTVSVCTASHAIEANKKLQLIIDDMRK
FT                   GERRTIVIGTGHGMCTCQGAAFEYIYNVDHTLREAGVRHMARIVWLSNEYELGDFGMGG
FT                   VHIKRGGYITNGKTFAESLMVERGIEWITRAHVKKVEAGKIHYEILDGSFHELAFDFSM
FT                   LIPPFAGVGLKAYDKAGEDITSAVFAPNGFMKVDADYTPRPYLEWSARDWPRTYQTPGY
FT                   ANIFAVGIAFAPPHMISKPMQSVNGTAINPTAPRTGMPSAAMAMAVAKSITDMINGAQK
FT                   PTHTASMAEMGAACVASTGSHVFKGTAATMTVYPVVPDFEKYPEYGRDLDLTFGEIGLA
FT                   GHWMKYLLHHAFIYQAKMKPGWSIIPD"
FT   gene            266898..267062
FT                   /locus_tag="Galf_0215"
FT   CDS_pept        266898..267062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_1146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54260"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY4"
FT                   /inference="similar to AA sequence:KEGG:Slit_1146"
FT                   /protein_id="ADL54260.1"
FT                   /translation="MSNKVTNREPYQQAYYPPSPTGFTRHMRTSIIWQMMRFIVINFKI
FT                   LKLMAKSHH"
FT   gene            267160..268182
FT                   /locus_tag="Galf_0216"
FT   CDS_pept        267160..268182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0216"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: slt:Slit_2618 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54261"
FT                   /db_xref="GOA:D9SIY5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADL54261.1"
FT                   /translation="MDEGIAVKKLWLVSLLMMSTGVGAAELVAPVEYREVAQTYSAEGM
FT                   VEATRQSTVSAQIGGRVKEVNFDVGDSVKKGQIILRIDERESAQALAGSQAQVQQAQAN
FT                   AQNARLTYERARQLLAQKFISQAALDKAQSDYKVAIAQAAASEAGAGQASLAHGYTAVV
FT                   APYSGVVSARMVELGEMVMPGKPLMTGFDPSEMRVLVSVPQYKIGNIGAHPEVMIEVPS
FT                   LNRWIKADSSKVQPVADARTHSTQVRVYLPANEAGLYPGMFVRAHFVVGKVKKLVIPAS
FT                   AVLRRSEVVATYVVDEKGAASLRQIRVGETAAEGWVEVLSGLKEGERVARDPVKAGMKQ
FT                   "
FT   sig_peptide     267160..267234
FT                   /locus_tag="Galf_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.635) with cleavage site probability 0.626 at
FT                   residue 25"
FT   gene            268227..271427
FT                   /locus_tag="Galf_0217"
FT   CDS_pept        268227..271427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0217"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   slt:Slit_2617 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54262"
FT                   /db_xref="GOA:D9SIY6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY6"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADL54262.1"
FT                   /translation="MGISGRIARHFLHSQMTPLLALVAVLLGLFAVLVTPREEEPQINV
FT                   TMANVLIAYPGASAQDVAKTVATPAEQVLSQIAGVDHVYSVAQPGMAVITVQFKVGEAH
FT                   VPSLVKLYDVVHSHSDWLPQTLGVSQPIIKAKGIDDVPIVALTLWRNQQIGGGLELTQV
FT                   AHAIEAELKRVPGTREVSTLGGTQRQVRVLLNPESLNAYQLSMQDVRAALQSANVSENA
FT                   GTLVQDNREVLVQTGSFLTDANEVRQLVVGVSNNKPVFLRDVADVQDGADQPGSYVWLG
FT                   TGPAADDKGIKARGEFTAVTVAISKKPGANAVEVADGLLARVAELKGSVIPADVEVSTT
FT                   RNYGETANDKAMKLIKKLLFATAAVVALVWLAMGRREAMVVGGAVLLTLAATLFASWAW
FT                   GFTLNRVSLFALIFSIGILVDDAIVVVENIHRHRALTPDQPLSQIIPAAVDEVGSPTIL
FT                   ATFTVIAALLPMAFVSGLMGPYMSPIPINASMGMLISLAVAFVITPWLVLRFAGSHHES
FT                   VKEDGESAISGFFHRVLSPFLNGAQGKPARRKLWLGILAGLVLAVSLGVVKLVILKMLP
FT                   FDNKSEFQVVVDMPTGTALEQTNAVLHDIGAYLATVPEVTDYEAYAGAASPINFNGLVR
FT                   QYYLRSGADQGDIQVNLREKHHRSRSSHQIATAMLDPIQKIAANWGAKVKIVEVPPGPP
FT                   VMSPIVAEIYGPDYEGARRVASQVRAQFGKTEGIVGIDDTVTEAAPKLQLRVLQSKAAL
FT                   LGVAPRDIVDVIGTALSGQDVASLHDASAKYAPPLRIGLPGELRSSIEEVLKLKVRARD
FT                   GVLVPISEVVQVIPVARDYPIYHKDLLPVVYVFGDMAGKLDSPLYGMFGINGQISGTPL
FT                   AQGGSLKSYFFNTPSDPYAGYALKWDGEWQVTFETFRDMGIAYGVGLILIYLLVVAQFK
FT                   SYLVPLIIMAPIPLTIIGVMPGHALLGSQYTATSMIGMIALAGIIVRNSILLVDFVNLQ
FT                   LAGGIPLQQAVIAAAGARAKPIVLTGLAAMLGAFFILDDPIFNGLAISLIFGILVSTLL
FT                   TLVVIPVLYYATLYKKFQ"
FT   gene            271462..271674
FT                   /locus_tag="Galf_0218"
FT   CDS_pept        271462..271674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0218"
FT                   /product="Protein of unknown function DUF2892"
FT                   /note="PFAM: Protein of unknown function DUF2892; KEGG:
FT                   slt:Slit_2616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54263"
FT                   /db_xref="GOA:D9SIY7"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY7"
FT                   /inference="protein motif:PFAM:PF11127"
FT                   /protein_id="ADL54263.1"
FT                   /translation="MNAERIIRIVAGTFVMLSLALGVEGSPIFVAKNFLWFTGFVGLNL
FT                   FQSGFTSFCPLNNILAKFGVKGGSC"
FT   gene            271668..273437
FT                   /locus_tag="Galf_0219"
FT   CDS_pept        271668..273437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0219"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: slt:Slit_2615
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54264"
FT                   /db_xref="GOA:D9SIY8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY8"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADL54264.1"
FT                   /translation="MLTSRQSSFNLTHISLALAGLMWVLPFLHYRHQYPLTTFEQEWLS
FT                   ALMGVLSLTLLLTGDYWQAPRLPRIVQLPAFLIALVLLQSSLGMMAYFDQSLLYLLYLL
FT                   FTLLLMMLGARLREVFGLEFLAVVLAGFLLVGAELSALIGILQHYRWHSWFDSVVVMKV
FT                   STGVYGNLAQPNHFASYITLGLISLGVLFGQRKLPAGFVLALALPLLFVLTLSGSRSSW
FT                   LYLLFMLLLAWRGMKTLPQLRPVMHYCVVLLAGFVLMHGVVQLSFMKGAGSNFDIFQRV
FT                   ADTSSGSIRLQLWHEAWLIFKQSPWMGAGFGQFAWQHFQLGPELRQVNINGLYNNAHSL
FT                   LFQLAAEAGIAGLLVLFAALGVWFKGGRVCSAPHWWGYAILGVLAIHSLLEYPLWYVYF
FT                   LAVAALLLGMFDETHYRLHMRWVGRGALAAILLLGLLSLIQLKSGYQLLKDTLAIRPVS
FT                   GNVAVAFERTRAGLIQVHNGSLLRPYADLFMAAYFEVSDEKLAAKLAVNSNLSRFIPIA
FT                   PVVYRQACLLAQSGDALAARRVYEQAMWAYPANQEARAQLVKLAQKDPAHFAALLEFAL
FT                   KTEQEYASAIHNK"
FT   gene            273418..273828
FT                   /locus_tag="Galf_0220"
FT   CDS_pept        273418..273828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0220"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: slt:Slit_2614 rhodanese domain protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54265"
FT                   /db_xref="GOA:D9SIY9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIY9"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL54265.1"
FT                   /translation="MQFITSNFFPISLALMSGVMIIWSMLGSRVRGIKDVDTNAALQLI
FT                   NHKNAFILDVREPAEFKAGHILNAQLIPLGKLKERMGELAKYKDKPVVVVCRSGNRSGN
FT                   ACVALGKNEFTQAYNLAGGMMAWQKANLPTQK"
FT   gene            273843..274085
FT                   /locus_tag="Galf_0221"
FT   CDS_pept        273843..274085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0221"
FT                   /product="glutaredoxin 3"
FT                   /note="KEGG: slt:Slit_2613 glutaredoxin 3; TIGRFAM:
FT                   glutaredoxin 3; PFAM: glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54266"
FT                   /db_xref="GOA:D9SIZ0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ0"
FT                   /inference="protein motif:TFAM:TIGR02181"
FT                   /protein_id="ADL54266.1"
FT                   /translation="MYTTEVCPYCIRAEQLLQRKGVTEIEKIRVDLQPELRLHMVEITG
FT                   RRTVPQIFINEQHVGGFDDLAALEQAGSLTALLAN"
FT   gene            274101..274562
FT                   /locus_tag="Galf_0222"
FT   CDS_pept        274101..274562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0222"
FT                   /product="protein-export protein SecB"
FT                   /note="KEGG: slt:Slit_2612 protein-export protein SecB;
FT                   TIGRFAM: protein-export protein SecB; PFAM: protein export
FT                   chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54267"
FT                   /db_xref="GOA:D9SIZ1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ1"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ADL54267.1"
FT                   /translation="MTDAANTQPVFNMDKIYVKDLSLEIPHAPQIFLERENPQIEVQLH
FT                   TSAEGVDEGVFEVNVTATVTAKVGEKVMFLIEAKQAGIFTLRNLPEVEMEPVLAVMCPN
FT                   ILFPYLREVVSDVAVRAGFAPVMLNPINFDVLYQQQKQQQVEAAAATTH"
FT   gene            274562..275014
FT                   /locus_tag="Galf_0223"
FT   CDS_pept        274562..275014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0223"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   slt:Slit_2611 protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54268"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ2"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ADL54268.1"
FT                   /translation="MRYPAVLRLASLCTLLCVLGAAQAVDYVTVGEASAILYDAPSLKA
FT                   KKLFVVSRYMPFEAIVTLDNWVKVRDRTGGLYWLEKHALTNKKYVVVIPPLVDVRAEPD
FT                   EGAARVCQVRAQVALEWFESTGTGWIKVRHKDGETGFVRSSEVWGE"
FT   sig_peptide     274562..274636
FT                   /locus_tag="Galf_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            275011..276003
FT                   /locus_tag="Galf_0224"
FT   CDS_pept        275011..276003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0224"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   domain protein"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: slt:Slit_2610
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54269"
FT                   /db_xref="GOA:D9SIZ3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ3"
FT                   /inference="protein motif:PFAM:PF01210"
FT                   /protein_id="ADL54269.1"
FT                   /translation="MNITVMGAGAWGTALAISLAGQHRVTLWARDAAQVAAMRASRCNV
FT                   RYLPDVLLPDSLQLSDDFAASLAGAELVILSAPTAALRESLLRLVRADLACGVIWLCKG
FT                   FEPETSLLPHQVAEKILPPGTPYGVLSGPSFALEVAQGLPTALVLASDDESFSQRTAQA
FT                   LHHSRLRVYASRDVVGVEVGGAVKNVMAIAAGVCDGMRLGNNARAALMTRGLAEISRLG
FT                   LKLGGCSETLSGLSGAGDLILTCTGDLSRNRRVGLMLAQGKTLDEILQQLGHVAEGVYA
FT                   AREVYSLAARLSVDMPISAAVYHVLYDHVPVAQMVASLLNRTASLEFSQ"
FT   gene            complement(275993..276469)
FT                   /locus_tag="Galf_0225"
FT   CDS_pept        complement(275993..276469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0225"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="KEGG: slt:Slit_2609 tRNA/rRNA methyltransferase
FT                   (SpoU); TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54270"
FT                   /db_xref="GOA:D9SIZ4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ4"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ADL54270.1"
FT                   /translation="MFHVILYQPEIPPNTGNIIRLCANTGCQLHLIKPLGFTLEDKQLI
FT                   RAGLDYHEFANLRVYDHLEACLSAFDAGRIFALTTKGSQPFHEIRYQPGDAFLFGPESR
FT                   GLPAEVLNQLTTTQRVRLPMLPDNRSLNLSNTVAVAVFEAWRQCDFGGASKLTG"
FT   gene            276556..278259
FT                   /locus_tag="Galf_0226"
FT   CDS_pept        276556..278259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0226"
FT                   /product="type II secretion system protein E"
FT                   /note="KEGG: slt:Slit_2608 type II secretion system protein
FT                   E; PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54271"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ5"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADL54271.1"
FT                   /translation="MARPEKVRIGDLLVSEQLISQDQLKAALDEQQRTGRKLGRVLVDN
FT                   GFVTEEKISESLAKQLHVPYINLKYYNINIGQVRKLPENQARRFRAIVLEERNGVLLVG
FT                   MADPTDLFAFDEISRIVKCDIDVAVVTEGQLLESIDRGYRRTEEISGLAHELSEELGDS
FT                   YVDFGSMTSAVGSEEAPVVKLLQTMFDDATQIRASDIHIEPQEGKLMIRFRIDGALHLQ
FT                   TEAHNKIAPALVLRLKLMSGLDISEKRLPQDGRFHVRVRDQGVDVRIATCPTQYGEAVV
FT                   MRLLRQDGGMVGLDKLGMPPDMLLRFRAILKRSNGMILVTGPTGSGKTTTLYSALAELN
FT                   TIDMKLLTVEDPVEYRLPGINQVQVNEKIGLTFSSVLRSALRQDPDVILVGEMRDAETA
FT                   QIGLRAAMTGHLVLSTLHTRDAAGTLFRLVDMGIQRFMVASSVQAVIAQRLLRRICESC
FT                   SESYTPTPQEREWLEVEGVSIEQHARLMHGRGCSHCNGTGYHGRMGVYEMLEMGREMVE
FT                   AAAHDSVGHFMTVAAEHMRGKTLVDHALQQMLQGRTSVSEVMRISNQVED"
FT   gene            278262..279488
FT                   /locus_tag="Galf_0227"
FT   CDS_pept        278262..279488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0227"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   slt:Slit_2607 type II secretion system F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54272"
FT                   /db_xref="GOA:D9SIZ6"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ6"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADL54272.1"
FT                   /translation="MAVFTYKGRNAQGRMVEGSLDGEGSGAVADQLNSMGITPTDIKPF
FT                   VGKNAVQAPDWWLKLNQQPITPMDLMLFSRQMYTLLKAGVPILRALAGLQESTKNTAFA
FT                   AMLQDVRDSLDSGRELSAALRRHPKVFSMFYISMVQVGEMTGMLDQTFIRLYAYLDFER
FT                   DMKERIATALRYPSFVVIAMGIAIVIINLFVIPTFAKVYAGFHADLPAITKLLLGFSAF
FT                   MVSYWWMLMLMLAGAVTGFRYYINTKAGRYNWDRYKLKLPIVGPIIFKATLSRFARSLA
FT                   LTFKSGMPILQGMNVVGMVVDNEFMRSRIEAMREGIERGESILRTAVAAGVFNPIVLQM
FT                   IAVGEETGDLDGLMAEVADMYEQEVKYEVSTLSSKIEPILIVSLGALVLVLALGVFLPM
FT                   WDLGKAAMH"
FT   gene            279557..279805
FT                   /locus_tag="Galf_0228"
FT   CDS_pept        279557..279805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sds:SDEG_0928 two component system histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54273"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ7"
FT                   /inference="similar to AA sequence:KEGG:SDEG_0928"
FT                   /protein_id="ADL54273.1"
FT                   /translation="MRQYHRIQKQFYRICLVSERDSQTLALVPDVENAYMIVQLLKESQ
FT                   RLRDGQRIVSFPSVLRPEPDSEKTDQVTIVTSADDVT"
FT   gene            279955..280389
FT                   /locus_tag="Galf_0229"
FT   CDS_pept        279955..280389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0229"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: mmb:Mmol_1195 general secretion pathway
FT                   protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54274"
FT                   /db_xref="GOA:D9SIZ8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ8"
FT                   /inference="similar to AA sequence:KEGG:Mmol_1195"
FT                   /protein_id="ADL54274.1"
FT                   /translation="MKKQAGFTLIELVMVIVILGILAAVALPKFVNLSGDARKATLASA
FT                   EGAIRSAANMTHSASLAGSMAAASSVTAEGTTVTMVQYYPAAASIATVAGLGAGYTVTT
FT                   SGTTTTIQVTGATTPASCQVTYTEAAAGAAPTIVPTNSGC"
FT   gene            280485..280961
FT                   /locus_tag="Galf_0230"
FT   CDS_pept        280485..280961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0230"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: tbd:Tbd_0755 general secretion pathway protein
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54275"
FT                   /db_xref="GOA:D9SIZ9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D9SIZ9"
FT                   /inference="similar to AA sequence:KEGG:Tbd_0755"
FT                   /protein_id="ADL54275.1"
FT                   /translation="MSIAKPKLSKGFTLVELVMVMVLIGILAAVAVPRFFGTSVFQSRG
FT                   FADQLKATLSYAQKVAAAQNHFVCVAFATDSVTLSYDAVAPGTAHTVATCPGGNMSSPD
FT                   GKSPYVLTAPGGVVLSGATSFYFDTLGRPSAAQSIAVSGYATPVIVEAETGYVH"
FT   gene            280951..281520
FT                   /locus_tag="Galf_0231"
FT   CDS_pept        280951..281520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54276"
FT                   /db_xref="GOA:D9SJ00"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ00"
FT                   /inference="similar to AA sequence:KEGG:Slit_2602"
FT                   /protein_id="ADL54276.1"
FT                   /translation="MFTKAGLRIGDRGSRGEPRVGVSSILNSQSSLLVSQLGASLIELI
FT                   MFIVIVSSALAGILLVMNQTSKGSADPLIRKQAMAAAYSLLEEIELQDFIAASGVASSP
FT                   VTQANRASAYHVVGDYNGFATTGVFAVADATSSSPVLAQYNATVSVMPEAAVWNGIPAG
FT                   RVAQINVTVTGPNNTTIIATGYRAAY"
FT   gene            281520..282434
FT                   /locus_tag="Galf_0232"
FT   CDS_pept        281520..282434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54277"
FT                   /db_xref="GOA:D9SJ01"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ01"
FT                   /inference="similar to AA sequence:KEGG:Slit_2601"
FT                   /protein_id="ADL54277.1"
FT                   /translation="MRKDRMREAEGRRQGFLIPHVCRGFTLIELVMVIVITGIIGSMVA
FT                   VFLKWPVQQYMDVARRADLTNIADTAFYRLAGDISIAVANSVRVAGCGATPCLEFMPTK
FT                   DVGRYRVAQDMSDPASGVGDVLDFSGADSSFDVIGSPMSFAANDYIVIGSTQSDGAPAY
FT                   DATTSGVLRAYAGAAGTQSNVVITPTKFPSFARLSSQRFDVVDGAQQAVTYACEGTLGA
FT                   LDSSGHGQASLVRHWGYGFNPVQASPSVLTGSRAILADKVSGCSIDYTAANQRMGLLGV
FT                   RLTLTSGGESVSLYQEIHVSNMP"
FT   gene            282431..282847
FT                   /locus_tag="Galf_0233"
FT   CDS_pept        282431..282847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0233"
FT                   /product="putative mannose-sensitive agglutinin (MSHA)
FT                   biogenesis protein MshP"
FT                   /note="KEGG: slt:Slit_2600 putative mannose-sensitive
FT                   agglutinin (MSHA) biogenesis protein MshP; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54278"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ02"
FT                   /inference="similar to AA sequence:KEGG:Slit_2600"
FT                   /protein_id="ADL54278.1"
FT                   /translation="MKKLQKGFSLITAIFLLVVIAALGTFAVTLSTTQNQSQAVDAMAA
FT                   RGYQAALAGIEVAAYHVALSSVAWTAGCPAMTAVSFTDNLLAPFAVTVSCSAASYVEGT
FT                   ATLWVYAVSSVAKTAGAPGDVNYVEQVATAKLVQ"
FT   sig_peptide     282431..282514
FT                   /locus_tag="Galf_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.844 at
FT                   residue 28"
FT   gene            282858..286493
FT                   /locus_tag="Galf_0234"
FT   CDS_pept        282858..286493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54279"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ03"
FT                   /inference="similar to AA sequence:KEGG:M301_1274"
FT                   /protein_id="ADL54279.1"
FT                   /translation="MNHLNKRVLWILAGLMFSTVVQAATCTSRANGRWGSSGTWNCGKV
FT                   PASTDTIVLAAPFTVTLDARYTSSSLTVNAGAILADAGNTLTLTGALTNNGTISGDGNM
FT                   DVTGAAAVISGSGTYSGTRLYTSGSAPQIAAGAVLNFSGSSRLYAGRNDAGKTVAASVL
FT                   TINGTINSTIDAANTTFLRIYADSTVIGATGVINAGVSAADFSSKTAKVTNNGSVSLKS
FT                   IKQKSATNAWTQGANSSLTVTATSTVGVLSASATGNTVTYTSPAVPISPLNKTYYNLAG
FT                   TGVACPHGFTVTGSNPCVTKAGAGFVISSPTSCTNLTGVGTRAWTNPGNAQAADTVHSI
FT                   AGNVVKNTTTNYLKCTGFDFAAIPVGAAISGITVYVTRKTDGGTIRDAFVYLVKAGTLS
FT                   TTLNGATTTNYTKADVAEMHGGMTSLWGTTWTDSDFKLSTFGVAFAAKNTSTKSNTNRS
FT                   VSVDFIQVRVDYAATGVDHVAISAANIGSTCTLSNVTITPHTAAHGAPTGGGGAIKLST
FT                   SSGKGDWSIVSGTGSLSNGTGNDGRATYTYAAGETSATLGLMHTSSGSITLGVSDNATG
FT                   ASLTANTMAAELSNTILFAGGGFTVANAAGIAVSNMDQVAGATSPVYYLKATSASCGNA
FT                   FNNVAKSVDIAFECLDPTTCQSPAVTINAYNAAGTAVTSSTVLSTGLQNGSDPATANTY
FT                   KAVSLNFNANSLAPFTLNYPDVGRITLYLRYTPSSIISESIPFVVKPAGFVLSNIKRVR
FT                   DNFANPGAADATGAGFVKSGEAFSVRVTAVNAQGGATPNYGHEVTPEHVKLSNALVSPA
FT                   GGHNIAITCADPASVTACDMTGVQFPTFGAFTGGVAVGNNFAWDEVGVITVTPHVGDSD
FT                   YLGVGEVVGTTSGNIGRFTLAKFALQNPLLDNRTDICDAGLLISDEVTPCPAYTYMGEQ
FT                   MDASFILVPTSLHGVPSQNYQNSTTAANNYAKLDPTIFANLNLAAIDLTTPSYLTSRIS
FT                   NAGMPVVSCGTTPCFSQPGGAGSQAQAEITVPFTISRGASADGVYDAVDIGIAPLDSDG
FT                   AAVESDIGTVCNNPAVADCYDLDTDAVAGNDHALLGQAAFRYGRSRIVNAYGSELLALS
FT                   LPVFIEYWDGTAYVTSVDDHITALTLALSNYQLNLNAAKTTLTNPVISNGQGVVGLSAP
FT                   GMGGNGSVDIDLASPAYLPLPGRARATFGVYGGNPVFIYRGRRGR"
FT   gene            286573..287526
FT                   /locus_tag="Galf_0235"
FT   CDS_pept        286573..287526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0235"
FT                   /product="putative mannose-sensitive agglutinin (MSHA)
FT                   biogenesis protein MshI"
FT                   /note="KEGG: slt:Slit_2597 putative mannose-sensitive
FT                   agglutinin (MSHA) biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54280"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ04"
FT                   /inference="similar to AA sequence:KEGG:Slit_2597"
FT                   /protein_id="ADL54280.1"
FT                   /translation="MKIPSITSFLKAKPRDAGWLAVGLTSHGVFLIQLSFDAEIPRVLR
FT                   CEYHENSAVTVAYLERLRRESDLGNEACTTLLAAGEYQIMLMEAPNVPDNELKTAMRWK
FT                   IKDSLAYSVDDAAVDVLRIPVNKNRPEHNQSLFAIAVPNETIKTRMALFEQAKLALSII
FT                   EIPETAQRNVARLFEQSDRALALLAFDELGGLLTFTADGELYLSRRIEITLPQLRDANE
FT                   ALREQYRDRVELELQRSLDYFDRQFNHLSLSRVLLSAPEDSGLLDYLVSTVGMAVEGVD
FT                   LSQVLDISAVPAMADSEFAAMVLPTLGAALRQERRA"
FT   gene            287526..288122
FT                   /locus_tag="Galf_0236"
FT   CDS_pept        287526..288122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0236"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   slt:Slit_2596 putative mannose-sensitive agglutinin (MSHA)"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54281"
FT                   /db_xref="GOA:D9SJ05"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ05"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ADL54281.1"
FT                   /translation="MSQQINLFNPDFLKQETHFSLVTMLQGLAVIFVGALILYGYALYQ
FT                   VRELDKQAAQVLARLNVEQSALAGYSAGFSPQKTNELLQSELQQLEKKAEEARSLTDTL
FT                   REGQVSNTSGFSEYMRAFSRQVVPGLWLTGFKVNSAEITLSGGTLAPESVPAYIQKLSH
FT                   ESIMHGKSFSNLQMQPAKEAKYLEFTLFTAPDSQL"
FT   gene            288119..288775
FT                   /locus_tag="Galf_0237"
FT   CDS_pept        288119..288775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0237"
FT                   /product="putative mannose-sensitive agglutinin (MSHA)"
FT                   /note="KEGG: slt:Slit_2595 putative mannose-sensitive
FT                   agglutinin (MSHA)"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54282"
FT                   /db_xref="GOA:D9SJ06"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ06"
FT                   /inference="similar to AA sequence:KEGG:Slit_2595"
FT                   /protein_id="ADL54282.1"
FT                   /translation="MKKYWELTRTKVDAMSTRERAMIFSVAVGLLILLLNALMLDPLLV
FT                   RQKTISQQMAQQEQETNNLQQAIKAILQAKQDIQHSPLRVRISELKAQLQENENFLKER
FT                   SARLVDPAKMAALLEQVLSRNDKLQLVELKTLPLSLLLEQKTDAKTAAPPVYKHGVQIT
FT                   VRGDYLDLLRYLTALETMPIQMFWGEVSLSVAKHPDSLLTLTVYTLSLDKTWLTV"
FT   gene            288760..289224
FT                   /locus_tag="Galf_0238"
FT   CDS_pept        288760..289224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54283"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ07"
FT                   /inference="similar to AA sequence:KEGG:Slit_2594"
FT                   /protein_id="ADL54283.1"
FT                   /translation="MVDGMSRAQLVAGCESFLVGLEWRNWTAYLLGLLFIGLSFASVAE
FT                   ELADPTRPPVSVSTPVDESVRVETKLEPGLQSILIAKNRRAAIIDGQTVEIGGRVGEAR
FT                   LIEVNAMNVVLKTSKGKQVLMLFPDVTISKTKNDAPPVQTDKKVSNGDKK"
FT   gene            289221..290942
FT                   /locus_tag="Galf_0239"
FT   CDS_pept        289221..290942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0239"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   Secretin domain protein; Secretin/TonB short domain; KEGG:
FT                   slt:Slit_2593 type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54284"
FT                   /db_xref="GOA:D9SJ08"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ08"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ADL54284.1"
FT                   /translation="MKKIGVFFVGFLLLSGCAANKSHNQTVDSIRQEMNQAVQPSKDDA
FT                   VNEALLPQLDAAMLKTDSKPLETKFDLSVNNTPASQVFMAIVSGTRYSMLVHPDVTGNI
FT                   SLNLKDVTVFDALEAVKEMYGYDYKLDGTRIFVQPLTLQTRIFQVNYLTGLREGSSSLR
FT                   VKSSSVSDNVGNASAQAQANANVGQSSSQYQYGAASTDTSKVSMKSKSDFWEELAQALR
FT                   LILGGKDASDGKGARLPADRSLSVSPMSGVIVIRALPDEIRNVTAFLKASQISVERQVI
FT                   LEAKIIDVQLNDSFQSGVNWGAFKNGLNSFSSVGVGGAGSVLNPATAGVGATDISSAAL
FT                   SALPGASLLPNAAGTGSLFGLAFQTSSFALLLNFLESQGDVHVLSSPRISTLNNQKAVL
FT                   KVGTDEFFVTEISGGSQATVNVAGTAPTIKTQPFFSGIVLDVTPKIDENNEIILHVHPS
FT                   ISSVTTVNKVLNLGATTGTYTLPMASSSISETDSIVRARDGQIVAIGGLMRQDSTNGES
FT                   GLPGLSKSIFGQTSKVSSKRELVILLKPTVVDSDRDWSDDIARSRDRVENLSRKTK"
FT   gene            290977..291936
FT                   /locus_tag="Galf_0240"
FT   CDS_pept        290977..291936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0240"
FT                   /product="general secretion pathway protein, ATPase"
FT                   /note="KEGG: slt:Slit_2592 general secretion pathway
FT                   protein, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54285"
FT                   /db_xref="GOA:D9SJ09"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ09"
FT                   /inference="similar to AA sequence:KEGG:Slit_2592"
FT                   /protein_id="ADL54285.1"
FT                   /translation="MYLKHFGLHEAPFGLTPDTSFFFACSSYQEALNTLLVAAHNGEGF
FT                   IKITGEVGNGKTMLCRKFLATLNEGMQSTTPIGTQDQAASAVAGQNFITAYIPNPYLEP
FT                   RSLLLALADEFRVPLDKDSDQHQLMKGLTNALLDCARYGQRALVCLDEAQALPLPTLEV
FT                   LRLLTNLETEKRKLLQVVLFGQPELNAHLAQYSIRQLRQRISFQYELRGLLPDELDRYV
FT                   RHRVRVAGFAGDTLFDMAAIAKLHRVTKGTPRLVNIIAHKALMLAYGEGQQHVSARHIG
FT                   VAAADTPESRRDWFALGLKAGAVIAVLLVVVSGLVLLR"
FT   gene            291933..292970
FT                   /locus_tag="Galf_0241"
FT   CDS_pept        291933..292970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0241"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: slt:Slit_2591 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54286"
FT                   /db_xref="GOA:D9SJ10"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ10"
FT                   /inference="similar to AA sequence:KEGG:Slit_2591"
FT                   /protein_id="ADL54286.1"
FT                   /translation="MSVINQMLNGLEQRGVTVATGQLRTVHASNKYRRVQFVLLAGLLV
FT                   ILAALLWRGVNGPSLITKQPVVAKVLPVAPVIPAISAIKPAAILPEKQAVVAPKVQPIK
FT                   QAVMVPKVQPEKQAAPQVKTMPLAKRAAAPPALKAVAPAVPDANLPGAVKQVSLRQQAE
FT                   AEFHKATVYMQQGRSIEAQAGLEAVLRMDAGFDAARHSLVSLLLESKRNTGAEQVLQEG
FT                   LKIRPANSGYAMLLARLQVQRGELDQAIATLALTLPYAVQQADYQAFYAALLQRRARHK
FT                   EAVEHYQVALKASPNSGVWLMGCGISLQALGKNDEAKEAFLRALSSKTLSAELQAFVQQ
FT                   KIKSL"
FT   gene            complement(292967..294223)
FT                   /locus_tag="Galf_0242"
FT   CDS_pept        complement(292967..294223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0242"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: slt:Slit_2270 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54287"
FT                   /db_xref="GOA:D9SJ11"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ11"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL54287.1"
FT                   /translation="MSKFSINLHEAVYSLSNALDLVGVTHIHHGKHVAYMATECGKKLG
FT                   WQGARMDDLFQAAILHDSGVSKTVIHQRLAQFEWEDEIDHCKSGAKLLSTCPLLAKLAP
FT                   IVRHHHTHWSELKDLDLPMEVKLSANCIYMVDRVDVLALGFLVDQSNLLLGREEIRQKI
FT                   FTKRGEWFCPELVDAFMEISRSEAFWLLLENEQVNGYVSVWLAETQSREMDFEELRSIV
FT                   SIFSYIVDAKSSFTKEHSDGVARLARYLGGLFNLSNETCEMLELAGLLHDIGKLRQPDE
FT                   LLDKAGKLTDEEYAHIQRHSFDTYIILKDIRGLEKITAWAAQHHERVDGSGYPYHLGDS
FT                   GISLEARIVAVADVFQALAQKRPYRDPLNPDAIMEILNEMVDDKKLDRSVVICVDQHLQ
FT                   DCWLAAVGGDKVPKFDTIA"
FT   gene            complement(294335..295048)
FT                   /locus_tag="Galf_0243"
FT   CDS_pept        complement(294335..295048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0243"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: slt:Slit_2590 phosphoribosyltransferase;
FT                   manually curated; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54288"
FT                   /db_xref="GOA:D9SJ12"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ12"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADL54288.1"
FT                   /translation="MSILNTLKLNSRLKFDQILPAQPCVLCGTMSHAGLWCTACDYEMP
FT                   YFDAPHCPVCARNTPDGSLCGHCLTHPPAFHHTLAVFSYQFPIDQLIQSLKYHSQLPLA
FT                   PMLAKKLLDRIDEIPDLVIPMPLHPVKLKDRGFNQASLIATPIARKLGVPLNETACHRL
FT                   RNTPSQTSLPWCERERNVRDAFDCTLDLSGKHIALVDDVLTSGASMNELARAVQKWGAN
FT                   KISVWVAARATSNLR"
FT   gene            295106..296101
FT                   /locus_tag="Galf_0244"
FT   CDS_pept        295106..296101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0244"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="SMART: biotin and thiamin synthesis associated;
FT                   Elongator protein 3/MiaB/NifB; TIGRFAM: biotin synthase;
FT                   KEGG: slt:Slit_2589 biotin synthase; PFAM: biotin and
FT                   thiamin synthesis associated; Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54289"
FT                   /db_xref="GOA:D9SJ13"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ13"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADL54289.1"
FT                   /translation="MNTQTIAFHHPVKRTATPERWSVEAVESLFALPFADLLYRAQQVH
FT                   REHFDPNQVQLSTLLSIKTGGCSEDCGYCPQSAFHSTGVEDRKMLALDAVIEAAKAAQA
FT                   AGADRFCMGAAWREPSEADMLSVVDMVQAVRGLGMETCATLGMLNDAQTEQLRAAGLDY
FT                   YNHNLDTSPEFYGDIISTRDYQDRLDTLERVRRAGMHVCSGGIVGMGESLTERAGLVAQ
FT                   LANLNPYPESVPINNLVKVEGTPLADAAELDPLDFVRTIAVARITMPTARVRLSAGRQA
FT                   MSDAIQALCFLAGANSIFYGEQLLTTGNPEVERDRALMDKLGMYPFADKH"
FT   gene            296107..297261
FT                   /locus_tag="Galf_0245"
FT   CDS_pept        296107..297261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0245"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="TIGRFAM: 8-amino-7-oxononanoate synthase; KEGG:
FT                   slt:Slit_2588 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54290"
FT                   /db_xref="GOA:D9SJ14"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ14"
FT                   /inference="protein motif:TFAM:TIGR00858"
FT                   /protein_id="ADL54290.1"
FT                   /translation="MPFTELQLELDERCARGLLRQRRTVSSPQTPELVVEGKPYLSFSS
FT                   NDYLGLANHPDIISALQQGAAEYGVGAGAAHLVCGHFTPHEQLECELAAFAGKPAALLF
FT                   STGYMANLGVVQGLVGRGDTVFADKLNHASLNDAMLLSRATVQRYRHNDMAQLAVLLAQ
FT                   TGRGRKLICVDAVFSMDGDMAPLPELLALCVAHDAWLLVDDAHGFGVLGHQGRGSLSHF
FT                   GLSSPRIIYMATLGKAAGVSGAFVAAEQAVIDTLINNAHSYVYTTASPPALACALRQSL
FT                   QLIAEEDRRRAHLHQLIAQLRTGLHGLPWQLMPSDTAIQPLLVGDNQAALALSMALRAR
FT                   GIWVAAIRPPTVPAGTARLRITLSAAHTEDDVSRLLEALHELAR"
FT   gene            297245..298132
FT                   /locus_tag="Galf_0246"
FT   CDS_pept        297245..298132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0246"
FT                   /product="bioH protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="TIGRFAM: bioH protein; KEGG: slt:Slit_2587 BioH
FT                   protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54291"
FT                   /db_xref="GOA:D9SJ15"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ15"
FT                   /inference="protein motif:TFAM:TIGR01738"
FT                   /protein_id="ADL54291.1"
FT                   /translation="MSLHVDRHGVSGAPLLFIHGWGAHSGMWGDVLPQLATHFKVMAVD
FT                   LPGHGYSRIEDRGSRIEGSAPSALKGEGDASLVLKGEEFGAAVLPFPLPPSRFSLDRIV
FT                   DQLSAQFTEPLSLCGWSLGGQVALRWAMRYPEQVQRLVLVAATPCFTQKADWPCAMEND
FT                   TLAAFSDALRQDSAQTLRRFLGLQVRGGERERELLAILRRSQALRDEPDFVSLQAGLEI
FT                   LRDSDLRDVLVKIKQSALLIAGSCDTLTPLAAMQFMAAKLPQARLVTVEGAAHVPFLSH
FT                   PEEFVKQVADFLHE"
FT   gene            298125..298997
FT                   /locus_tag="Galf_0247"
FT   CDS_pept        298125..298997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0247"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="KEGG: slt:Slit_2586 biotin biosynthesis protein
FT                   BioC; TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54292"
FT                   /db_xref="GOA:D9SJ16"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:D9SJ16"
FT                   /inference="protein motif:TFAM:TIGR02072"
FT                   /protein_id="ADL54292.1"
FT                   /translation="MNEFVIDKKAMRQAFSRAAEGYDASAVLQREVCMRMLERLEYIKL
FT                   QPARLLDAGSGTGWGGRQLAEKYPAAQVISLDIAIGMLQTSKSRSSWWQKLFGGCRQLP
FT                   VCADVEALPLAANSLDMVWSNLAVQWCNDLPATFVELHRVLKTEGLLMFSTLGPDTLKE
FT                   LRQAFKGVDERSHLNRFADMHDIGDMLVQAGFAEPVMDMEYLTLTYEDVRGVLQDLKAI
FT                   GAHNTTAGRGQGLMGKAAWARLLENYEKLRRDGKLPATYEVVYGHAWKPAPRVNRDGAA
FT                   IIKTSFKIK"
FT   gene            299005..299673
FT                   /locus_tag="Galf_0248"
FT   CDS_pept        299005..299673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0248"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: slt:Slit_2585
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54293"
FT                   /db_xref="GOA:D9SJ17"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ17"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADL54293.1"
FT                   /translation="MNFFVTGTDTGVGKTLISCALLHGFARQGLSVVGMKPVAAGCDDG
FT                   GMNEDVRALLAASNVLASRGQINPYSFERAVAPHLAAKFVGVRISLERILQSYSELESQ
FT                   ADVVVVEGAGGFRVPLNEGQDSADLARQLKLPIILVVGMRLGCLNHALLTADAITRCGL
FT                   KLAGWVANCVDGEMRMLNENIEALTERIKGPLLGVVPHHQNAPDASEVVRFLDMTLLKH
FT                   "
FT   gene            299741..300451
FT                   /locus_tag="Galf_0249"
FT   CDS_pept        299741..300451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0249"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: slt:Slit_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54294"
FT                   /db_xref="GOA:D9SJ18"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ18"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADL54294.1"
FT                   /translation="MTEFSIIAVFFVGLLGGVHCLGMCGSLVGILTTQLPAGGARWPFH
FT                   LAYSGGRVTSYTLAGLLAGAVGQAGLLLRDVVPVQHLLFALSSLMLIALGLYLAGLWGA
FT                   VRRIETLGKLLWQRIQPLTRGLFPVSTPLRAFLLGTLWGWLPCGLVYSVLITALASGQA
FT                   STGALVMLAFGLGTLPNLLAIGLFWENMRGWVQSPKVRRVAGLLVVGIGMYGLTKVGYT
FT                   FYVNGWAGSCHVAA"
FT   gene            300438..301028
FT                   /locus_tag="Galf_0250"
FT   CDS_pept        300438..301028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0250"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   slt:Slit_2583 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54295"
FT                   /db_xref="GOA:D9SJ19"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ19"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADL54295.1"
FT                   /translation="MLLRNGFVFLLMLFIAGCGEPKLPSPFHAAEVGAKYAGADFKLTD
FT                   HTGKLRTLHDFRGKVVVLFFGYMHCPDVCPTTMADLSQVMTRLGKDADRVQVLFVTVDP
FT                   ERDTQALLAQYVPAFHPSFLGLFGDAGSTAQVAKVFDVMYQKQATATGYNVDHSAGSFL
FT                   IDTDGRVRLLSPFAQRTDWLEQDIRLLLALGKS"
FT   gene            301120..301767
FT                   /locus_tag="Galf_0251"
FT   CDS_pept        301120..301767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0251"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: slt:Slit_2581 two component transcriptional
FT                   regulator, LuxR family; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54296"
FT                   /db_xref="GOA:D9SJ20"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ20"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54296.1"
FT                   /translation="MKILMADDHALFRDGMRYVLQQLSDTLELLEVNNFPECLKVVAQH
FT                   PELDLVLLDLNMPGSEGARSVSYFHQRFPRIPVVVVSGDDALANMEKVMDYGASGFICK
FT                   SSTSHAMLAALKRVLSGEIYVPPEIFRQRSVQAVDKRSMHTNGYGLTPRQMEVLEHICA
FT                   GMSNKEIASHTHLAEGTVKIHVAAVYQTLKVNGRLEAVRVAERLGLVGGAHG"
FT   gene            301760..304027
FT                   /locus_tag="Galf_0252"
FT   CDS_pept        301760..304027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0252"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="KEGG: slt:Slit_2580 cell division FtsK/SpoIIIE;
FT                   PFAM: cell divisionFtsK/SpoIIIE; DNA translocase ftsK
FT                   gamma; SMART: DNA translocase ftsK gamma; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54297"
FT                   /db_xref="GOA:D9SJ21"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ21"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADL54297.1"
FT                   /translation="MAEGSRDLPGNTLLGLLRESRWLLLAVCAVYFAVALFGYHPDDSA
FT                   WSHSTASTKILNPTGVLGAYVSDLLFYLLGVSAWWLVLFMLQQVWAGYRRLRADSVFCK
FT                   RTLWVSFIGFCLLLLSSSALEAIRLHTLATPLPLAPGGMFGMLIGDALSRLLGFTGATL
FT                   LLLALMASSFSIFSGLSWLRFMDWLGARLEAIYYWGRQFWQTRQDKRIGAQATTERGAV
FT                   VEVEKKRVEVHQPIYIEQPVMEVVKSARASEEKQITLFADMPDSPLPPLHLLDPATHQV
FT                   ETVSADTLEFTSRLIERKLKDFGVEVKVVAAFPGPVITRYEIEPAVGVKGSQITNLVRD
FT                   LARALSVVSIRLVETIPGKSYMALELPNAKRQMVQLSEILGSQVYADMHSMLTIAMGKD
FT                   ISGKPVVADLAKMPHVLVAGTTGSGKSVGINAMILSILYKATPQQVRMLLIDPKMLELS
FT                   VYEGVPHLLCPVVTDMRQAASGLNWCVQEMDKRYRLMSHFGVRNIAGFNQKHREAIKAD
FT                   KPLTNPFSLTPDDPEALDELPLIVVFIDELADLMMVVGKKIEELIARLAQKARASGIHL
FT                   VLATQRPSVDVITGLIKANVPTRIAFQVSSKIDSRTILDQMGAEALLGQGDMLYLPPGT
FT                   GYPQRVHGAFVSDQEVHRIAEYLKSQGEPQYIDGVLNSLEDSGDDGGVSPTLDAESDPL
FT                   YDQAVEIVVKSRRASISLVQRNLRIGYNRAARLVEQMEAAGIVTAMQSNGNREVIAPQR
FT                   QE"
FT   gene            304103..304717
FT                   /locus_tag="Galf_0253"
FT   CDS_pept        304103..304717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0253"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="KEGG: slt:Slit_2579 outer membrane lipoprotein
FT                   carrier protein LolA; TIGRFAM: outer membrane lipoprotein
FT                   carrier protein LolA; PFAM: outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54298"
FT                   /db_xref="GOA:D9SJ22"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ22"
FT                   /inference="protein motif:TFAM:TIGR00547"
FT                   /protein_id="ADL54298.1"
FT                   /translation="MKYILAILLAALSFSAQAGAIEKLKTFIAATHSAQANFTQVVQDQ
FT                   NGKRMQSASGVMQFQRPGRFRWTYQKPYEQIIVGDGAKFWLYDKDLNQVSVKKLDAALG
FT                   SSPAALLAGSNEIERGFVLKEAGSREGFEWLQATPKAQDSSFSAVLMGFDADASLVAME
FT                   LNDTFGHKTVLRFSGMQRNPRVSAQQFQFTPPAGADVIAGD"
FT   sig_peptide     304103..304159
FT                   /locus_tag="Galf_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 19"
FT   gene            304722..305567
FT                   /locus_tag="Galf_0254"
FT   CDS_pept        304722..305567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0254"
FT                   /product="KilA, N-terminal/APSES-type HTH, DNA-binding"
FT                   /note="PFAM: KilA, N-terminal/APSES-type HTH, DNA-binding;
FT                   KEGG: plu:plu1205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54299"
FT                   /db_xref="GOA:D9SJ23"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ23"
FT                   /inference="protein motif:PFAM:PF04383"
FT                   /protein_id="ADL54299.1"
FT                   /translation="MKSRTINVKGGDITIVTREEQDYISLTDMVKHFDGGSALIEQWLK
FT                   NKDTVLFLGVWEQLNNPGFNSNSPEFEGIRNEAGRNSFFLSAKKWIDATGAIGLYAKAG
FT                   RYGGTYGHRDIAFEFGSWLSPEFKLYLIKEFQRLKDKEASTASLEWSFQRTLSKVNYKT
FT                   HTDAIKERLIPSRLTKAQTGIIYASEADLLNVALFGLTAVQWRQANTDVPGNMRDVATL
FT                   EQLVVLSNLESINAVLIHQGLEPSERLTQLNNIAISQMQSLLGNRMVKKLAKPVETLNE
FT                   "
FT   gene            305560..306879
FT                   /locus_tag="Galf_0255"
FT   CDS_pept        305560..306879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0255"
FT                   /product="MgsA AAA+ ATPase-like"
FT                   /note="KEGG: slt:Slit_2578 AAA ATPase central domain
FT                   protein; PFAM: MgsA AAA+ ATPase-like; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54300"
FT                   /db_xref="GOA:D9SJ24"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ24"
FT                   /inference="protein motif:PFAM:PF12002"
FT                   /protein_id="ADL54300.1"
FT                   /translation="MNDLFAAAQPDAPLAERLRPKHIDEVIGQSHLLGEGRPLRLAFQS
FT                   GRLHSMILWGPPGVGKTTLARLMASAFDAEFMPLSAVLSGVKDIREAIAQAQRVLQQNG
FT                   RHTILFVDEVHRFNKSQQDAFLPFVEQGLVTFIGATTENPSFEVNNALLSRAQVYVLHA
FT                   LSEEELGQLFERAQAVAMPGLSFADDAHERVIGYADGDARRLLNVLEQLQTAAETAGKT
FT                   LIDSVFLDNTLAQNLRRFDKGGEAFYDQISALHKSVRGSNPDAALYWLVRMLDGGADAR
FT                   YMARRIVRMAWEDIGLADPRAIQLANDAAQTYERLGSPEGELALAQAVIYLACAPKSNA
FT                   GYVAYNAARAFVAQDGSREVPLHLRNAPTKLMKQLDYGRDYRYAHNEAGGYAAGENYFP
FT                   DGMPDVSFYQPTERGLEGKISEKLTRLRELDEQARAGSNK"
FT   gene            306848..307603
FT                   /locus_tag="Galf_0256"
FT   CDS_pept        306848..307603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0256"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: min:Minf_1771
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54301"
FT                   /db_xref="GOA:D9SJ25"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ25"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL54301.1"
FT                   /translation="MSRLVQAAINKGAGLSDFQTNSDDWPEHAAAPNTHNRVLELVQQY
FT                   LPAGLKVCDLPCGAGMFSARLSQLGMDVTAVDLEAVEPFYFDKARRVLADANLILPFAD
FT                   GEFDALVSIEGIEHLENPSFFMRECARLVKPGGLVILSTPNVDSYRSRRSTYVHGFHKY
FT                   FKPVSAHHKMAWHLHPIDMTFVRGAVRKAGLEILEVAVNRMTGKNLWSEALRPIFNRKL
FT                   PAELRGEIPYYGEVIIYILKKPAADGAGA"
FT   gene            307616..308911
FT                   /locus_tag="Galf_0257"
FT   CDS_pept        307616..308911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0257"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="KEGG: slt:Slit_2576 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54302"
FT                   /db_xref="GOA:D9SJ26"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ26"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADL54302.1"
FT                   /translation="MLDIQVLRSDLDGVAARLATRGFVLDTARFGELEAARKAIQVRTQ
FT                   ELQSKRNSASKLIGQAKAKGEDTTAIMAEVTLVGEELKSIEVQLGALQGQLQQLLEGLP
FT                   NMPHESVPIGGSEADNVEVRKSGSVPVFDFAVKDHVELGEALGGLDFETAAKISGARFS
FT                   VLKGGLARLHRALAQFMLDTHTDTHGYTEVYVPYLVNADSMRGTGQLPKFEEDLFAVPR
FT                   QMGEGGMQNFYLIPTAEVPVTNMVRDEIIPLEQLPLKYVAHTPCFRSEAGSAGRDTRGL
FT                   IRQHQFEKVELVQIVHPDDSYAALEQLLGHAEAILQKLGLHYRVVRLCTGDIGFSSATT
FT                   YDIEVWLPAQNTYREISSCSNFEAFQARRLQARFKSGTGKPELLHTLNGSGLAVGRTLV
FT                   AVLENNQLADGSISIPEVLRPYMGGLAVLSAS"
FT   gene            complement(308999..310495)
FT                   /locus_tag="Galf_0258"
FT   CDS_pept        complement(308999..310495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0258"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="KEGG: slt:Slit_2569 lytic transglycosylase
FT                   catalytic; PFAM: Lytic transglycosylase catalytic;
FT                   extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54303"
FT                   /db_xref="GOA:D9SJ27"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ27"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADL54303.1"
FT                   /translation="MQRHKLIIRLFQISVFFALMLFGYTHLNKHIASWSDEELIVVIAQ
FT                   DSTLSDEEFSKQLAQQFADHLYVPLKIILVPADQISATLQKHQAHLSASGFRLDQKSSG
FT                   LLLGPGFLTVREQVAFNQDQDAPKHLNDLIGKRIAVVAGSTHEKALIALKEQLPQLAWE
FT                   SRTMQTVEDLLKEVAQRSLDFTIANHEQISQMLNYYENLAVAFDIGKPSKLAWAFPHDA
FT                   DNELIAEAEQFFAEIEKNGELHKLLDRYYGHNDRLATLDAAEFIEQTNKTLPKFRTLFE
FT                   KAGRIVNEDWRLIAAIAYQESHWDPLATSMTNVRGMMMLTEATADRMNVTNRLDARESI
FT                   NAGAKYLELIKKQLPPRIEEPERTWLALSAYNQGQGHLEDARTLTARKGGNADSWVEVK
FT                   KWLPQLNNPVYFEKLKHGYARGGEAVIFVENIRAYYDMLTRLTDDTTPARDYQLVSTRE
FT                   KPAFSLHTPRKLKATAGGDKTEASYSLSDQRSIDGQHPPL"
FT   gene            310544..310634
FT                   /locus_tag="Galf_R0011"
FT                   /note="tRNA-Ser1"
FT   tRNA            310544..310634
FT                   /locus_tag="Galf_R0011"
FT                   /product="tRNA-Ser"
FT   gene            310742..310906
FT                   /locus_tag="Galf_0259"
FT   CDS_pept        310742..310906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54304"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54304.1"
FT                   /translation="MPMTGVFLLTDIRSVIDLYQTTPAYIVYYSLMQFMVKLECFRWEC
FT                   AADCRNLLY"
FT   gene            311032..312462
FT                   /locus_tag="Galf_0260"
FT   CDS_pept        311032..312462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0260"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit I;
FT                   KEGG: slt:Slit_0411 cytochrome c oxidase, cbb3-type,
FT                   subunit I; PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54305"
FT                   /db_xref="GOA:D9SJ29"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ29"
FT                   /inference="protein motif:TFAM:TIGR00780"
FT                   /protein_id="ADL54305.1"
FT                   /translation="MEATQATPVKYDMDIVRWFTIAAVIYGVVGTLIGVYVAFELAFPF
FT                   LNFDIPEITFGRLRPLHTNAVIFAFGGCVLMATGFYIVQRTGATKLWSNTMAWFTFWGW
FT                   NLIIVLAVITLPLGLSEGKEYAELPWWVDIMIAVVWLSYGLNYIMTIGIRKTSHIYVSN
FT                   WFTMGMIVMITYLHVVNSLAIPVDWATSYSIYSGVQDAMIQWWWGHNAVGFYLTGGFLG
FT                   IMYYFIPKQSGRPVFSYRLSVLHFWTLTFGYVWLGAHHLQYTALPDWTGSLGAAVSLAM
FT                   IIPSWGGAMNGMMTLSGAWDKLRTDYILRFLVTAMAFYAMSTFDGPVMAIKSVNALSHY
FT                   TDWTVGHVHAGALGWMSMISFGALYHMVKKLWNTEMYSDKLVNVHFWVALIGATTYVVA
FT                   MWVSGIMQGLMWRDYDEFGTLTYTFVESVSAMHPYYVMRAVGGAIFNLGAWIMLFNVVM
FT                   TIRQASAVRGVNAVAAKA"
FT   gene            312475..313272
FT                   /locus_tag="Galf_0261"
FT   CDS_pept        312475..313272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0261"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="KEGG: slt:Slit_0412 cytochrome c oxidase, cbb3-type,
FT                   subunit II; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   subunit II; PFAM: cytochrome C oxidase mono-heme
FT                   subunit/FixO"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54306"
FT                   /db_xref="GOA:D9SJ30"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ30"
FT                   /inference="protein motif:TFAM:TIGR00781"
FT                   /protein_id="ADL54306.1"
FT                   /translation="MSDHDKIYSTKFQDKIERNTLLMFVLTAIAVAVGGIVEIVPLFYL
FT                   PNTGMNGGDGTFNGTSHKDLQGNAIPMDKIVWNPTTSAHKTLADWQPGDGVRPYTALET
FT                   AGRHVYIREGCFLCHSQMIRPFRDEKDRYGHYSIAEESMYDHTYQWGSKRTGPDIARLG
FT                   GKYSDEWHRKHLKYPRDVVPESVMPNFFFLDKAMVDKTKTVKTLEVMTKMPFNPVPKTI
FT                   YTDAYIAGAAAELEGKTEMDAVIAYLQSLGNHVKFEEGVNYRD"
FT   gene            313277..313477
FT                   /locus_tag="Galf_0262"
FT   CDS_pept        313277..313477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54307"
FT                   /db_xref="GOA:D9SJ31"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ31"
FT                   /inference="similar to AA sequence:KEGG:Slit_0413"
FT                   /protein_id="ADL54307.1"
FT                   /translation="MNYLHTDWAAMSGNDWQGVFFTVAAFIAMIVVYVMVFNPKNKDAF
FT                   DSQSDMALREDGEYNNSGDKK"
FT   gene            313474..314475
FT                   /locus_tag="Galf_0263"
FT   CDS_pept        313474..314475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0263"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: slt:Slit_0414
FT                   cytochrome c oxidase, cbb3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54308"
FT                   /db_xref="GOA:D9SJ32"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ32"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADL54308.1"
FT                   /translation="MSDNHNSAGGVPTTGHVWDDDLADFVNQPPKWWMLGLTASALWVV
FT                   IYFIMYPAIPLATNGTFFKGIGLPGTGQWTAIKELAEDQKVLDDVRRPFEDKLKTMTPA
FT                   AILADEELSKYVERSGKVLFSDNCGGCHGQNGVGTEQVGAKFAVREQGLMAPRLNDDDW
FT                   LYGGKIDDIHATIAGGRQGMMTAHKDTLSAQQIEDVSKYVLAMSEGRGDSEAAGKKVFM
FT                   ESDCTACHGADAKGIQAMGSANLTDRVWRFDGSIEGIKQTITYGVNSGDANARAAIMPN
FT                   FTAAGKLSDVDMKKLAVYVYKFGGGQKDEAAAPVAAVEAAPAPEAAPAPEAK"
FT   gene            314533..314655
FT                   /locus_tag="Galf_0264"
FT   CDS_pept        314533..314655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54309"
FT                   /db_xref="GOA:D9SJ33"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54309.1"
FT                   /translation="MGHDFVYWSLMIGTAGAFAALIFALVFLFKNAMTKKSGDK"
FT   gene            314841..316262
FT                   /locus_tag="Galf_0265"
FT   CDS_pept        314841..316262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0265"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: slt:Slit_0416 cytochrome c oxidase accessory
FT                   protein CcoG"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54310"
FT                   /db_xref="GOA:D9SJ34"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ34"
FT                   /inference="protein motif:TFAM:TIGR02745"
FT                   /protein_id="ADL54310.1"
FT                   /translation="MSEPVKEVGSVTGIYSEHVEWATNLGDKTIHAKRMPGRFRTLKYI
FT                   TESFWLIFFFGAYLRWNGKQALLLDVNNRQFHIFNLTILPQDIWMVSLLLLLLAMTLFA
FT                   VTSVASRVFCGFFCFQTAWVDLFTWVEEKIEGNPNKRHKLDAAPWNADKILRKVSKHLI
FT                   WLAIAVFTGISFTIWFEDAFVYWHDLMHFKLSMMEMTTLTAFTLGTYFLAGFMREQACL
FT                   WLCPYARIQAVMADSQTILPAYDVARGEPRGKLRSGGKVVEQQGDCIDCFQCVQVCPTG
FT                   VDIRDGQQLGCITCGLCLDACDSVMDKIGKPRGLIRYASLDELEGRPVKKLYQHPRTWV
FT                   YIVIILLALGGIIYGLTHLGAMKLSVEPERQPLFVRMSDGSIQNKYTFKVLNKTDKDLY
FT                   VKVSAEGGVKGQVIVDADKPQLVHHGKAAGFTVFVKAPAENVAGEVTKMQFRVENVENP
FT                   TIAAEYNSVFRGPKR"
FT   gene            316277..316837
FT                   /locus_tag="Galf_0266"
FT   CDS_pept        316277..316837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0266"
FT                   /product="FixH family protein"
FT                   /note="PFAM: FixH family protein; KEGG: slt:Slit_0417 FixH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54311"
FT                   /db_xref="GOA:D9SJ35"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ35"
FT                   /inference="protein motif:PFAM:PF05751"
FT                   /protein_id="ADL54311.1"
FT                   /translation="MISQKQKGWRNPWVFGLLIIILSGVLINARFLWNVLHNPVRVLDD
FT                   NYSVKAHNKYDAKWVQQQAERSTLGWQASLHSPQRLQNDSQAKPDEARFILTASPAILQ
FT                   FNLLDRESKPVQSGAVVVVAQWPGDPNFDFKETLREIAPGHYQGELKFPRAGNWDLLIR
FT                   AERDGSQFDTEQKVFVAISKQPE"
FT   gene            316846..319299
FT                   /locus_tag="Galf_0267"
FT   CDS_pept        316846..319299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0267"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: slt:Slit_0418 copper-translocating P-type
FT                   ATPase; TIGRFAM: copper-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; heavy metal translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; Putative metal-binding domain of
FT                   cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54312"
FT                   /db_xref="GOA:D9SJ36"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ36"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADL54312.1"
FT                   /translation="MSHTETAHLAHAGCFHCGLPIASDAHYQKLLDHGQREFCCFACQS
FT                   VCEAIYEAGLQGYYQRTPQGTLLAPPPMPPRDIEMYDLDDVQQDFVNCQGELRDAHLLV
FT                   EGIHCAACVWLIERGMMRTPGVLSAGVNLAGKRLHLRWNERQVKLSTLIHQLAKIGYSG
FT                   VPYDPEVAEGSMKRINRALLFRLFFAAFAMMNLNLIAIALYSGADRGQFVNFFHWMAFA
FT                   LATPALLYSGYPFYKGALSGLRNASLTMDLPIAIGLTVTYVFSLYVTITGGDRVYFDTV
FT                   TNLTFVILIGRYLEGMFRHQAVSATNRLMDLQPRVATVLREGDEKIVSVRAVKVGETVL
FT                   VKPGSHIPMDGIVLEGSSSVDESMLSGESAHVKKQPDDRVSAGTLNGSGALLVEVQAAS
FT                   QDSTLSKIIRLVEEAQSSKAPIQRLSDSIVPWFVLATLILASVTFYIWSADFEFALMAA
FT                   TSVLIITCPCALGMATPMSIAVASGLGARHGILVKNGVVLETLSRVTHFVFDKTGTLTE
FT                   GKMRVEQVVVAQGQDEEALLALCASVERYSEHSVARAVVIAAEARELPFRDQLVQGFLA
FT                   TAGAGVEAEVAGRQILLGTADWLLKQGVVQSEQLIKVQDTSEAQAKTCVHLAVGGEHVA
FT                   VLVIADTLRVDAKALIDTLREAGIGMTLLSGDRRAVAEEIARQLGGMEVIAEVLPQDKD
FT                   RVIQALQERGECVAMVGDGVNDAPALIRADVGIALGSGTDVSVESADIVLMHNELDKVR
FT                   LATLLSRRTLRTIKQNIGLSFVYNSIMVPLAIMGHVTPLLAAITMPVSSLLVIGNAARI
FT                   RSLFK"
FT   gene            319343..319537
FT                   /locus_tag="Galf_0268"
FT   CDS_pept        319343..319537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0268"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="KEGG: slt:Slit_0419 cytochrome oxidase maturation
FT                   protein, cbb3-type; TIGRFAM: cytochrome oxidase maturation
FT                   protein, cbb3-type; PFAM: cytochrome oxidase maturation
FT                   protein cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54313"
FT                   /db_xref="GOA:D9SJ37"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ37"
FT                   /inference="protein motif:TFAM:TIGR00847"
FT                   /protein_id="ADL54313.1"
FT                   /translation="MDVIYSLIPGMTVFGLVFVGILIWAVKKGQYEDMEGNASRILLDD
FT                   DEDAMLHNQSSAQQDAKKD"
FT   gene            complement(319616..320323)
FT                   /locus_tag="Galf_0269"
FT   CDS_pept        complement(319616..320323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54314"
FT                   /db_xref="GOA:D9SJ38"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ38"
FT                   /inference="similar to AA sequence:KEGG:Slit_0420"
FT                   /protein_id="ADL54314.1"
FT                   /translation="MDKKIILGVIALVVATIGIILMMPDNSVSTPDTLPWKITHPTPDT
FT                   TRVFGITLGKSTLDEVAHTYKYETELEISLFKPSDAAMGVEAFFEEVNFNGLKAKIIMT
FT                   IAIPTEELPGMFERGLRMNSTPSGKRITLTADDLARVRSLPVASLTYMPTARIEESVIS
FT                   KRFGEPAQRIREKKTNLIHWLYPQHGLDVVLGEGQKPFFQYLPPKDFEILRAPLLANGE
FT                   IMTTDSAAKSAVQ"
FT   gene            complement(320325..320828)
FT                   /locus_tag="Galf_0270"
FT   CDS_pept        complement(320325..320828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54315"
FT                   /db_xref="GOA:D9SJ39"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ39"
FT                   /inference="similar to AA sequence:KEGG:Slit_0421"
FT                   /protein_id="ADL54315.1"
FT                   /translation="MEHQVTEAEVSRAKSLHSMLLFDFIVVHVFVFVLALSLLKTSMLP
FT                   ITLMPLLSIALLTNVIFKAKRAINKEESIFVLCHNLLAAKRAKLFLILFIVTGTLTTAL
FT                   VVGGAQFGMSKVTSYALAGGIGQLPFMVALLILVVLEFDAEHQCKDGKIPASALALHSA
FT                   LKKN"
FT   gene            complement(320921..321646)
FT                   /locus_tag="Galf_0271"
FT   CDS_pept        complement(320921..321646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0271"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: slt:Slit_0422 transcriptional regulator,
FT                   Crp/Fnr family; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: cyclic nucleotide-binding; regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54316"
FT                   /db_xref="GOA:D9SJ40"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ40"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADL54316.1"
FT                   /translation="MPLPAPIYHLHSPCSSCNLAELCLPADLSANEMHKLDELSTVKRS
FT                   FARSDYLYRSGDKFRSLFAIHSGSFKTQILHEDGREQVTGFQMAGEIIGLDAISTDIHA
FT                   CDAVALESCVVCELPFNKLEALSREIPLLQRHLHKIMSREIVRDQGIMLLLGSMRAEER
FT                   LAVFLLNLSQRFAARGLSPTQFQLRMSRQEIGSYLGLKLETVSRAFSHFQSERLINVKV
FT                   RTVEILDLAGLQACLNNTR"
FT   gene            321773..323194
FT                   /locus_tag="Galf_0272"
FT   CDS_pept        321773..323194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0272"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="TIGRFAM: oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: HemN domain protein; Radical SAM domain
FT                   protein; KEGG: slt:Slit_0423 oxygen-independent
FT                   coproporphyrinogen III oxidase; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54317"
FT                   /db_xref="GOA:D9SJ41"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ41"
FT                   /inference="protein motif:TFAM:TIGR00538"
FT                   /protein_id="ADL54317.1"
FT                   /translation="MANLINSGDIMLNNNELVVDLELIRRLDKNGPRYTSYPTADRFVE
FT                   AFNAETYSQWLLKREIGGVSRPLSLYIHIPFCNTLCFYCACNKVITKDRSKSAEYVRYL
FT                   IKEMGMQANLLGKGQVVEQLHFGGGTPTFLSDDEIRQVMAAIRENFKLVEDGEYSIEID
FT                   PRKVTNETIALLGEAGFNRISIGVQDFDDDVQRAVNRIQSEEETLGIIAAARANGFKSV
FT                   SIDLIYGLPKQTLEGFGRTLDRIIAANPDRLSIYNYAHMPTLFKPQRRIHEEDLPSPQM
FT                   KLDILGMTGRKLTGAGYVYIGMDHFAKPEDELAVAQRQSRLHRNFQGYSTHSDCDLVAL
FT                   GVSAIGKIGPTYSQNYRELEDYYDALDRDQLPIMRGMELNADDLVRRAIIQDLMCHFEL
FT                   SKESLNIAYLIDFDSYFATELEELREYEMEGLLEISPQWISVTPKGRMLIRNICMVFDK
FT                   YLRTRTEHARYSKVI"
FT   gene            323228..324316
FT                   /locus_tag="Galf_0273"
FT   CDS_pept        323228..324316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0273"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="SMART: HhH-GPD family protein; manually curated;
FT                   TIGRFAM: A/G-specific adenine glycosylase; KEGG:
FT                   slt:Slit_0427 A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54318"
FT                   /db_xref="GOA:D9SJ42"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ42"
FT                   /inference="protein motif:TFAM:TIGR01084"
FT                   /protein_id="ADL54318.1"
FT                   /translation="MKVGSACRWRIRLSSFSSSLIAWQRSHGRHDLPWQCADPYCIWLS
FT                   EIMLQQTQVVTVIPYYQRFVASFPTIAALASATEEQVLAHWSGLGYYARGRNLHRAAQI
FT                   IVAQHGGAFPRQFELILALPGIGRSTAAAICALAYQQNRAILDGNVRRVLARYCGIYGS
FT                   PAIKSVEARLWQQAEALLPLNDVDRYTQALMDMGATLCTRSRPKCASCPVQPDCVAHQT
FT                   GCVADLPTPRQRRVVPERTACFLLLLVDHDVFMERREPAGIWGGLWCLPQFEDEAAALF
FT                   WCAQHGVEAADRQRDALTPFTHTFTHFKLHITPLRVSVTAKPLHVLQTKGAWLRVSDAL
FT                   SSAIPAPVRTILEGYGVPDDAF"
FT   gene            complement(324431..326404)
FT                   /locus_tag="Galf_0274"
FT   CDS_pept        complement(324431..326404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0274"
FT                   /product="potassium efflux system protein"
FT                   /note="KEGG: slt:Slit_0442 sodium/hydrogen exchanger;
FT                   TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; TrkA-C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54319"
FT                   /db_xref="GOA:D9SJ43"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ43"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ADL54319.1"
FT                   /translation="MDNSLSLVLILLATAVMVVVVCRILRLPVMLGYLAVGILIGPHAF
FT                   GWIPDSPSTRHLGEFGVVFLMFSIGLEFSLTRLKAMHRTVFGLGGAQVLSTILLVMAAA
FT                   TLLGVDWRAGLALGGILAMSSTAIVSKMLVERAELNLPYGQQMMGVLLFQDLAVVPLLI
FT                   IIPALASQPDNLHLTLGLAMFKATIVLLILLVFGQHVMRRWFHIVASQKSSELFTLNVL
FT                   FITLGLAYLTELAGLSMALGAFVAGMLISETEYRYQVEEDIKPFRDVLLGLFFVTIGMM
FT                   LNPASIVSNLGWIALALPLLILFKALLVAILARIFEGEWSVALRSGIGLAQAGEFGFVL
FT                   LTLTDGAHLLQGETMQITLATMLLSMVTAPFLIQYGEAISRRFSDEWTNRALQMHQIAI
FT                   KSMSSTGHVILCGYGRSGQKLASILEDEELRFIALDLDSRRVREAAAGNKSVVYGDAAK
FT                   REVLMAAGLMRARVLVVTYKDKHSTLAILRHVKELRPDLPVVVRTNDDTNLELLKNAGA
FT                   AEVVAEVLEGSVMLASQALLLAGVPLNRVIRHVQENRARRYAMFNGYINNSQNSGIEIS
FT                   DDMQPRFLNVMLKADSFAVGKRLRDSELDTLNVEVKALRRYNVHGAQPSEDMVLRSEDV
FT                   LVLLGLPEALLDAEIRLHKGGL"
FT   gene            326540..327526
FT                   /locus_tag="Galf_0275"
FT   CDS_pept        326540..327526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0275"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   KpsF/GutQ family protein; KEGG: slt:Slit_0441 KpsF/GutQ
FT                   family protein; PFAM: sugar isomerase (SIS); CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54320"
FT                   /db_xref="GOA:D9SJ44"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ44"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ADL54320.1"
FT                   /translation="MNKFLADAPRALQLGRQVLDIEAAAVLALSQRLDDHFLQALDVIL
FT                   RCEGRVIVSGMGKSGHIARKIAATMSSTGTPAYFVHPGEASHGDLGMVAGSDVFIALSY
FT                   SGESQELMTIVPIIKRQGAKLISMTGNPASSLARVADVHLNAAVDKEACPMGLAPTAST
FT                   TASLALGDALAVALLDAKGFSAENFARSHPGGSLGRRLLTLVRDVMRSGSRMPLVQEGA
FT                   MLSEALLEMSRKGVGMTAIVDAHGGVLGIFTDGDLRRTLEKKLDFSSTPVKSVMSAHPR
FT                   CIGEESLAVEAVQLMEQYNISQMLVVNTQHQLVGALNMHDLLHAKVI"
FT   gene            327575..328093
FT                   /locus_tag="Galf_0276"
FT   CDS_pept        327575..328093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0276"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="KEGG: slt:Slit_0440 3-deoxy-D-manno-octulosonate
FT                   8-phosphate phosphatase, YrbI family; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54321"
FT                   /db_xref="GOA:D9SJ45"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ45"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ADL54321.1"
FT                   /translation="MFLSRAKLIRLVAFDVDGVMTDGGLFLSDSGEEFKRFNSLDGHGI
FT                   KMLRASGVEVAIITGRTSRCVERRAQNLGIAHVYQGVERKLEAMVDLLGKLQLSRDAAA
FT                   YMGDDVVDLCVMRHVGLAITVPESPQLVQAHSHYMTKRSGGYGAVREVCELIMSAQGTL
FT                   DAQLAPYLK"
FT   gene            328090..328665
FT                   /locus_tag="Galf_0277"
FT   CDS_pept        328090..328665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0277"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   slt:Slit_0439 protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54322"
FT                   /db_xref="GOA:D9SJ46"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ46"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ADL54322.1"
FT                   /translation="MTAVSKYRYWLPLLPLLALLAGVYWLDKQVQQEIAVAAGNQRHDP
FT                   DGIMDNFHATKMDLQGVPRFLLSATQMRHYPDHDTTELDFPRVTMLSSERPPLYVNGNR
FT                   GNVSSRGDEVLFHENVVVRRDAGGDQSAMTLKTEYLRVLPNQDWVNTDRPVTMFNLNTT
FT                   VHAIGLEMDNKARTMKLLSQVRSEHHVK"
FT   gene            328655..329191
FT                   /locus_tag="Galf_0278"
FT   CDS_pept        328655..329191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0278"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="KEGG: slt:Slit_0438 lipopolysaccharide transport
FT                   periplasmic protein LptA; TIGRFAM: lipopolysaccharide
FT                   transport periplasmic protein LptA; PFAM: OstA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54323"
FT                   /db_xref="GOA:D9SJ47"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ47"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADL54323.1"
FT                   /translation="MLNKLSFIFMLLAVSVPCQAERADRDKPIDIDADQVIVDDAKQIS
FT                   TFTGHVILTQGTMVFRGDKIVVVQDKAGFQRGTAYGHTASFRQKREGLDEYVEGFGERI
FT                   EYDTRADTVDFYIQARVKRAQDEVRGEHVTYNSKTEIFQADSKNAAAGTPGRVHAVLFP
FT                   KSKEGAEAKPAAERK"
FT   sig_peptide     328655..328717
FT                   /locus_tag="Galf_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            329188..329910
FT                   /locus_tag="Galf_0279"
FT   CDS_pept        329188..329910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0279"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: slt:Slit_0437 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54324"
FT                   /db_xref="GOA:D9SJ48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ48"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54324.1"
FT                   /translation="MSELRAVALKKKYGLRTVVHDASLSVKSGEVVGLLGPNGAGKTTS
FT                   FYMIVGLVAADGGKITIDDQDITHLPIHRRARLGLGYLPQEASIFRRMTVAQNIQAVLE
FT                   LQDLSDEEIERRLEELLHDLHIQGIRNNPAISLSGGERRRVEIARALATNPRFILLDEP
FT                   FAGVDPIAVLDIQKIIRFLKERNIGVLITDHNVRETLGICDRAYIINAGAVMAEGKPDE
FT                   IIYNEGVRKVYLGENFKL"
FT   gene            329954..331351
FT                   /locus_tag="Galf_0280"
FT   CDS_pept        329954..331351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0280"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: slt:Slit_0436 RNA polymerase, sigma 54
FT                   subunit, RpoN; TIGRFAM: RNA polymerase sigma-54 factor,
FT                   RpoN; PFAM: sigma-54 DNA-binding domain protein; sigma-54
FT                   factor; sigma-54 factor core-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54325"
FT                   /db_xref="GOA:D9SJ49"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ49"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADL54325.1"
FT                   /translation="MKASLQLRMSQQLTLTPQLQQSIRLLQLSTLDMQQEIDRMLDENP
FT                   MLELGDESVYHALSGEPVREDHAQVDNAESERGEAEPFEWNAETRGADDESDAYPEQAA
FT                   LQASMREYLHSQLSVSQLDSRDRLVIGMLIDALDENGYMLQDLAELAGLLPAELELTLD
FT                   DLETALVQLQYLDRPGLGARTLSECLALQLKALPEQTPGRDLAMSLVNGNLDLLAAHDF
FT                   SKIKKLLRCSDASLRVAQELIVSLNPKPGCEFDRSVADYVVPDVIVEQHKGKWRARLNA
FT                   DAMPRLRVNQMYANILQQRDDKSGAPLVSQLQEASWLIKSLRQRFDTILRVAQAIVDRQ
FT                   GAFLEHGDIAMRPLVLREIADVLEMHESTVSRGTTQKFMRTPRGIYEFKYFFGSGLVTE
FT                   SGGVCSSAAIRELIKQLVGGEDTSKPLTDGRMSEILAQQGIVVARRTIAKYREALHILP
FT                   VNLRKSL"
FT   gene            331367..331687
FT                   /locus_tag="Galf_0281"
FT   CDS_pept        331367..331687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0281"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: slt:Slit_0435 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54326"
FT                   /db_xref="GOA:D9SJ50"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ50"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADL54326.1"
FT                   /translation="MNLHITGHHLEITPAIREYATGKFSKIKRHFDNVLDVNIILSVDK
FT                   LKQKAEATVHISGKNVFVECEDENLYAAIDALVDKLDRQVIKHKEKLADRRHDETQVAA
FT                   EE"
FT   gene            331737..332198
FT                   /locus_tag="Galf_0282"
FT   CDS_pept        331737..332198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0282"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="KEGG: slt:Slit_0434 putative PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; TIGRFAM: PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54327"
FT                   /db_xref="GOA:D9SJ51"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ51"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADL54327.1"
FT                   /translation="MNLISKIFSPGNILLDSESTSKKRVFERVGMLFENEMQIGRSQVF
FT                   DSLFAREKLGSTGLGQGVAIPHGRIPKLRDATAAFVRTTHPIPFDAPDGQPVTLIFVLL
FT                   VPELATDLHLQLLGELAQMFSDAQFRERLTACDDPACIYQMFAEWDSAA"
FT   gene            332195..333133
FT                   /locus_tag="Galf_0283"
FT   CDS_pept        332195..333133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0283"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain-containing protein;
FT                   KEGG: slt:Slit_0433 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54328"
FT                   /db_xref="GOA:D9SJ52"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ52"
FT                   /inference="protein motif:PFAM:PF02603"
FT                   /protein_id="ADL54328.1"
FT                   /translation="MSQVNIRQLFEDKQVRLELRRVAGTDGVDRIIDSEAVEASNREMV
FT                   GHLSLIHPSWVQVLSAAELDYLRNLSLDERNLAFEQIEQNGTTCLIVAGDNEIPPELMV
FT                   FANRSSIPLFSSSKPSVHLMWLIRHYLAKELAESTTRHGVFLDVLGVGVMITGESAVGK
FT                   SELGLELITRGSGLVADDVVELHRIAPDTLEGRCPELLRDFLEVRGLGMLNIRTMFGET
FT                   AVRRKKSLKLIVHLHRSQDGELSQMERLPLVATHQEIIGVKINTVNIPVVAGRNLAVLV
FT                   EAAARNFVLQQRGINTMQEFISRHDQMLAGG"
FT   gene            333136..333972
FT                   /locus_tag="Galf_0284"
FT   CDS_pept        333136..333972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54329"
FT                   /db_xref="GOA:D9SJ53"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ53"
FT                   /inference="similar to AA sequence:KEGG:Slit_0432"
FT                   /protein_id="ADL54329.1"
FT                   /translation="MQLFLLSGLSGSGKSVALKVLEDNGFYCVDNLPAELLKGLIEYLL
FT                   SAGYDKMAVSIDVRSANSVQRLPEILLHLMQKDLAVHVLFLDAKSDTLVKRFSETRRMH
FT                   PLSDGVRTLPECVECERELLSEISNIGHHIDTSELGANALRAWIKQFIKLDRARMTLLF
FT                   ESFGFKHGIPLDADYVFDVRCLPNPFYDPLLRSLTGRDAPVIEFLENTPATQEMFADIS
FT                   RFVERWLPHFIADNRSYLTIAIGCTGGQHRSVYISEKLSRHFQSQQQVLLRHRELS"
FT   gene            333977..334357
FT                   /locus_tag="Galf_0285"
FT   CDS_pept        333977..334357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0285"
FT                   /product="protein of unknown function DUF1312"
FT                   /note="PFAM: protein of unknown function DUF1312; KEGG:
FT                   slt:Slit_0431 protein of unknown function DUF1312"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54330"
FT                   /db_xref="GOA:D9SJ54"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ54"
FT                   /inference="protein motif:PFAM:PF07009"
FT                   /protein_id="ADL54330.1"
FT                   /translation="MSPLALDHIRPGDWLTLILGAGSVVLLALMFWSGEIADKAIIRSG
FT                   GKLFREVSLSRNQQIAVPGPLGVSLISIENRKVRIAKDPGPRQYCVRQGWLQQAGEIAL
FT                   CLPNQVSVELVGSHKRYDSLNY"
FT   gene            334359..334955
FT                   /locus_tag="Galf_0286"
FT   CDS_pept        334359..334955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0286"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: slt:Slit_0430 heptaprenyl diphosphate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54331"
FT                   /db_xref="GOA:D9SJ55"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ55"
FT                   /inference="protein motif:PFAM:PF07456"
FT                   /protein_id="ADL54331.1"
FT                   /translation="MQDRGSGIENREEATAPNSVYNSILPPQSSILLNTTAEDHHVARM
FT                   AAVALGLTILEGAIPSPLPGVKPGLANIVTLIVLARYGWRTAAWVSLLRVFAGSLLFGN
FT                   FLTPGFFLSLTGALLSLLALALAQHLPSRWFGPVTHSICAAFAHIAGQMALVYLWLIPH
FT                   AGIAYLIPLFAAAALVFGAVNGLIAARFMDNAETK"
FT   gene            334971..335603
FT                   /locus_tag="Galf_0287"
FT   CDS_pept        334971..335603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0287"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="KEGG: slt:Slit_0429 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54332"
FT                   /db_xref="GOA:D9SJ56"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ56"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADL54332.1"
FT                   /translation="MKTINLAFTGASGMPYGMRLLECLLKSGQRVHLVYSQAAQIVAKQ
FT                   EMGLVLSSRPPEAARVLRERMGEFSGELQVFGRDDWYAPMASGSNPGDAMVICPCTMGT
FT                   LAKVACGISDDLIARAADVMLKEKRTLILAPREMPFSVIHLENMLKLAQAGAVIMPPNP
FT                   GFYYQPQNVQDMVDFVVARILDHLGVTNTLMPRWGACVPENDSEGLR"
FT   gene            335600..336544
FT                   /locus_tag="Galf_0288"
FT   CDS_pept        335600..336544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0288"
FT                   /product="mutator MutT protein"
FT                   /note="KEGG: slt:Slit_2704 thiamine monophosphate synthase;
FT                   TIGRFAM: mutator MutT protein; PFAM: thiamine monophosphate
FT                   synthase; NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54333"
FT                   /db_xref="GOA:D9SJ57"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ57"
FT                   /inference="protein motif:TFAM:TIGR00586"
FT                   /protein_id="ADL54333.1"
FT                   /translation="MSALLQKVVEVAAAVLQRPDGTFLLAQRPADKIWAGYWEFPGGKV
FT                   EAGETAHDALVRELHEELGIEVLTAYPWLTRVFTYPHATVRLSFFRVTEWRGELYPHEG
FT                   QQFSWQQAQDVRVSPVLPANAPILRALELPALYAISNVAELGVESFLIKLQAQLDAGLQ
FT                   LIQLREKNLTPERLRELAVRTVAMAHAAGAKVLINGDLALAREVGADGVHLTSLQLAEL
FT                   TERPSVAWCAASCHTDEELQRAQRLGCDFAMLSPVLPTQSHPGAAHLGWERFSALAAGS
FT                   SIPVYALGGLTRAEMSIAWQRGAHGIALLRQAW"
FT   gene            complement(336532..336723)
FT                   /locus_tag="Galf_0289"
FT   CDS_pept        complement(336532..336723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0289"
FT                   /product="protein of unknown function DUF329"
FT                   /note="KEGG: slt:Slit_2703 protein of unknown function
FT                   DUF329; manually curated; PFAM: protein of unknown function
FT                   DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54334"
FT                   /db_xref="GOA:D9SJ58"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ58"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ADL54334.1"
FT                   /translation="MSKPPIVPCPRCGKESPWDTNNRFRPFCSERCKMIDLGKWADEEF
FT                   RVAVPDDEQDFTAPLYQA"
FT   gene            complement(336720..337481)
FT                   /locus_tag="Galf_0290"
FT   CDS_pept        complement(336720..337481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0290"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   slt:Slit_2702 protein of unknown function DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54335"
FT                   /db_xref="GOA:D9SJ59"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ59"
FT                   /inference="protein motif:PFAM:PF07072"
FT                   /protein_id="ADL54335.1"
FT                   /translation="MISYEFPINEKVRTWLRLEDLFARMNYFLAGEISMEHHVALTTLF
FT                   EIHEVASRPDLKSELLQELERQKRALACLHNNPAISEQALDSILTEIEQASSALLAMTG
FT                   KVGAILRENEWLMSIKQRASMPGGTCQFDLPSYHYWQKQPVALRRSDLQEWLSPLLPIS
FT                   AAISILLRLLRENGRTISFTAHQGTFQQMQGGRAAQLLRVRLAANLPCIPELGANKYAI
FT                   NIRFIVANYEAKSSLLEQDVPFDLTFCTLTT"
FT   gene            complement(337541..338173)
FT                   /locus_tag="Galf_0291"
FT   CDS_pept        complement(337541..338173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0291"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="TIGRFAM: dephospho-CoA kinase; KEGG: slt:Slit_2701
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54336"
FT                   /db_xref="GOA:D9SJ60"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ60"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ADL54336.1"
FT                   /translation="MNSLPQTCIGLTGGIGCGKSTVAHLFEAKGVRIIDTDAIAHQLTQ
FT                   PGGNAIDAIRTHFGSEYLLASGAMDRPKMRHLVFADYAAKAKLENILHPLILTACSQAI
FT                   STPSLAPYTLLMVPLLLENPPFLKLVQRVLLVDCSEQQQISRVMQRSGLDESEIRAIIA
FT                   LQMSRKERIFRSDDLIKNDGMPDELTAQVNNFHNDYQQISNNHLTAS"
FT   gene            complement(338170..339036)
FT                   /locus_tag="Galf_0292"
FT   CDS_pept        complement(338170..339036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0292"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="KEGG: slt:Slit_2700 prepilin peptidase; PFAM:
FT                   peptidase A24A domain protein; peptidase A24A prepilin type
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54337"
FT                   /db_xref="GOA:D9SJ61"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ61"
FT                   /inference="protein motif:PRIAM:3.4.23.43"
FT                   /protein_id="ADL54337.1"
FT                   /translation="MTLFDLLESSAPLFIGTCTLLGLMVGSFLNVVIHRLPKMMELGWR
FT                   SQCAELRGEAPVESEPYNLLVPRSACPQCQHAIRAWENIPVISYLLLRGKCSGCHTAIS
FT                   SRYPIIETFSGLLCGFAAFHFGFGLTALAALILIWALIALTAIDFDTQLLPDDITLPLL
FT                   WAGLLFNLYGAFTSLHDAFLGAVFGYLALWSVFWLFKLVTGKEGMGYGDFKLLAALGAW
FT                   LGWQLLPLIIILSSLVGAIIGIALIIAVKRGREIPIPFGPYLAGGGLIALFWGQTLTQS
FT                   YLQLLAP"
FT   gene            complement(339125..340336)
FT                   /locus_tag="Galf_0293"
FT   CDS_pept        complement(339125..340336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0293"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   slt:Slit_2699 type II secretion system F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54338"
FT                   /db_xref="GOA:D9SJ62"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ62"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADL54338.1"
FT                   /translation="MAVAQQKAKEYTYTWEGKDKSGKLVKGEMRSIGEANLSAYLRRQG
FT                   ITVAKIKRARSSAKAITQKDITLFTRQLATMLKAGVPLLQAFDIVGKGHHNPSVSRLLF
FT                   SIKTDIETGSSLQQAFKKHPLYFDDLYCNLIGAGESAGILDSLLERLATYQEKILAIKS
FT                   KIKSALFYPVSIIVVAFIITAVIMIFVIPAFKELFSSFGADLPAPTLFIMAISDFFVSY
FT                   WWAIFGGIGGGFYTFFYFLKRSRPMQHLMDRVLLKLPIFGELVKKATIARWSRTLSTMF
FT                   AAGVPLVEAFNSVAGAAGNAVYFDATKSIQREVSTGNSLTVAMQNTEVFPSMVIQMVSI
FT                   GEEAGSLDAMLSKVADFYEAEVDDAVEALSSLMEPIIMVVLGTLIGGMVVAMYLPIFKM
FT                   GQVV"
FT   gene            complement(340473..341750)
FT                   /locus_tag="Galf_0294"
FT   CDS_pept        complement(340473..341750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0294"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: slt:Slit_2698 protein of unknown function
FT                   DUF21; manually curated; PFAM: protein of unknown function
FT                   DUF21; CBS domain containing protein;
FT                   transporter-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54339"
FT                   /db_xref="GOA:D9SJ63"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ63"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADL54339.1"
FT                   /translation="MNDFSTASLFGILILLLVCSAFFSGSETSMMAINRHRLNHLIRKG
FT                   NKSAKLTAQLLGKIDKLLGSILLGNTLLNVAAATLTEFIVLRLYGHNELVMLIGTLLIT
FT                   LMLLIFSEILPKIIAASYPERIALPSSYLLTPLITLFHPVVSVAGGIVKGVLWLLRIKV
FT                   QTDQSKQKITLEELRGMVLEAEHFLPRKHQKMLLNLVDLERITVNDVMIPRNQIESLNI
FT                   NADEDALREQIITCHHTLLPVYADTPGNILGILHIKRIPALFQEGNFNTTELRDVLQEP
FT                   YFIPSDTPLLQQLQQFQERHTRMGLVVDEYGELLGLVTLENILEEIVGEFTTQSPSQTG
FT                   KFLRQEDGSILLEGSTTLRELNRKLGLHLPMDSAKTLNGLILEQLEDIPETGTSLKIAG
FT                   YPIEIIQTQDRIVKVARLFPQQVQKQ"
FT   sig_peptide     complement(341670..341750)
FT                   /locus_tag="Galf_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.469 at
FT                   residue 27"
FT   gene            complement(341803..342591)
FT                   /locus_tag="Galf_0295"
FT   CDS_pept        complement(341803..342591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0295"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="KEGG: slt:Slit_2697 prolipoprotein diacylglyceryl
FT                   transferase; TIGRFAM: prolipoprotein diacylglyceryl
FT                   transferase; PFAM: prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54340"
FT                   /db_xref="GOA:D9SJ64"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ64"
FT                   /inference="protein motif:TFAM:TIGR00544"
FT                   /protein_id="ADL54340.1"
FT                   /translation="MLVYPHINPVALQLGPLAIHWYGLMYMAGFLTFLWLGRKRIVTLN
FT                   YTQITNKTLDDLLFYGVLGVILGGRLGEVLFYNPSYYFANPLKILAVWEGGMSFHGGFL
FT                   GVLVAMAVFAYQQKLRWLELMDFIAPLVPPGLAFGRLGNFINGELWGRPTDAPWGMIFP
FT                   HVDNLPRHPSQLYEFALEGVLLFTLLWLYAKQPRPVGAVSGLFLIGYGSFRFLGEFARN
FT                   PDDGIFGLMSLGISMGQWLSLPMVLTGIAMMVWSYRRPVA"
FT   gene            342649..344496
FT                   /locus_tag="Galf_0296"
FT   CDS_pept        342649..344496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0296"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   slt:Slit_2696 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54341"
FT                   /db_xref="GOA:D9SJ65"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ65"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADL54341.1"
FT                   /translation="MPVYRSRTSTHGRNMAGARSLWRATGMKEGDFGKPIIAIANSFTQ
FT                   FVPGHVHLKDMGQLVAREIERAGGIAKEFNTIAVDDGIAMGHSGMLYSLPSRDLIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVNWNGATRGLD
FT                   LVDAMVAAADSHYSDAEVDAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSLV
FT                   ATHAERKQLFLRAGRVIVDLCKRYYEQDDESVLPRNIATFNAFENAMTLDIAMGGSTNT
FT                   VLHLLAIAREAEVDFTMKDMDRLSRHVPTLCKVAPSSEYHMEDVHRAGGIPAILGELDR
FT                   AGLLHGEVGSVHSKTLRDGLAAWDIVQNTDGTADKFFRAAPGGIVTTIAFSQSMLYPET
FT                   DSDRATGCIRDKAHAYSQDGGLAVLHGNVAVDGCIVKTAGVDESILKFTGRARVFESQD
FT                   DAVAAVLADTIVAGDVVVIRYEGPKGGPGMQEMLYPTAYLKSKGLGKVCALLTDGRFSG
FT                   GTSGLSIGHVSPEAAAGGAIGLVVEGDTIEIDIPNRSIVLSISDEEMVRRRTEMASRGR
FT                   LAWKPVSRDRQVSVALRAYAAMTTSADKGAVRDVTQIES"
FT   gene            344554..345459
FT                   /locus_tag="Galf_0297"
FT   CDS_pept        344554..345459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0297"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: tbd:Tbd_2730
FT                   dihydroxyacid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54342"
FT                   /db_xref="GOA:D9SJ66"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ66"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ADL54342.1"
FT                   /translation="MTTALNSQFGIKGQLVFNVDASGLIVAEIDNALGRASLCLQGAHL
FT                   MSWQPKSQAVPVVWLSRDTKPAVGKSIRGGAPVCWPWFGAHASEAGFPGHGFARTVPWR
FT                   VIESGSEPDGATRLTLRLVPSDKTRAQWLHECNVDLTVIVGETLRMEMTTENTGATNFV
FT                   IGEALHTYFQISDIGAIRVTGLEGTEYWDKVGGSNLRRQDGAITFNSEVDRVYINTGSE
FT                   CVIHDDKLARRIHIAKSGSQSTVVWTPWVEKANKMGDMGQPDGWREMVCVESVNAIENV
FT                   VTVAAGTRHTMIVEYRAESV"
FT   gene            345471..345704
FT                   /locus_tag="Galf_0298"
FT   CDS_pept        345471..345704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dgr:Dgri_GH22395 GH22395 gene product from
FT                   transcript GH22395-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54343"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ67"
FT                   /inference="similar to AA sequence:KEGG:Dgri_GH22395"
FT                   /protein_id="ADL54343.1"
FT                   /translation="MRKVILFLALFYGAQAYACDVKHGPVKHKSHKHPCAEHESQPCPM
FT                   QDKHHAGEAAKSAAVLKAPVLDKIVPDAQPSH"
FT   sig_peptide     345471..345527
FT                   /locus_tag="Galf_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 19"
FT   gene            345880..346197
FT                   /locus_tag="Galf_0299"
FT   CDS_pept        345880..346197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0299"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: slt:Slit_2693
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54344"
FT                   /db_xref="GOA:D9SJ68"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ68"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADL54344.1"
FT                   /translation="MKSIIASIAVAAGLMIAGSAMAVDMPANGKAKCGACHAVDKKVVG
FT                   PAWTEVAKKYAGDKDAESKIAANVTKGGAFGWKMGNMPPKGMGASDADIKELSKFIAGL
FT                   K"
FT   sig_peptide     345880..345948
FT                   /locus_tag="Galf_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            346273..346656
FT                   /locus_tag="Galf_0300"
FT   CDS_pept        346273..346656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0300"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: slt:Slit_2693
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54345"
FT                   /db_xref="GOA:D9SJ69"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ69"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADL54345.1"
FT                   /translation="MKKSYVFLVVLFALFLSACNKTEEAHAVAPKAVVASVTESAKTMP
FT                   LAARENNCTACHAIDKKVVGPSWMDIANKYKGDATAEARLIIKVSKGGAGNWGTMPMPA
FT                   NDASGKKPEQMKELVRFILALAK"
FT   sig_peptide     346273..346329
FT                   /locus_tag="Galf_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.360 at
FT                   residue 19"
FT   gene            346790..347944
FT                   /locus_tag="Galf_0301"
FT   CDS_pept        346790..347944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0301"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   slt:Slit_2692 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54346"
FT                   /db_xref="GOA:D9SJ70"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ70"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADL54346.1"
FT                   /translation="MSFRSVSLLFTALFALAACGKSANDQAAGELVVRIGAVAPLTGPQ
FT                   AHLGKDNENGTRMAIDDANAKGITIGGKKVHFELISEDDQADPKTATIVAQKLVDNKVA
FT                   GVIGHLNSGTTIPAAKIYSDNAIPQISPSATAVSYTQQGFKTAFRVMANDAQQGRALGE
FT                   YAVKNLGAVKIAIIDDRTAYGQGLADEFIKAARAAGAQIVAHEYTSDKSVDFTAVLTAV
FT                   KGRQPDLLFYGGMDAQGGPMARQIKALALNVRLMMGDGGYTPEFVKLAGDAAEGAYASL
FT                   PGVPLDKMPGGKDFSDRFVAKYQPIQLYAPYCYDAVNVMIAAMQKADSIDPAKYMPALA
FT                   SLSHQGVTANIQFDGNGDLKGGAVTLYQVKQGKWQVLETVGAEK"
FT   sig_peptide     346790..346852
FT                   /locus_tag="Galf_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.722 at
FT                   residue 21"
FT   gene            347975..348898
FT                   /locus_tag="Galf_0302"
FT   CDS_pept        347975..348898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0302"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   slt:Slit_2691 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54347"
FT                   /db_xref="GOA:D9SJ71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ71"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADL54347.1"
FT                   /translation="MEIFFQQIINGLVQGSVYALVALGYTMVYGILGLINFAHGEVVMV
FT                   GAMLALSALTALIGWGVPPLLALPVSLLLAMAGCMLLGFGIERIAYRPLRHAPRLAPLI
FT                   TAIGVSIVLQNLAMMIWGREYHAFPQLINNQSHHVGGAIINDIQIIIIIMAFVIMAGLM
FT                   LIVHRTSLGRAMRAVAENQHAAQLMGVDVNRVISVTFMLGSALAAIAGLMVSANYGLAH
FT                   YYMGFLLGLKAFTAAVLGGIGNLRGAMLGGLLLGLIESLGAGYIGDLTGGFLGSQYQDV
FT                   FAFFVLIAVLVFRPSGLLGERLAERA"
FT   gene            348895..349995
FT                   /locus_tag="Galf_0303"
FT   CDS_pept        348895..349995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0303"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   slt:Slit_2690 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54348"
FT                   /db_xref="GOA:D9SJ72"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ72"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADL54348.1"
FT                   /translation="MKKYNFSTQHVLNGLLLVSVLLLPFLTDALLGRGWVRIVDFAMLY
FT                   IMLALGLNIVVGYAGLLDLGYIAFFAVGAYCYALTGSPHLALAFPLLFPDGLHLSFWIV
FT                   LPLAAVLAGGFGVLLGAPTLRLRGDYLAIVTLGFGEIIRIFMNNLNAPVNFTNGPQGIS
FT                   RIDPISVAGVSLNSTQQVMGITLPSVHLYFYLFLAFTMLVVFVSSRLEKSRIGRAWMAI
FT                   REDEIAASAMGINTRNLKLLAFAMGAMFGGVSGTLFAGFQGFVSPESFSLMESIMVLCM
FT                   VVLGGMGHIYGVILGGLLLALLPEVLRHSVVPLQQALFGKTLIDPESLRMLLFGVALIV
FT                   VMLYRPAGLWPSRVRRRELESDEAAR"
FT   gene            349992..350762
FT                   /locus_tag="Galf_0304"
FT   CDS_pept        349992..350762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0304"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: slt:Slit_2689 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54349"
FT                   /db_xref="GOA:D9SJ73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ73"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54349.1"
FT                   /translation="MSEPLLALTGIGKQFGGLSALTDVSLHINAGEIYGLIGPNGAGKT
FT                   TLFNVVTGLYQASSGEFRFNGRRFQTGAPHLLAQAGIARTFQNIRLFANLTALENVLIG
FT                   RHARTRAGVFGALFKNRATRDEERASIARARQLLDYVGISKPHQTLAKNLSYGEQRRLE
FT                   IARALATEPLLLALDEPAAGMNATETESLKVLLQAIRSTGVTVMLIEHDVKLIMGLCDR
FT                   VAVLDYGRKIAEGTPDDVRNNPGVIAAYIGAESE"
FT   gene            350755..351468
FT                   /locus_tag="Galf_0305"
FT   CDS_pept        350755..351468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0305"
FT                   /product="ABC transporter related"
FT                   /note="manually curated; PFAM: ABC transporter related;
FT                   KEGG: slt:Slit_2687 ABC transporter related protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54350"
FT                   /db_xref="GOA:D9SJ74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ74"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54350.1"
FT                   /translation="MNKLLEISGLEVGYGGIHAVKGIDFHIGQGELVALIGSNGAGKTT
FT                   TLKALAGLIAPAGGEIIYDGSVLNAVPAHQRVSMGIALVPEGRGVFARLTVAENLLMGA
FT                   YSRCDQAQINEDLARMYALFPRLVERRDQLAGTLSGGEQQMLAMARALMSRPRLLMLDE
FT                   PSMGLAPLMVKKIFETIREVAAQGMSILLVEQNARLALQVSSRSYVMEGGSIALSGVSA
FT                   DLLGSDAVQRAYLGA"
FT   gene            complement(351473..353410)
FT                   /locus_tag="Galf_0306"
FT   CDS_pept        complement(351473..353410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0306"
FT                   /product="RelA/SpoT family protein"
FT                   /EC_number="2.7.6.5"
FT                   /note="TIGRFAM: RelA/SpoT family protein; KEGG:
FT                   slt:Slit_0275 RelA/SpoT family protein; PFAM: RelA/SpoT
FT                   domain protein; TGS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54351"
FT                   /db_xref="GOA:D9SJ75"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ75"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ADL54351.1"
FT                   /translation="MVSIQSTSSQTDAMSWLPGLAGLFSPEEIDVIARACAVAEPLYRG
FT                   QTELTGTPLMQHALGSASILIGMNMDHETIAATILHAVPEYLDDWAEKLKTDFGAPVMA
FT                   LVEGISRLEQIKQFRELRSTDKKIDNSQQIDVLRKMLLAMVSDIRVVLIKLAERTQTLR
FT                   CLSGASPDEQKLIAQETQSLFAPLANRLGVWQIKWELEDLSVRYLDPVLYKQVARLLDE
FT                   RRVDRERYIDDVVQQLKRTLSAAGIEAEVTGRPKHIYSIINKMKRKHLAFDELYDVRAV
FT                   RILVDDVQSCYASLSLVHDLWTQIGSEYDDYIARPKSNNYRSLHTAVIGPREQNFEVQI
FT                   RTREMHQYSELGVAAHWRYKEGGKTDAKLDEKIIWLRQILEWKDDLTDRGDLQAQFKNE
FT                   LFHDQVYVLTPQGRVVDLPKGATPVDFAYMLHTDLGHRTRGAKVDGAIVPLNYKLQNGQ
FT                   RVEILTTKQGGPSRDWLTPALGFLQGARARAKVRAWFKNQNIDESIAQGRIQLDRELQR
FT                   HGVTSVNQEKLAQRLHFNKLDDLLAALGRNEITQRRIAVALSAELPNKIIAIAKPVFRA
FT                   PAEKRSATGILIEGLGNLVTRPAKCCNPAPPDVIIAYVTRDRGITIHRKDCAFALQLTR
FT                   DRLLNAQWSS"
FT   gene            complement(353411..354202)
FT                   /locus_tag="Galf_0307"
FT   CDS_pept        complement(353411..354202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0307"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   slt:Slit_2685 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54352"
FT                   /db_xref="GOA:D9SJ76"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ76"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADL54352.1"
FT                   /translation="MEWAYLLLGATVGLLGGLFGIGGGTVLVPVLLLLFDAQQFPPEHL
FT                   LHLALGTSMATIIFTALASLYKHHQHRAVDWNVVRTITPGILIGTGLGSLLATSIPTHF
FT                   VGILFALFVYFAAAQILFDLRPPVSRQLPGKLIIRLFGVFAGTLSSLVSIGGGTVVIPF
FT                   LLRSNLSIRHAIGTSAAISFPVAIGGTIGYVATGLNASGLPPLSLGYVYLPCLLWTAAA
FT                   SVITAPLGAKAAHRMNIGVLRKLFAVLLLLLATKLLFKVLG"
FT   gene            complement(354204..354668)
FT                   /locus_tag="Galf_0308"
FT   CDS_pept        complement(354204..354668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0308"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   slt:Slit_2684 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54353"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ77"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ADL54353.1"
FT                   /translation="MRYWLMKSEPADVSIDDLASFPDQSVAWYGVRNYQARNFMRDQMA
FT                   IGDGVLFYHSNCKIPGIAGIARVSTTAYPDAKQYDQTSKYFDEKATPEQPRWFNVDVQL
FT                   VKKIPLISLSELRLHPELERMRTLQQGNRLSITPLDPLEWNYITTVLVRD"
FT   gene            354880..356133
FT                   /locus_tag="Galf_0309"
FT   CDS_pept        354880..356133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0309"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   vap:Vapar_0330 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54354"
FT                   /db_xref="GOA:D9SJ78"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJ78"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL54354.1"
FT                   /translation="MNDIATASENTTRERDLARMKWIAAGLLGLAACLYILGKLFALGY
FT                   LAAFAEAAMIGALADWFAVVALFRHPLGIPIPHTAIVTRNKRSIADSLADFVVGQFLSA
FT                   EVIAQRLKRYDAALQLSQWLMLTDNRKRVAGYLSTGFIYGVKALDDRRIHDFIAQATRS
FT                   KLQSIDLSGLLAGSLELVTRGERHHKILHGGLNRFADYVDNPDNNETISAFIKGWSDNA
FT                   FVQSMIEPFVPTIRTAVVNKLRAVAEDETNGLYREYNEQVQSYLQRLQQDPELQAWMNA
FT                   QKEALLSRPEFAAQIELLWDQLREWVVLDLSEPESVLAGKITALVDQLESQLVSNEAVR
FT                   SWINEQIQAALIQAANANKGAVGDLIREEFANWDDKEMVNRLELYLGRDLQYIRINGTL
FT                   VGGLFGLAIYAVTRLIGG"
FT   gene            complement(356196..356372)
FT                   /locus_tag="Galf_R0012"
FT   ncRNA           complement(356196..356372)
FT                   /locus_tag="Galf_R0012"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score
FT                   66.84"
FT                   /ncRNA_class="other"
FT   gene            complement(356396..356707)
FT                   /locus_tag="Galf_0310"
FT   CDS_pept        complement(356396..356707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0310"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   slt:Slit_2683 protein of unknown function DUF710"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54355"
FT                   /db_xref="GOA:D9SJK6"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJK6"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ADL54355.1"
FT                   /translation="MSGQKNMLDVKILDRELRVACPEDEREALLSAVAYLDKKMTEIRD
FT                   AGKIVNVERIAIMAALNIAHELLSTKLGRGVDLSDLTRRMTAMQTAIDQALAEQENLF"
FT   gene            complement(356704..356904)
FT                   /locus_tag="Galf_0311"
FT   CDS_pept        complement(356704..356904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0311"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: slt:Slit_2682 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54356"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJK7"
FT                   /inference="similar to AA sequence:KEGG:Slit_2682"
FT                   /protein_id="ADL54356.1"
FT                   /translation="MENELNTLEQKLGQLIKISSQLRTENHQLRQELAQAQSDNRLCND
FT                   KIESARTRLEKLLPTFPEELS"
FT   misc_binding    357007..357231
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 105.88"
FT   gene            357378..359396
FT                   /locus_tag="Galf_0312"
FT   CDS_pept        357378..359396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0312"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: slt:Slit_2681 TonB-dependent receptor
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54357"
FT                   /db_xref="GOA:D9SJK8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJK8"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ADL54357.1"
FT                   /translation="MHQKLIIIALFGAITLPTVSFAETASLDEVVVTATRFATTSENTA
FT                   VNVTVITAADIEKSAAKTLPSLLAQHVGIQVRSTDGTPDLAVDMRGFGMTGNQNTLVLL
FT                   DGQPLNDIELTSIHWSAIPLDSIERIEIVNGSGAVLYGGGASGGTIHIVTKHPGKGVHG
FT                   IASVGAGSYGAKEWQLALSGSGERLGMRITASGLDTANYRANNNVTQNNLEADIRGDVG
FT                   QGDAFVKFGADNQTIRYPGNRSVNPNTGVNQLLTDPRGTATPLDYGTRNGVHVSLGTAQ
FT                   QFEFGEFAGELSYRDTKRTAYFAAFGGAYLDTALNLLSFTPRIKVPYQLGGAANELTVG
FT                   MDLSNWNYDSSRSSAPANMGTPTTKILAGQSDRALYLQNVNQLGADTKLTLGARSQRVS
FT                   YQARDAVNPAAYASANQVRTANAYELGLRHNLNQTLAVFGRIGRSFRIATVDEIFAQYG
FT                   GPFFDSKVTMLEPQTSQDSELGLDYKSAKDKIRATLYQMNLNNEIHYNALTFTNMNLSP
FT                   TRRYGLELEGTHAYSDSVEVGAAYSYTVAKFSNGTYGGINVSGNNIPLVPRQRLALSTA
FT                   LKLTEKTSLSGSAMYVGQQHFDNDQANTFGQKMPAYTTVDMKLTHREGAWQLAAAVNNL
FT                   FNRQYYTYAVSSTFTPGVYNAYPMQGRNFSLNASYQF"
FT   sig_peptide     357378..357446
FT                   /locus_tag="Galf_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.948 at
FT                   residue 23"
FT   gene            359504..360070
FT                   /locus_tag="Galf_0313"
FT   CDS_pept        359504..360070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54358"
FT                   /db_xref="GOA:D9SJK9"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJK9"
FT                   /inference="similar to AA sequence:KEGG:Slit_2680"
FT                   /protein_id="ADL54358.1"
FT                   /translation="MNNIQIKKSAILVALVALMAFTRMHHFGSGLHLPDASLAVFLLAG
FT                   AVMASPLFFGVLLAEAALLDFTAVTQFGVSDYCMTPAYGFLIPTYAVLWFAGRYYAGMH
FT                   QNTLRSLGWFSAISLAAVNVAFVISNASFYLFSDRYVGMSAMQYASEVTQYYVPYVSGA
FT                   VIYLIPAAMLYVVFARSAATDAKHA"
FT   gene            360063..360656
FT                   /locus_tag="Galf_0314"
FT   CDS_pept        360063..360656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0314"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="TIGRFAM: cob(I)alamin adenosyltransferase; KEGG:
FT                   mmb:Mmol_0278 cob(I)alamin adenosyltransferase; PFAM:
FT                   ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54359"
FT                   /db_xref="GOA:D9SJL0"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL0"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ADL54359.1"
FT                   /translation="MPDSHHRNRMARKKAVVDAAIASADRDKGLLLVLTGNGKGKSSSA
FT                   FGMVARSLGYGHRVGVAQFLKSRRDTGEEAFFARQPGVQWHVLGDGFTWDTQDREADVA
FT                   SALRGWTVAQTLLQDASLHLVVLDELTYLLNYGYLDATQVCADLAARPAGQHVVITGRA
FT                   ASQDLIGLADTVSEINDVKHAFRAGIRAQAGIDL"
FT   gene            360698..362488
FT                   /locus_tag="Galf_0315"
FT   CDS_pept        360698..362488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0315"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="TIGRFAM: lipid A ABC exporter, fused ATPase and
FT                   inner membrane subunits MsbA; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter related; KEGG:
FT                   slt:Slit_2679 lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54360"
FT                   /db_xref="GOA:D9SJL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL1"
FT                   /inference="protein motif:TFAM:TIGR02203"
FT                   /protein_id="ADL54360.1"
FT                   /translation="MNLSTSQLYLRLLSYVKPYWRVFAASILGTAIAAATEPLLPALLK
FT                   PMLDGTFVQKDDFVIRWAPLIIILIFLVRGIAGFVATYAINWVGNKVVMDLRGEMFRKL
FT                   LTLPTAYYDNHATGNLISKLTFDVTQVTAAATSVVTVTIRDSIIIAGLMGWLLYLNWKL
FT                   TLLSLIVTPAVALVIYTINRRLRNSSRDSQRAMGNVTQVIEESVGAHKVVKLFGGQQYE
FT                   EQRFTSETNWMRRHAMKQAAAAAANVPLVQLVAAVALAVIIYLATAQAKTDATSVGGFL
FT                   SFVAAMLMLTAPIKRLTGISEHMQRGLAAAESVFELLDTASEPDAGTVAIGRARGALHI
FT                   EHLNFAYQSESTDEKSAIRQALSDICLDIPAGQTVALVGASGSGKSTLANLVPRFYLPG
FT                   SGRITLDGHNLNELTLTSLRANIALVSQEVLLFNDTLAANIAYGQTRAVSESEIVAAAT
FT                   AAHAMEFIREWPEGLNTLVGERGVKLSGGQRQRIAIARAILKDAPVLILDEATSALDSE
FT                   SERHVQAALETLMQGRTTLVIAHRLSTIEKADRIVVLHKGEIAEIGTHSELLAKNGVYA
FT                   QLHSVQFSPGAHLIPQDAQG"
FT   gene            362549..363154
FT                   /locus_tag="Galf_0316"
FT   CDS_pept        362549..363154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0316"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Peroxiredoxin-like; KEGG:
FT                   mfa:Mfla_1689 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54361"
FT                   /db_xref="GOA:D9SJL2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL2"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADL54361.1"
FT                   /translation="MAVLVGKAAPDFTAAAVMGNNEINESFNLKSHIAGKAAVIFFYPL
FT                   DFTFVCPSELIAFDHRLAEFKNRGVEVIGVSIDSQFTHLAWKNTPVNKGGIGQVGYPLV
FT                   ADIKHEICQAYDVELAGAGVALRGSFLIDKTGVVMHQVVNMLPLGRDIDEMLRMVDALQ
FT                   FFETHGEVCPAGWKKGKAGMNASTEGVAQYLADHAQSL"
FT   gene            complement(363244..363648)
FT                   /locus_tag="Galf_0317"
FT   CDS_pept        complement(363244..363648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0317"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: slt:Slit_0144 rhodanese domain protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54362"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL3"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL54362.1"
FT                   /translation="MKLTTKKISLTLATLLLVMLGAQRLQATTDVDIDVTQAHTMNRQG
FT                   ALLLDVREPSEYTEVHAPNATLIPLGQLGARLDEIASYKDKPIIVMCRSGRRSAKAVHL
FT                   LQEAGYSHVSNIAGGILAWEKSELKVVRPN"
FT   sig_peptide     complement(363565..363648)
FT                   /locus_tag="Galf_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 28"
FT   gene            363964..366453
FT                   /locus_tag="Galf_0318"
FT   CDS_pept        363964..366453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0318"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="KEGG: hor:Hore_02400 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; SirA-like
FT                   domain-containing protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; Rhodanese domain
FT                   protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54363"
FT                   /db_xref="GOA:D9SJL4"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL4"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADL54363.1"
FT                   /translation="MKVVIIGGVAGGATAAARIRRNDERAEIVMIERGPYISFANCGLP
FT                   YHISGTIEQREQLLVTSEPAFEARYRVDVRSRTEAIAIDRQAKLVRLRDLNTGDEYDES
FT                   YDKLLLSPGAEPVRPKLPGIDSPRVFGLRNIPDLDRIMGHLEQHSPRRAVVIGGGFIGI
FT                   EVAENLHEKGIFTTLVEGADQILLPLDYEMAAIVHSHMKDKNVELYLSDKVERFEDKDD
FT                   HTVVYLGSGRRLQADMVVLAIGVRPETTLARASGLELGSTGGIKVDSHLQTSDPDIYAV
FT                   GDAIEVTQFISGRQALIPLAGPANRQGRMAADNIVFGNKQQYRGTQSTSILKAFDLAAA
FT                   TTGLNEKQLIAAEIPFLSCITHSGSHASYYPGAKQISLKLLFSPEGRILGAQAVGADGA
FT                   DKRIDVISTAIHGNLNVEDLAELELAYAPPFSSAKDPVNIAGYVAINLLNKSHEMIAWR
FT                   ELHARLLAKSSELQLIDVRTAEEYEFGSIATARNFDVNQIREHLDELDRNAPVVVFCQI
FT                   GLRGYLAYRILKQHGFTQVSNLSGGYKTYSWAVDKQSNPDIFDYEDIKRRAPEVIEAER
FT                   SGSAVLVAPGGELHTLNAVGLQCPGPIMKTYKAMEALDAGELLEVTVSDPAFGRDIRAW
FT                   AKKTGNDVLSLKSDKGLIVVLLRKNKAVPVVALPAATRDKLTLVVFSDDLDKVMASMII
FT                   ANGALAMGKPVSLFFTFWGLDVLRRENAPARDKPMMDRMFSSMLPSGVDHLNSISKMDM
FT                   HGLGAKMIRKVMHDKGVETPGHLLQSLVDGGAQMIACQMSMDVMGIHQSELIDGVEIGG
FT                   VAAFLGEASESGTTLFI"
FT   gene            366577..366933
FT                   /locus_tag="Galf_0319"
FT   CDS_pept        366577..366933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_1843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54364"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL5"
FT                   /inference="similar to AA sequence:KEGG:Slit_1843"
FT                   /protein_id="ADL54364.1"
FT                   /translation="MYKKIVLSVLSVTLLASFGIAMAADIAVQEPSRIQQTTGRQLMSS
FT                   EEQNEQRSKMRNATSAEERKEIRQEHHEKMKEKAKEKGVAIPDSVPARGQGGGMGGGQG
FT                   GSMGGGQGGMRGGR"
FT   sig_peptide     366577..366648
FT                   /locus_tag="Galf_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(367092..367559)
FT                   /locus_tag="Galf_0320"
FT   CDS_pept        complement(367092..367559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_1934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54365"
FT                   /db_xref="GOA:D9SJL6"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL6"
FT                   /inference="similar to AA sequence:KEGG:Nham_1934"
FT                   /protein_id="ADL54365.1"
FT                   /translation="MKNCKLSWSLVVVLSIIVTLLGYKFTVGEVQPSDDGRQAVILTKD
FT                   ERNALLLEMRNWLQNSQAILAAASEKDFDTVIKSARASGMAAEADTPGSLFRKIPVEMK
FT                   ALGFGTRKKFDEIAADAEQFKESNRTVAKLSDAMNNCIACHATYRFVETTQ"
FT   gene            complement(367596..368018)
FT                   /locus_tag="Galf_0321"
FT   CDS_pept        complement(367596..368018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0321"
FT                   /product="cytochrome c class II"
FT                   /note="PFAM: cytochrome c class II; KEGG: tbd:Tbd_1357
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54366"
FT                   /db_xref="GOA:D9SJL7"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL7"
FT                   /inference="protein motif:PFAM:PF01322"
FT                   /protein_id="ADL54366.1"
FT                   /translation="MKKRIAFLTGTLFFTTLTAAEPLALQRVMKELGKNMQIVTDGISR
FT                   EDWVLVEHTAHQIGEHPEAPPDEKIRIISFMGSNMGKFKSFDAQTHEAAHEMAEAAQDK
FT                   NGQSVIAAFQKLQTGCLACHQTFRPAFTEHFYGKSK"
FT   sig_peptide     complement(367959..368018)
FT                   /locus_tag="Galf_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.691 at
FT                   residue 20"
FT   gene            complement(368044..368667)
FT                   /locus_tag="Galf_0322"
FT   CDS_pept        complement(368044..368667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0322"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: slt:Slit_1136
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54367"
FT                   /db_xref="GOA:D9SJL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJL8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL54367.1"
FT                   /translation="MNQEVIKRRMPSEERQSEIVRVAIHLAAEKGIDSVTTQDMADAMK
FT                   VTQGAIFKHFPTKDDIWLAVMQWIRGKLMTVVEKAASEATDPMDAIERMFFAHITFIGK
FT                   HPSIPRLLFSEMLHKRNSKLRDLIQEIISGYEGKIAGLLEMAKDQALVARELDSKNAAV
FT                   LYIGMIQGLFMQVSIFGGKRTLLEEAKKTFPIYLHGIKKRSDDL"
FT   gene            complement(368691..369860)
FT                   /locus_tag="Galf_0323"
FT   CDS_pept        complement(368691..369860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0323"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ppd:Ppro_0140 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54368"
FT                   /db_xref="GOA:D9SCP4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCP4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADL54368.1"
FT                   /translation="MNRGKTVFAQLLDFVPFNHFEYLTERFAANHGIKHFSAWSQFICM
FT                   AYAQLTRRDGLRDLVACLNSQKSKLYHIGIRSKVSRSTLADANERRDWRLFEALGHRLI
FT                   SIALELYRDEDIGLGLKEPLYAMDSTTIDLCLTLFPWAEFRSTKAAVKAHTIIDLRGSI
FT                   PVFLSITTGKVHDVNLLDVIPFPAGTIVVIDRGYLHFARLYALHQRQVTFVIRAKNNLR
FT                   FTWIASREVDKATGLRCDQTILLATPKSKTAYPERLRRVSFRDPETGKHLVFLTNRFDL
FT                   PALTIANIYKNRWQIELFFKWLKQNLAIKHFYGNSLNAVKSQIWIAICVYLLVSIAKKQ
FT                   LNLPASQQILLNLFEVNMFDKTPINQMVANAIQNLDEPDISKQLNLFDF"
FT   gene            complement(370044..370157)
FT                   /pseudo
FT                   /locus_tag="Galf_0324"
FT   gene            370644..371090
FT                   /locus_tag="Galf_0325"
FT   CDS_pept        370644..371090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0325"
FT                   /product="MraZ protein"
FT                   /note="KEGG: slt:Slit_2728 MraZ protein; TIGRFAM: MraZ
FT                   protein; PFAM: MraZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54369"
FT                   /db_xref="GOA:D9SJM0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM0"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ADL54369.1"
FT                   /translation="MFQGAAQLNLDGKGRLAIPARYRDRLLSNCAGNLVLTADADGCLL
FT                   VYPEPEWVTIRDKLNKLPSFNPRARALQRLIVGHAEDVQMDNAGRVLVSPVLRSYAGLD
FT                   KSVMLIGQGNKFELWDEVKWQAQQQAALLLMSGDLPAELEGFSL"
FT   gene            371087..372022
FT                   /locus_tag="Galf_0326"
FT   CDS_pept        371087..372022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0326"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="KEGG: slt:Slit_2727 S-adenosyl-methyltransferase
FT                   MraW; TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54370"
FT                   /db_xref="GOA:D9SJM2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM2"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ADL54370.1"
FT                   /translation="MSEVLVHTTVLLAEAVEALAIKPDGIYLDCTFGRGGHSALILQQL
FT                   GANGRLIALDKDMTAVSHGLEWQDARFKMVHSGFTHLAEVLRELGVERVDGILLDLGVS
FT                   SPQLDEAARGFSFRFDAPLDMRMDNSRGPTAAQWLETADEGLLTEVIRDYGEERFAKQI
FT                   ARAIIVAREIQPIQTTGQLVELVGKTVRTRETGKNPATRTFQAIRIYLNQELEELKQVL
FT                   PQCVTHLKPGGRLAVISFHSLEDRMVKHFIRDMNDADKLPRNVPIRASEVPKGKLNLIG
FT                   RAIKAGKDELNSNPRARSAVMRVAERSDVA"
FT   gene            372012..372323
FT                   /locus_tag="Galf_0327"
FT   CDS_pept        372012..372323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0327"
FT                   /product="cell division protein FtsL"
FT                   /note="KEGG: slt:Slit_2726 cell division protein FtsL;
FT                   TIGRFAM: cell division protein FtsL; PFAM: cell division
FT                   protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54371"
FT                   /db_xref="GOA:D9SJM1"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM1"
FT                   /inference="protein motif:TFAM:TIGR02209"
FT                   /protein_id="ADL54371.1"
FT                   /translation="MWRNGFLQGLLLVLVITGALSVVTSQHQARKLFIALQQEKEHAHQ
FT                   MEIEWGQLQLEQSTLAASARVERVATKQLQMQLPKKEQIKLIRVGQSSPLDNGTSHKP"
FT   sig_peptide     372012..372077
FT                   /locus_tag="Galf_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.305 at
FT                   residue 22"
FT   gene            372320..374074
FT                   /locus_tag="Galf_0328"
FT   CDS_pept        372320..374074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0328"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: slt:Slit_2725 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; Penicillin-binding protein dimerisation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54372"
FT                   /db_xref="GOA:D9SJM3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM3"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADL54372.1"
FT                   /translation="MKYTAKSNDSITAKLPGWRAIVLFALLLLCLAGLVGRAIYLQGIR
FT                   DDFLQEKGNQRYSRIIEVSAHRGMITDRNGEPLAVSTPVESVWASPSDIKIDDANETKI
FT                   SPQQLKQLAQALGMRVTDVHDHLSDVKRDFVFLKRQLPPEQSGSVAKLNLPGISLQHEY
FT                   RRYYPAGEEFAQMLGFTGQDDNGQEGLELVLQNQLAGKLGSQRVIKDRRGHIVEDAGSL
FT                   TPPKPGGDIALSLDSKIQHLAYRELKLAVAQHQAKAGAIVVLDANSGEVLALANYPSYN
FT                   PNNRTRVSTQAMRNRAVADVFEPGSTMKPFTIATALNIGKVRPDTMINTENGVFTVGNK
FT                   KIHDTHAEPMLSVSQVIQKSSNVGAAKIALSMEPDTMWQTFYDAGFGHHTGSNFPGEAI
FT                   GMLRDAKSWKPIEQATMSYGHGISVNLLQLARAYTVFAGDGEIKPVSMLKLDQPAAGKP
FT                   VFSSKTAAQLRMMMESVVMPGGTAPLAQVAGYRVAGKTGTAHKLDGRHYSNRYVASFVG
FT                   LAPVSAPRLIVAVMIDEPSAGQYYGGLVAAPVFSQVVAGALHLLNVPNDAPLDNVIAAP
FT                   AEIVREEI"
FT   gene            374071..375582
FT                   /locus_tag="Galf_0329"
FT   CDS_pept        374071..375582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0329"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="KEGG: slt:Slit_2724 UDP-N-acetylmuramyl-tripeptide
FT                   synthetase; TIGRFAM: UDP-N-acetylmuramyl-tripeptide
FT                   synthetase; PFAM: Mur ligase middle domain protein;
FT                   cytoplasmic peptidoglycan synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54373"
FT                   /db_xref="GOA:D9SJM4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM4"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ADL54373.1"
FT                   /translation="MTPTLSQLQLQLGVPLNHLVTDSRTLKSGDVFMAYPGEKTDGRQF
FT                   IAQAILQGAAAVIWDAHNFVWDKAWTVPNIGISDLRHNAGFLADAIYGEPSKSLRMIGV
FT                   TGTNGKTSTCHWIAQALGDAGKKCALIGTLGNGFVNELEASANTTPDAIRVQGLLADFL
FT                   NSGAQAAAMEVSSHALAQGRVNGVRFDVALLTNLSRDHLDYHGDMESYAATKRRLFDWQ
FT                   SLNYAVINLDDAFGAELALQLVDKTVEVIGYGTTDEALRLAERHGLRMVYGVVLEMDSH
FT                   GMKVEVRSSWGAAQLSTQMVGRFNVSNLLGALGVLLVSDVTLDAAVASLNAVQPVTGRM
FT                   QKLGGNDQPLVIVDYAHTPDALEKVLLALCEAAQGTKAGGQLICVFGCGGDRDRGKRAM
FT                   MGRVAEKFADRCIVTSDNPRSEDAQQIIGEVIAGMNEGRHEVISDRADAIGHAIAMAGR
FT                   ADIVLIAGKGHEDYQEIKGVKHPFSDVNVATQALKTWMSQPGVTQ"
FT   gene            375579..377030
FT                   /locus_tag="Galf_0330"
FT   CDS_pept        375579..377030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0330"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="KEGG: slt:Slit_2723
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D -alanyl ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54374"
FT                   /db_xref="GOA:D9SJM5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM5"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADL54374.1"
FT                   /translation="MMLLAQAAKVLHGHIKGPTDARFMAVSTDTRKIKAGDLYIALRGE
FT                   KFDGADFAAQAIESGATAVLMNADSFEARSLILNPQSSILLVADTRIALGQLAAHWRQK
FT                   FNIPMVAITGSNGKTTVKEMLASVLRSAAGSDDAVLATKGNFNNDIGMPLTLLQLNAQH
FT                   RYAVIEMGMNHPGEIDYLTRIACPNVALINNASGAHLEGMGSVEAVAHAKGEIFSGLQP
FT                   GGSAIINADDEFAPLWRCLAGANSLLEFGLSGHSDVVGAWQPNGAGLRLDVKTPVGDFT
FT                   VEMQVPGEHNARNALAVTAAAIALNLSLESIVAGLSKFSGVAGRLQRKPAREGAVLIDD
FT                   TYNANPASLKAAIAVLAAMSGQRVLVLGDMGELGEDTAAFHAGIGINVRESGIENLYAL
FT                   GELSREAVREFGVGALHFEHIDALLAELDKELKVGTTVLVKGSRFMKMERVVKHLEIGS
FT                   GKWEVVSGVGCIHSPLTTPDSPEIL"
FT   gene            377030..378115
FT                   /locus_tag="Galf_0331"
FT   CDS_pept        377030..378115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0331"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /note="KEGG: nmu:Nmul_A2497
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54375"
FT                   /db_xref="GOA:D9SJM6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM6"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ADL54375.1"
FT                   /translation="MLLALTQWLAQDIRFFSVFNYITLRTVMAAMTALGISFMVGPAMI
FT                   RKLTAYKIGQSVRSDGPQTHLVKAGTPTMGGALILTSIGITTLLWGDLHNHYVWVVLLT
FT                   TLGFGVIGWIDDYRKVVHRNPKGLSAKAKMTWQSLIALVVAVYLWKTSTLPAQTELIVP
FT                   FMKFFVFPLSAATFIAVVYFVIVGTSNAVNLTDGLDGLAIMPTVMVASALALFSYVAGN
FT                   AVFAKYLGIPYIPGAGELAVFCGGIAGAGLAFLWFNAYPAEVFMGDVGALALGAALGVV
FT                   AVIVRQELVLFIMGGVFVVETLSVVIQVASFKLTGRRVFRMAPLHHHYELKGWKETQVV
FT                   VRFWIITMLLVLLGLATLKLR"
FT   gene            378112..379503
FT                   /locus_tag="Galf_0332"
FT   CDS_pept        378112..379503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0332"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="KEGG: slt:Slit_2721
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54376"
FT                   /db_xref="GOA:D9SJM7"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM7"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ADL54376.1"
FT                   /translation="MKTLSDKSVLILGLGETGLSMVRWLSAQGARLRVADSRTTPPGLD
FT                   QVAQFVPADQLFFGAFTDTLFDGIELIAISPGVPLADPYIARAAARGIPVVGDIELFAQ
FT                   QLRASHAPLPGKVLAITGSNGKTTVTSLVEHLCRAAGLDAVAAGNISPAVLDVVLQRGD
FT                   KQPEVWVLELSSFQLETTRSLTADAATVLNVSEDHLDRYLGMDEYAAAKQQILGGCRLQ
FT                   VLNRDDARSIAMKHTTSDCVSFGLNKPASESDFGIEREGDDIWLVQGCSRLIKASEMQL
FT                   AGLHNVANALAALALCRAIDLPMPVLLAALRSFKGLPHRVEKVAVLHGVTFYDDSKGTN
FT                   VGATVAALAGLGCPAVLIAGGVGKEQDFSPLKSAVTHHARAVVLIGRDAPLIAAALAGG
FT                   DVPLIHAADMQDAVQLAAKIAQYGDAVLLSPACASFDMYRNYGHRAQVFIAEVNHLNEE
FT                   GAWPH"
FT   gene            379491..380654
FT                   /locus_tag="Galf_0333"
FT   CDS_pept        379491..380654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0333"
FT                   /product="cell division protein FtsW"
FT                   /note="KEGG: slt:Slit_2720 cell division protein FtsW;
FT                   TIGRFAM: cell division protein FtsW; PFAM: cell cycle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54377"
FT                   /db_xref="GOA:D9SJM8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM8"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ADL54377.1"
FT                   /translation="MASLVKTHTRPPQVQFDMLLIWVFIALLSVGLVMVYSSSIATAEG
FT                   SKFTGHQASYYLMRHSMFIAVGLVAGALAFQVPVQTWQNYSPYLFVAGATLLVLVLIPH
FT                   VGREVNGSRRWLSLFVINLQPSELMKLFAVMYAADYTVRKGRESNSIIKTFLPMFGVMA
FT                   VVGGLLLLEPDMGAFVVVLAISICTLWLGGFNLKVFGLLVFMLPMAFAALILSSPYRLQ
FT                   RVIGFMDPWADPYGKGYQLSHALIAFGRGERFGVGLGGSVEKLFYLPEAHTDFLMAVIA
FT                   EELGLVGVVCVIGLFALVVIRAFQIGRHAAFLERNYSALVAQGIGVWVGVQATINIGVN
FT                   MGVLPTKGLTLPFLSFGGSGVVVNCIAAAVLLRVDYENRRLARGMPA"
FT   gene            380651..380752
FT                   /locus_tag="Galf_0334"
FT   CDS_pept        380651..380752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54378"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54378.1"
FT                   /translation="MSIKNRKSSISVQTKIELGYLHKNRRIARGMPA"
FT   gene            380749..381810
FT                   /locus_tag="Galf_0335"
FT   CDS_pept        380749..381810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0335"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="KEGG: slt:Slit_2719
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: Glycosyltransferase 28 domain; glycosyl
FT                   transferase family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54379"
FT                   /db_xref="GOA:D9SJN0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN0"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ADL54379.1"
FT                   /translation="MNRSILIMAGGTGGHIFPALAVADQLREQGWQVTWLGAPNSMEAD
FT                   LVPKHGYPMSLVRFSGLRGNGWVRKVMLPLNLIIALWQSAVAIFRHRPDVVLGMGGYIT
FT                   FPGGLMAAILHRPLVIHEQNSVAGLSNKVLARLATRVMTGFPAVLPKAQWCGNPVRSVI
FT                   ADIPAPADRYAARTGRLNVLVVGGSLGARALNEVMPKVLALLPTEDRPIVVHQTGKQHH
FT                   STVTQLYKEADVEADVLPFIGDMAAAYAAADLVICRSGALTVAELAAAGVASILVPFPF
FT                   AVDDHQTHNARFLSEQGAAILLPQTELSAAGLAKQLMELSREKLLTMAQQARSLAKTDA
FT                   AGDVANICKELAQ"
FT   sig_peptide     380749..380814
FT                   /locus_tag="Galf_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.712 at
FT                   residue 22"
FT   gene            381807..383207
FT                   /locus_tag="Galf_0336"
FT   CDS_pept        381807..383207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0336"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: slt:Slit_2718 UDP-N-acetylmuramate/alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54380"
FT                   /db_xref="GOA:D9SJN1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN1"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADL54380.1"
FT                   /translation="MRHKIKQIHFVGIGGSGMNGIAEVLFNLGFSVSGSDLAENAATAR
FT                   LRELGVSVAIGHSEVNLTRADVVVVSTAVSQDNPEVVAARARHIPVVPRAMMLAELMRL
FT                   RQGIAVAGTHGKTTTTSLTASVLARGGFDPTFVIGGKLNSSGTNAKLGTGEFIVVEADE
FT                   SDASFLYLQPILAVVTNIDEDHMETYGHDFAKLKQAFIDFIEHLPFYGRAMVCVDDANI
FT                   REILPRVTKPVTTYGFSEDAQIRAINVRHEGGKMCFTAQCRQNGTPRDLVITLNLPGRH
FT                   NVLNALAAIAIALEIGVADDAIIAALDEFEGVGRRFQRYGEIALPEGGRFTLIDDYGHH
FT                   PVEMAATLAAVRGAFPGRRLVLAFQPHRYTRTRDLFEDFVKILCGVDALLLAEVYAAGE
FT                   TRLVAADGRAMMHALRLAGQSEAIFVEHIADMPQSIMQWARDGDVVVTMGAGSIGNVPG
FT                   AVKQMANT"
FT   gene            383204..385099
FT                   /locus_tag="Galf_0337"
FT   CDS_pept        383204..385099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0337"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; KEGG:
FT                   mfa:Mfla_2266 D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain-containing protein; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54381"
FT                   /db_xref="GOA:D9SJN2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN2"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADL54381.1"
FT                   /translation="MNMSEPGQFIAAVLRGKLSLDQSMRRHTSWRVGGAADRVYQPADL
FT                   DDLRVYLCSLPLDEPLVAVGLGSNLLVRDGGVRGTVLLMHGALTELAMQQDGLIYVQAG
FT                   VPGAKLARFAANHDLAGAEFCAGIPGTLGGMLAMNAGCYGSEIWQHVVRVQVVTRSGEL
FT                   IERASSEYQIAYRSVTKKQDGASDEFFVGAWLSFVQGDGQVARQNIKELLAKRISSQPL
FT                   NLPNAGSVFRNPANDYAARLIEQCGLKGKKIGGAQVSEKHANFIVNVDNATADEIENLI
FT                   CQVRQTVMTQTGVDLHPEVKIIGEASVKMANSKTDFKTLNPEFSTLNPAAYGKVAVLFG
FT                   GRSAEREVSLKSGAAVLASLLRSGVDAHAFDPASRSLQELQEQGFDRVFIALHGRFGED
FT                   GTVQGALELLGIPYTGSGVMASSLGMDKWRSKLVWQAGGLPVPDFMMLAEQSEPLDVIG
FT                   KLGLPLFVKPANEGSSVGISKVKAVGELQAAYREAARHDPLVIAERFIGGGEYTVAILG
FT                   DQVLPVIKIEPANEFYDFEAKYLRDDTCYRCPSGLDAASEAKMQGLAQAAFALIGGQGW
FT                   GRVDFLMSEAGQPYVLEANTSPGMTDHSLVPMAARQAGISFDELVLRVLGMAHVG"
FT   gene            385089..385805
FT                   /locus_tag="Galf_0338"
FT   CDS_pept        385089..385805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0338"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: slt:Slit_2715 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54382"
FT                   /db_xref="GOA:D9SJN3"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN3"
FT                   /inference="protein motif:PFAM:PF03799"
FT                   /protein_id="ADL54382.1"
FT                   /translation="MWDNAPLLRGMASVLFFCSIVVMLYGAVHYVVHMPKLLPIKSVRL
FT                   ASAPERVMSDEVKAVVRQVVQGNFLTVDIDTLRRSLEKLSWVRNVSVRREFPNGLVVQF
FT                   EEHQALAHWNDVALVNRQGEVFTAETTQSLPRFTGYEGTSAEVTQQYAKFGAQLAALNL
FT                   QVEQLALSPRHAWQLRLSNDMVVELGREALSQRLARFIAVYPYGLAPQGDAEREIQVVD
FT                   MRYRNGYAVRRRQGNA"
FT   gene            385844..387067
FT                   /locus_tag="Galf_0339"
FT   CDS_pept        385844..387067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0339"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: slt:Slit_2714 cell division
FT                   protein FtsA; SMART: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54383"
FT                   /db_xref="GOA:D9SJN4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN4"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ADL54383.1"
FT                   /translation="MSRNKEAKNLVVGLDIGTSKIVAIVGEVKPDGALEVIGMGMHESS
FT                   GLKKGMVVNIEATVGAIQRALEEAELMADCKITEVHTGIAGSHIRSVNSSGMVKIKEKE
FT                   VTQADVDRVLETASSISMPADQQKLHVLEQAFSIDGQDGIKKPLGMSGMRLDVEVHIVT
FT                   GAVAAVQNIMKCIHRCGLEVNELILQPLASSRAVLADDEMDLGVCLVDIGGGTTDIAVF
FT                   TGGSIRHTAVIPIAGDQITNDIAMALRTPTQDAEDIKIRHGCALRQLADDGTIEVPGVG
FT                   DRGPRMLSRQTLAEVIEPRVEELYSLVQAELRRSGFDDLLSSGIVITGGSSAMQGMVEL
FT                   GEEIFHLPVRLGIPKYVGGLLDVVKTPRMATGVGLLLYGLEYHKNNEATRMQGNSFGDV
FT                   LAKMKSWF"
FT   gene            387142..388296
FT                   /locus_tag="Galf_0340"
FT   CDS_pept        387142..388296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0340"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; KEGG: slt:Slit_2713 cell division
FT                   protein FtsZ; SMART: Tubulin/FtsZ, 2-layer sandwich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54384"
FT                   /db_xref="GOA:D9SJN5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN5"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ADL54384.1"
FT                   /translation="MFEIMEAESQDAVIKVIGVGGCGGNAVDHMIEQGVQGVEFIAINT
FT                   DAQALNRSRAPTQLQIGAAITKGLGAGAKPSVGKAAAEEDRERIKSMISGANMVFITAG
FT                   MGGGTGTGAAPIVAQIAREMNILTVAVVTKPFAYEGNRMRFAADGIKALQEHVDSLIIV
FT                   PNSKLMEVLGNDVTVPEAFKAANGVLQGAVAGIAEVINAPGLINVDFADVCTVMSENGM
FT                   AMMGSAVASGPDRARIAAERAIASPLLEDMDLTGARGVLVNITSTSSLKLREMDEVMAC
FT                   VQFAAEEATVILGSVFDESMGDDLRVTVVATGLGGRKSKPELVYVEQESKRTGTHDMPI
FT                   SNVNYAELETPTAFRSGRRAAVEAMEKNGVETYDIPSFLRKQAD"
FT   gene            388408..389337
FT                   /locus_tag="Galf_0341"
FT   CDS_pept        388408..389337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0341"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="KEGG: slt:Slit_2712 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; TIGRFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54385"
FT                   /db_xref="GOA:D9SJN6"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN6"
FT                   /inference="protein motif:TFAM:TIGR00325"
FT                   /protein_id="ADL54385.1"
FT                   /translation="MKFALNKPMVKQRTLKTSVSVTGVGLHSGEKVTLSLRPGQVDGGI
FT                   VFRRVDVKPVQDIQARPHLVHDTRLSTCMEQNGVRVATIEHLMSALAGLGVDNAIVEMD
FT                   GAEVPIMDGSAGTFIFLLQSAGIVEQSAAKKFIRIKKPVEVVQGDKWVRFEPYNGYKLT
FT                   FTINFAHPVFASSKQHVTVDLNEHSYIRDISRARTFGFMQDVENMRAQGLALGGSLDNA
FT                   IVMDEYRVLNPDGLRFEDEFVKHKVLDAIGDLYLLGHAVIGAFSGFKSGHALNNALLRA
FT                   LLADEMAWEFVTFNDVDDAPDFLRLQVA"
FT   gene            389365..389565
FT                   /locus_tag="Galf_0342"
FT   CDS_pept        389365..389565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54386"
FT                   /db_xref="GOA:D9SJN7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN7"
FT                   /inference="similar to AA sequence:KEGG:Slit_2711"
FT                   /protein_id="ADL54386.1"
FT                   /translation="MLIMRLYLVLVVLLLVLSGGLYVFTRNRRYLKFAWQTVRFTVLLV
FT                   LVFGLLFVLERYVLVAWKVFL"
FT   sig_peptide     389365..389436
FT                   /locus_tag="Galf_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.797 at
FT                   residue 24"
FT   gene            complement(389593..390009)
FT                   /locus_tag="Galf_0343"
FT   CDS_pept        complement(389593..390009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0343"
FT                   /product="protein of unknown function DUF721"
FT                   /note="KEGG: slt:Slit_2710 protein of unknown function
FT                   DUF721; manually curated; PFAM: protein of unknown function
FT                   DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54387"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN8"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADL54387.1"
FT                   /translation="MTQRLKSLMNSSSQLRELLNAVQSLTELQHHFNQVAPAYLSAHCQ
FT                   VLGLRQGTLSIAASNGTLAAKLRQLAPELVTKLQDKGCEVSGIRVKVQVSYAVVKTRPA
FT                   PRLLSNTAKNQLHALSDNLPESPLKFALEKFSKS"
FT   gene            390038..390910
FT                   /locus_tag="Galf_0344"
FT   CDS_pept        390038..390910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0344"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: slt:Slit_2709 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54388"
FT                   /db_xref="GOA:D9SJN9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJN9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADL54388.1"
FT                   /translation="MNIILVSNRCTQSRSIYLTGWHVFLCIVLLVALTAAAVLGMMRFA
FT                   PAGLDKVGIRPNQLVYQRSNLSALALKLGEMQARVQRLDALGGRLVKLTGMKPEEFQFD
FT                   QPPAQGGPLVTAGPLSLATLAQQLETLAHVVDDRSDKLMALQTLLMQNQLSRGLLPSIV
FT                   PIENGVYTSNFGWRVDPFSGSSAMHEGVDFMAEPGTPIFASAGGVVVYADTHAQYGNMV
FT                   EIDHGNDIVTRYAHASKLLVKAGQVVRRGDKVAEVGSTGRSTGNHLHFEVRYKGSAQNP
FT                   VRFLQNAAG"
FT   gene            390988..393711
FT                   /locus_tag="Galf_0345"
FT   CDS_pept        390988..393711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0345"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: slt:Slit_2708 preprotein translocase, SecA
FT                   subunit; TIGRFAM: preprotein translocase, SecA subunit;
FT                   PFAM: SecA DEAD domain protein; SecA Wing and Scaffold;
FT                   SEC-C motif domain protein; SecA preprotein cross-linking
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54389"
FT                   /db_xref="GOA:D9SJP0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP0"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADL54389.1"
FT                   /translation="MISKALKSIFGSRNDRLLKQYRSTVKEINKLEATMATLSDEALRE
FT                   KTISFRQRFEQGETLEAMLPEAFAVVREAGTRALGMRHYDVQMIGGMVLHYGKIAEMRT
FT                   GEGKTLMATLPVYLNAISGRGVHVVTVNDYLASRDAAWMGRLYRFLGLSVGVIVSQMPS
FT                   DEKQAAYAADITYGTNNEFGFDYLRDNMASQMGERFQRKLNYAIVDEVDSILIDEARTP
FT                   LIISGQAEGDVNVYMQINELVQKLVRQIEEEGPGDYSVDEKNHQILLSEIGHEHAENIL
FT                   TEAGLLPENGSLYDAANISLIHHLYAALRAHALYHKDQNYVVQDGEVVIVDEHTGRLMS
FT                   GRRWSDGLHQAVEAKEGVEIKKENQTLASITFQNYFRMYNKLGGMTGTADTEAYEFQQI
FT                   YNLETVIIPPNRPTVRRDMMDKVYLTAMEKYRAVIVDIKDCYERGQPVLVGTTSIENSE
FT                   LLSHLLEKENLPHQVLNAKQHAREAEIVAQAGQPKMVTIATNMAGRGTDIVLGGSIERQ
FT                   IEAVQGDETLDEAAKIAQIEQLKSTWTIVHEQVIKCGGLHIIGTERHESRRVDNQLRGR
FT                   SGRQGDPGSSRFYLSLEDPLLRIFASDRVAAIMNKFKLPEGEAIEHVWVTRAIENAQRK
FT                   VEARNFDMRKQILEYDDVANDQRKVIYQQRTELLESDDITETVQGMRDSVLDDTISQYI
FT                   VPHSMEEQWDVPGLEKALAVEFHLELPLAQWLEEDNSFNEAGLRNRVLEEAMQRYRAKV
FT                   ELVGADGMHHYERAIMLQSVDVHWREHLAALDQLRQGIHLRGYAQKNPKQEYKREAFEL
FT                   FSSMLDVIKREVTQVLMTVQVRSEAEIEAVEATTAVENVQYHHADYEEALAQDATSVST
FT                   DEAVQTFVRDGRKIGRNDPCPCGSGKKYKQCHGQLN"
FT   gene            393724..394209
FT                   /locus_tag="Galf_0346"
FT   CDS_pept        393724..394209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0346"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: slt:Slit_2707 putative transcriptional
FT                   regulator, Crp/Fnr family; PFAM: cyclic nucleotide-binding;
FT                   SMART: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54390"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP1"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADL54390.1"
FT                   /translation="MSLVIDTLRTSPVTEELSQAEVEILAGLFEVQEFKAGDIIVQPND
FT                   VQPDNLYILASGEVDVKIESGGDESTVHVLKPGDLAGMITFAGGAATHISATLYAVGPT
FT                   KVLSMARARFETLINTHPMLVYRVMRGIIRNMHGIVRRVNIESAELSNYIYKTGGRY"
FT   gene            394226..395455
FT                   /locus_tag="Galf_0347"
FT   CDS_pept        394226..395455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0347"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; KEGG: slt:Slit_2706 arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54391"
FT                   /db_xref="GOA:D9SJP2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP2"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADL54391.1"
FT                   /translation="MPVNLNPPVAKQLLPVAGVTLGIAEANIKRENRKDLLVMQLCEGA
FT                   KVAGVFTQNRFCAAPVIVAREHLAADEGIRALVVNTGNANAGTGEQGLLDARMTCAALA
FT                   GLLGCKSNQILPFSTGVIMEPLPVAKIAAGLPAAVANMTGDNWFDAAHAIMTTDIVAKA
FT                   ISKQVVVEGVTVTITGIAKGSGMIHPNMATMLGYIATDVTISQALLQQLVTTAANRSFN
FT                   CITVDGDTSTNDALMLIATGQAAHNEVTSQDSAVYGVLLDAISEVAIYLAQAIVRDGEG
FT                   ATKFITVKIEGGRDEEECKKIGYAIAHSPLVKTAFFASDPNLGRILAAIGYAGVEDLDV
FT                   SALQLYLDDVLVAENGGRAASYQEADGQRVMAQSDITIRVVLNRSDVNATLWTCDFSYD
FT                   YVKINASYRS"
FT   gene            395459..396316
FT                   /locus_tag="Galf_0348"
FT   CDS_pept        395459..396316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0348"
FT                   /product="protein of unknown function DUF815"
FT                   /note="KEGG: slt:Slit_2705 protein of unknown function
FT                   DUF815; PFAM: protein of unknown function DUF815; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54392"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP3"
FT                   /inference="protein motif:PFAM:PF05673"
FT                   /protein_id="ADL54392.1"
FT                   /translation="MSALNQFLARAEGLLARLEGIVPGAAVQAPDWAIAAAFRWDHRQR
FT                   ILSPVANFQRIRLADLLGIDDQKQRIQQNTRQFVAGGTANNVLLSGARGTGKSSLVKAL
FT                   LNEYADAGLRVIQIDKQGLTDLPVIVGLVEGRAERFILYCDDLSFNADEEGYQTLKAAL
FT                   DGDLVAFSDNLLIYATSNRRHLMPDYMSDNLATRYDGDEIHPAESVEEKVSLSERFGLW
FT                   ISFYPFSQDEYLAICERWLQYHGRRGGMTDEVRRAALQWSLSRGSRSGRVAGQFAKDWC
FT                   GRQA"
FT   gene            complement(396328..397884)
FT                   /locus_tag="Galf_0349"
FT   CDS_pept        complement(396328..397884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0349"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /EC_number="2.3.1.182"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; KEGG: app:CAP2UW1_1241
FT                   2-isopropylmalate synthase/homocitrate synthase family
FT                   protein; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54393"
FT                   /db_xref="GOA:D9SJP4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP4"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ADL54393.1"
FT                   /translation="MSQVFLYDTTLRDGTQREDISLSVDDKLIIAKRLGDFGFHYIEGG
FT                   WPGSNPKDAEFFARAAKLELGGAKLAAFGRTRQKNKSCEEDSNLEALLAAKTPVVTMVG
FT                   KSSDYHVKLVLAASLEENLAMIRDSVAYMKQNGREVMFDAEHFFDGFLANKDYALASLR
FT                   AATEAGADWLVLCETNGGKLPWEVEEIVREVRQHIPTPLGVHCHNDTGCGVANSLAAVR
FT                   GGCTQVQGTINGYGERVGNANLTTIIPNLQLKMDRKVVKAEQLRELTSLAQYVAEVVNL
FT                   KHYNHAPYIGRSAFAHKGGIHVAAMLKAADTYQHIDPQLVGNETRSVVSELSGRGNIQF
FT                   HAKSLGIDLNNDDAQRVLGHIKHLEHEGFTFEAAEASVELMLHRLRSDYVQPFELIDYF
FT                   VITEKRQSRGLLSEATVKVKVNGETKFVAAEGNGPVNALSTALRSALAGVYPVLTTVRL
FT                   IDYKVRILDSANGTSAQIRVLITFQGGGHVWTTVGASANIIEASWRALSDSLEYALVKL
FT                   N"
FT   gene            complement(397925..398347)
FT                   /locus_tag="Galf_0350"
FT   CDS_pept        complement(397925..398347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0350"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: slt:Slit_2473 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54394"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP5"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADL54394.1"
FT                   /translation="MKARVKWVENVAFLGETESNHAVLMDGAPAAGGRNLGPRPMEMLL
FT                   LGAGGCTSFDVMSILKKSRQAVTDCYVELDAERAETDPKVFTKIHMHFVVKGRNIKPEV
FT                   VEKAIKLSAEKYCSASIMLGATALVTHDFEVIQEQD"
FT   gene            complement(398364..399128)
FT                   /locus_tag="Galf_0351"
FT   CDS_pept        complement(398364..399128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0351"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   slt:Slit_2472 protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54395"
FT                   /db_xref="GOA:D9SJP6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP6"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADL54395.1"
FT                   /translation="MSWFITNLTSAFLLPPLSLLLLLLAGIYLFYRQPKFARALCTSAL
FT                   VLLWIASTPYFAEGALHLLENQTHALTADSPKASAIVILGGGTYFHAPEYDNQDTVSEA
FT                   TLLRLRYGARLQRELNAPILVTGGKPLGNGTSEAHQMRTVLEEDFRIPARWTEDASDNT
FT                   FENARYSYQTLQKAGIRDIYLVTHAWHMLRSAAAFRAAGFVVIEAPTCFTTRYQTNLLA
FT                   FIPRAEALRDSKIFVHEVIGLLWYQAKLRIHG"
FT   sig_peptide     complement(398955..399128)
FT                   /locus_tag="Galf_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.407 at
FT                   residue 58"
FT   gene            399333..399770
FT                   /locus_tag="Galf_0352"
FT   CDS_pept        399333..399770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0352"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: slt:Slit_2457 ribosomal protein L13; TIGRFAM:
FT                   ribosomal protein L13; PFAM: ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54396"
FT                   /db_xref="GOA:D9SJP7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP7"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADL54396.1"
FT                   /translation="MKTFSAKAHEVQHEWLLVDAADQVLGRLAAQIASRLRGKHKAIYT
FT                   PHVDTGDFVVVINADKLRVTGNKAEAKLYHRHTGYPGGLYTTNFTKMQGRHPARVLEKA
FT                   VKGMLPKGPLGYAMLRKMKVYAGPAHPHEAQQPTLINLLKA"
FT   gene            399773..400165
FT                   /locus_tag="Galf_0353"
FT   CDS_pept        399773..400165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0353"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: slt:Slit_2456
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54397"
FT                   /db_xref="GOA:D9SJP8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP8"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADL54397.1"
FT                   /translation="MTVSYNYGTGRRKSAVARVFIKAGKGDIIVNDKPVDVYFSRETGR
FT                   MIVRQPLGLTDTLGQFDIMVNVSGGGENGQAGAVRHGITRALIDYNADFKPVLKAAGLV
FT                   TRDAREVERKKVGLRKARRRKQFSKR"
FT   gene            400248..401276
FT                   /locus_tag="Galf_0354"
FT   CDS_pept        400248..401276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0354"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="SMART: Semialdehyde dehydrogenase NAD - binding;
FT                   TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase; KEGG:
FT                   slt:Slit_2455 N-acetyl-gamma-glutamyl-phosphate reductase;
FT                   PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54398"
FT                   /db_xref="GOA:D9SJP9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJP9"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADL54398.1"
FT                   /translation="MIKVGIVGGTGYTGVELLRLLVLHPEVTLQVITSRADAGTRVDQM
FT                   FPSLRGLVDLLFVHPDEAHLEQCDAVFFATPNGIAMQQTRALLEAGVRVIDLAADFRLQ
FT                   DIASWEAWYGMTHACPDLVAEAVYGLPEVNREQIKTARLIANPGCYPTAVQLGFFPLLE
FT                   AGVIEAGSLIADAKSGVSGAGRKAEIPALFAEAGDNFKAYGVAGHRHLPEIKQGLARVS
FT                   GNGVGLTFVPHLTPLIRGIHATLYGKLTRDVDLQALFEARYADEPFVDVMPAGSHPETR
FT                   SVRGSNRCRIAVHRPQGGDTVVVLSVIDNLVKGAAGQAVQNLNIMFDFPEAMALNIVPL
FT                   LP"
FT   gene            401331..402032
FT                   /locus_tag="Galf_0355"
FT   CDS_pept        401331..402032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54399"
FT                   /db_xref="GOA:D9SJQ0"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ0"
FT                   /inference="similar to AA sequence:KEGG:Slit_2454"
FT                   /protein_id="ADL54399.1"
FT                   /translation="MRPLSVRPHIAWYYRWSMVLPFVLAAAGLVWYAYISGLELAGFRS
FT                   GESERAMTGLQEKLAKVTLENSQLGSQVAQFQQQLQVEQGRSGETARQLQNLTAENARL
FT                   QDDLNFFQNLTAASGKEGEFAIHRLTLERDKIPGEYRVRMLLVQSGQHGKEFSGGYQLV
FT                   GTVVQNGREVTQLFPSAESGLAQFSLKFKYYQRLEQTLRLPADVQLKSVQVRLFEQGMR
FT                   EPKIRQSVNLL"
FT   gene            402047..402451
FT                   /locus_tag="Galf_0356"
FT   CDS_pept        402047..402451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0356"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   slt:Slit_2453 protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54400"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ1"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ADL54400.1"
FT                   /translation="MFNKKHSKPQSRIDTLIGLGTVIDGNVTFSGGMRIDGQVNGDVIA
FT                   MPGKPSTLILSELGSVNGAVSVTHLVVNGAICGDVTATEYLELHAKARVTGNVHYKTLE
FT                   IQIGAMLQGHLVHTNAADQENVVAFKSSNA"
FT   gene            402470..402829
FT                   /locus_tag="Galf_0357"
FT   CDS_pept        402470..402829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0357"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: slt:Slit_2452 iron-sulfur cluster assembly
FT                   accessory protein; TIGRFAM: iron-sulfur cluster assembly
FT                   accessory protein; PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54401"
FT                   /db_xref="GOA:D9SJQ2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ2"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADL54401.1"
FT                   /translation="MDATTAVTESQDLLVFTDNAAAKVKQLIEEEGNSELKLRVFVSGG
FT                   GCSGFQYGFTFDEITNEDDTVLDKNGVQLLIDPMSYQYLVGAEIDYTEGLEGSQFVIKN
FT                   PNATTTCGCGSSFSV"
FT   gene            complement(402972..403178)
FT                   /locus_tag="Galf_0358"
FT   CDS_pept        complement(402972..403178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0358"
FT                   /product="SlyX family protein"
FT                   /note="PFAM: SlyX family protein; KEGG: slt:Slit_2430 SlyX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54402"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ3"
FT                   /inference="protein motif:PFAM:PF04102"
FT                   /protein_id="ADL54402.1"
FT                   /translation="MTEERFVNIETKISYQEDLVEELNKIVYQQQQKLSQLEAICASLT
FT                   GHIQSLNEAGNINKTLNERPPHY"
FT   gene            complement(403223..404335)
FT                   /locus_tag="Galf_0359"
FT   CDS_pept        complement(403223..404335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0359"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   slt:Slit_2451 protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54403"
FT                   /db_xref="GOA:D9SJQ4"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ4"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /protein_id="ADL54403.1"
FT                   /translation="MGTQHLSQPELYIGLMSGTSLDGIDAVLVDFAPPAPTLLGKFFFP
FT                   FDDALRQAVLALHLPAQNELHQTQLIANQLATLYAQAVNALLALTCHTPQQILAIGCHG
FT                   QTIRHCPEHGYTLQIGNAALLAELTSITVVSDFRSRDIAAGGQGAPLVPAFHDKLLRAP
FT                   GVHRVIVNIGGISNLTNLAPGVTTSGFDCGPGNLLMDAWCMQHLKRSYDANGAWAATGR
FT                   VLPELLQLMLAEPFFALPPPKSSGRDLFNMQWLQSKLTGDESPEDVQATLLELTCRTIA
FT                   EAIQTQCAGAQAVYLCGGGAHNLTLLNRLATLLSSSIVQTTNELGVDSDFLEAIAFAWL
FT                   AQQNLQGLPANLPLVTGARHSCILGAVYPA"
FT   gene            complement(404336..405634)
FT                   /locus_tag="Galf_0360"
FT   CDS_pept        complement(404336..405634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0360"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: slt:Slit_2450 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54404"
FT                   /db_xref="GOA:D9SJQ5"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ5"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADL54404.1"
FT                   /translation="MLTQNMLNQERKKKLRWFITVSTMPLLGVVTAFGLVPTSNLGLNN
FT                   DKVAIEQLALPAAAPTESTPATFWHTERLQRGDTVAELMQRLNIKDPVASNYLRNSADA
FT                   KAFRKLSVGSEVQAETDTTGALVSLSYLGEQGAKSIIQKQGDSFISKTVAAQLEKRLFV
FT                   RTGEIKTSLYAATDAAGMPESAANQLTEIFSGDVDFHHDLKRGDRFTAVYEMTYSNGAL
FT                   VKAGQIQAAEFINQGNVYRAVRFQSDATHSDYYTPEGRSLKKAFLRSPIAFSRVSSGFT
FT                   MARFHPVLNKWRAHKGVDFAAPIGTPVKATSDGIVSFVGQQNGYGNVVILKHQSQYSTV
FT                   YGHLSRYAKGLRNGARVRQGDVIAYVGMTGMTSGPHLHYEFRINDQQRDPLRVALPNAL
FT                   PITGANRTAFKAMADKFVASLVQLRNTNLAKLD"
FT   gene            405821..407020
FT                   /locus_tag="Galf_0361"
FT   CDS_pept        405821..407020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0361"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="KEGG: slt:Slit_2449 tyrosyl-tRNA synthetase;
FT                   TIGRFAM: tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54405"
FT                   /db_xref="GOA:D9SJQ6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ6"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADL54405.1"
FT                   /translation="MNDMTQVLDVIKRGADELLIEAELKQKLALGRPLRIKAGFDPTAP
FT                   DLHLGHTVLLNKMRQLQDLGHHALFLIGDFTGMIGDPTGKNATRPPLSREQVLENAQSY
FT                   RDQVFKVLDPEKTEIVFNSTWMDKFSAVDLIRLAATHTVAQMLERDDFAKRYKGGQPIA
FT                   IHEFIYPLVQGYDSVALKADLELGGTDQKFNLLMGREMQRHYGQPAQCILTMPLLEGLD
FT                   GVNKMSKSLGNYIGITDAPQDMFGKLMSISDVLMWRYLELLSFRSLSEIASWRAEVEGG
FT                   RNPRDIKVLLAQEIVARFHSQRDAEAALEEFDARFRKGVLPDDMPEMTVAAPDGVISVP
FT                   LLLRQAGLVDGTSEAMRMIVQGAVKLDGERVNDKGDTVAAGRVVVAQVGKRKFARITVQ
FT                   "
FT   gene            407127..407339
FT                   /locus_tag="Galf_0362"
FT   CDS_pept        407127..407339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0362"
FT                   /product="ribosomal protein S21"
FT                   /note="KEGG: slt:Slit_2447 ribosomal protein S21; TIGRFAM:
FT                   ribosomal protein S21; PFAM: ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54406"
FT                   /db_xref="GOA:D9SJQ7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ7"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ADL54406.1"
FT                   /translation="MTTVRVKENEPFEVAMRRFKRSVEKTGLLTDLRAREFYEKPTAER
FT                   KRKLAAAVKRHYKRLRSQTLPPKLY"
FT   gene            407361..407804
FT                   /locus_tag="Galf_0363"
FT   CDS_pept        407361..407804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54407"
FT                   /db_xref="GOA:D9SJQ8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ8"
FT                   /inference="similar to AA sequence:KEGG:Slit_2446"
FT                   /protein_id="ADL54407.1"
FT                   /translation="MNLKQKITDDMKVAMRAKDTARLSAIRLLLAAIKQREVDERIELA
FT                   DGDIVAIIEKMNKQRRDSISQYEAASRQDLADIEKFEMGVLAVYMPQQLGDAEVLAAVV
FT                   EAISAVGAAGPQDMGKVMGVLKSKLAGIADMGRVSALIKAQLS"
FT   gene            407878..409635
FT                   /locus_tag="Galf_0364"
FT   CDS_pept        407878..409635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0364"
FT                   /product="DNA primase"
FT                   /note="TIGRFAM: DNA primase; PFAM: DNA primase catalytic
FT                   core domain; DNA primase, DnaB-helicase binding domain; DNA
FT                   primase DnaG DnaB-binding; TOPRIM domain-containing
FT                   protein; KEGG: slt:Slit_2445 DNA primase; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54408"
FT                   /db_xref="GOA:D9SJQ9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJQ9"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ADL54408.1"
FT                   /translation="MIPKSFIQDLLNRLDIVDVIERYVPLKKAGGNYVACCPFHNEKSP
FT                   SFTVSQSKQFYHCFGCGVHGTAVGFVMEHLGLGFVEAIEDLAQSVGMQVPYEQQASGES
FT                   FKKVAPDLYEVMQVATRYYREQLKLSTRAIDYLKNRGLSGEIAARFGIGFAPEGWQNLS
FT                   AAFPDYQSATLVETGLVITGDGDKRYDRFRDRVMFPIVNVRSQVIGFGGRVLDKGEPKY
FT                   LNSPETPLFEKGRELYGLYQAQKAIRAHGRVLVVEGYMDVVALAQHGVDYAVATLGTAT
FT                   TPYHIQKLLRLADQIVFCFDGDKAGRKAAWRALENALPHLQDGKLLSFLFLPAEHDPDS
FT                   FIREFGQAEFEQRIAEAMPLSGYLLRELTSELDLQTQEGRNQLLHRAKPLLSVIVSPVT
FT                   SLLLRKEVAALSGVSQAELEALYEIKPIAHAPRPSLKKAARTPFPVQRLMLQCLIAQPG
FT                   LGVDMPADWHGEGADAEAIVAVLSALREADYKISSPALMQMFEGTSYARALAQAEAEML
FT                   AWGDSFDVAAEFAGLVGKLEEGQRRDQFQALQSKLSQGGLSGLSVDEREQYLRLLQRGN
FT                   SGVVSELKS"
FT   gene            409731..411698
FT                   /locus_tag="Galf_0365"
FT   CDS_pept        409731..411698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0365"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="KEGG: slt:Slit_2444 RNA polymerase, sigma 70
FT                   subunit, RpoD; TIGRFAM: RNA polymerase sigma factor RpoD;
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 non-essential domain protein; sigma-70 1.1 domain
FT                   protein; sigma-70 region 3 domain protein; sigma-70 region
FT                   2 domain protein; sigma-70 region 4 domain protein;
FT                   sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54409"
FT                   /db_xref="GOA:D9SJR0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR0"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ADL54409.1"
FT                   /translation="MVTVKKTKKKTDKKDDVIALPLAELQQDIDARRTSLKALIVLGKE
FT                   RGYLTYAEINDHLPDMLEVEQIESVASMINDMGIRVCDVAPDAEALIMTDSAPTAADED
FT                   AAEEAEAALSTVDSEFGRTTDPVRMYMREMGTVDLLTREKEIEIAKRIEEGQRNMIQAI
FT                   SACPVTIAEILSLAAKIEIDEIRVNELIDGFVDIELEDESGLTASDDQEQDDAEEEESS
FT                   EESSSEDGDEEDEEAMAAASAAAAAADLAQLKADALARFAVIADLFSKMGKAYEKYGYL
FT                   SAQYNVHQAGITEELMAFRFTAKQVDALCNTMRGLVEEIRTNERGIQDICVTKSKMPRP
FT                   HFIKSFVGHEVDMDWLAQEIKAAKPYSELLVRYQHAIVEKQQNLINMQKRVGLPITDLK
FT                   EINRRMTNGEARSHRAKRDMIEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDK
FT                   FEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQILQETGQE
FT                   ADAATLAEKMEMTEDKIHKILKIAKEPISMETPVGDDDDSHLGDFIEDSNTTVPIEAAV
FT                   YESLRSATSDILDSLTQREAKVLRMRFGIEMNTDHTLEEVGKQFDVTRERIRQIEAKAL
FT                   RKLRHPSRSEKLKSFLDSEG"
FT   gene            411707..411783
FT                   /locus_tag="Galf_R0013"
FT                   /note="tRNA-Met1"
FT   tRNA            411707..411783
FT                   /locus_tag="Galf_R0013"
FT                   /product="tRNA-Met"
FT   gene            411860..413125
FT                   /locus_tag="Galf_0366"
FT   CDS_pept        411860..413125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0366"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   slt:Slit_0320 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54410"
FT                   /db_xref="GOA:D9SJR1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL54410.1"
FT                   /translation="MSSLSRNDYRTLVLSALGGALEFYDFIIFVFFAVVIGQLFFPPDM
FT                   PDWLRQLQTFGIFAAGYLARPLGGIVMAHFGDLLGRKRMFMLSILLMSLPTLVIGLLPT
FT                   YAVIGIWAPILLLTLRIMQGAAIGGEVPGAWVFVSEHVSEKHVGFACGTLTAGLTGGIL
FT                   LGSLVATAVHQMYSPAELLSEGWRVPFILGGLFGLLSVWLRQWLQETPVFKEMQARKLL
FT                   ADELPLKTVVRAHRASVVLTMAMTWLLSAAIIVMILMTPILVQKLYAIPAAAALQAGSI
FT                   ATLFLSFGCIVFGALSDRFGAGRVLAAGCVMLGFTAMLFYSQMAVAPQYINPLYALCGF
FT                   FVGVIGVIPAAAVRAFPPVVRFSGLSFSYNVAYAVFGGLTPVLVSLCLPLDPMAPAHYV
FT                   LLLSGAGVLIGLYLIRCEKKVE"
FT   gene            413232..414194
FT                   /locus_tag="Galf_0367"
FT   CDS_pept        413232..414194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0367"
FT                   /product="Polyprenyl synthetase"
FT                   /note="KEGG: slt:Slit_0321
FT                   trans-hexaprenyltranstransferase; manually curated; PFAM:
FT                   Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54411"
FT                   /db_xref="GOA:D9SJR2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR2"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADL54411.1"
FT                   /translation="MENFNQLLAADMASVDQVIRNKLHSEVVLVNQVAEYIVNSGGKRL
FT                   RPALVVLSAHAFNYTGEHHHELAAVVEFIHTATLLHDDVVDESGLRRGRETANALFGNA
FT                   ASVLVGDFLYSRAFQMMVEVGSMRVMQTLADATNVIAEGEVLQLLNCNDADVDAENYMR
FT                   VIHYKTAKLFEAAMRLGAILAKTSSEDEAAAATYGMHLGTAFQLIDDVLDYSADEAATG
FT                   KHLGDDLAEGKPTLPLIYAMQHGTAQQAAVVRSAIEEGDVGKFADVLKIIHDTGALDFT
FT                   RLQAMREVELACAAIKGLPASKYKTCLMELAHFAATRQH"
FT   gene            414240..414449
FT                   /locus_tag="Galf_0368"
FT   CDS_pept        414240..414449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR3"
FT                   /inference="similar to AA sequence:KEGG:Slit_2635"
FT                   /protein_id="ADL54412.1"
FT                   /translation="MSRLLFLFAIVAVIYLLFKSVRKNLPSQAPKPAEDMVRCAYCGVH
FT                   LPAGESVSAGDAHFCCAAHRDAQG"
FT   gene            414452..416056
FT                   /locus_tag="Galf_0369"
FT   CDS_pept        414452..416056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0369"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: slt:Slit_2634 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54413"
FT                   /db_xref="GOA:D9SJR4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL54413.1"
FT                   /translation="MLPVTNDEIPADFWRSLYYFNLYRLALVGFILFIAIAFEAERLFG
FT                   TSKGHLFLLTGWVYAVVVTLSFIPMRMRWFKFSWQLAWQVCSDIVVLTVLSHASGGIQS
FT                   SVGLLLMVSMAVAGIISRGKITLFFASLASIAALLEHAFAVLYDDAPVTQYVQVGLLCV
FT                   SYFAVAGLAHKLAQYALDNQKLAQRRGRDLIGMAEANRLVMRDMQDGVLVVDEHDRIVQ
FT                   MNPSAARLLYNTEAADSMLSESFPLLYQQYVQWKHNTMNARITLQLDGGLQARLRFVGV
FT                   ERDAAQGAVIFLEDMQHAQAEAQQIKLAALGRLTANLAHEVRNPLSAISYATELLQEES
FT                   GDTRQARLLQLIRDNTQRINRIVEDVMQLNRRDRAQPETFDLAVLLPVFVEEFNQAERV
FT                   GKDVLHLQAEGGSMVTFDRGHFRQVLWNLCRNALHYGHQLPGSLVLTTGLDRGRVLLDV
FT                   LDDGPGVSVAHQSRLFEPFFTTAEQGTGLGLYIARELCEANGAWLEYHDRFSEPGACFR
FT                   ITFGERRLGKRPVNEHG"
FT   gene            416043..417437
FT                   /locus_tag="Galf_0370"
FT   CDS_pept        416043..417437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0370"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: slt:Slit_2633 two component, sigma54 specific,
FT                   transcriptional regulator, fis family; PFAM: sigma-54
FT                   factor interaction domain-containing protein; response
FT                   regulator receiver; helix-turn-helix Fis-type; SMART:
FT                   response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54414"
FT                   /db_xref="GOA:D9SJR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR5"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADL54414.1"
FT                   /translation="MNMADKTKREFQSGSVKGAALQQSVLLVDDEPDILELLEMTLLKM
FT                   GLVVDKAACVQEALAKLAANRYDLCLTDMRMPDGDGLEVVKYIAAHSLDVPVAVITAHG
FT                   NMENAITVLKAGAFDYLAKPLSLEQLRTLVKSALSMPQPSPSADKLLLGNAPAMQKVRD
FT                   LIERVARSQAPVYISGESGSGKELAARLIVQSGPRSDQPVIAVNCGAIPENLMESEFFG
FT                   YKKGAFTGADKDRDGFFQAANGGTLFLDEVADLPLTMQVKLLRVIQEKRVRKVGSTTEE
FT                   PVDVRLISATHKDLAERVKSGQFRQDLYYRLNVIPIQMPSLRELREDIAQIAQQVLNRL
FT                   RAGVPTRFSDEALRVLQQYDFPGNVRELENIIERALALCSEGVIAAEDLCLSPVEQAEV
FT                   GERTDKYPLPAYLDRVEKEALMEALQQTNFNRTAAAKLIGLTFRTMRYRMERLGIKSPA
FT                   GADDAD"
FT   gene            417424..417966
FT                   /locus_tag="Galf_0371"
FT   CDS_pept        417424..417966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0371"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="KEGG: nmu:Nmul_A1812
FT                   N-acetyl-anhydromuranmyl-L-alanine amidase; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART:
FT                   N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54415"
FT                   /db_xref="GOA:D9SJR6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR6"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADL54415.1"
FT                   /translation="MMRIDQAGWAGGCEHLHSPNFDDRAAGPIELLVIHNISLPPDEFG
FT                   GEGVQQLFTNTLDRRAHPYYQTIPEGRVSSHFYIRRDGHLIQFVSCLQRAWHAGLSSWQ
FT                   GKTRCNDFAVGIELEGSDNVPFTDAQYAALHELTLALRMALPIRGIAGHSHIAPVRKTD
FT                   PGPFFDWQRYLAPLALK"
FT   gene            418148..420982
FT                   /locus_tag="Galf_0372"
FT   CDS_pept        418148..420982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0372"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /note="KEGG: slt:Slit_2631 ribonucleoside-diphosphate
FT                   reductase, alpha subunit; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein; ATP-cone domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54416"
FT                   /db_xref="GOA:D9SJR7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR7"
FT                   /inference="protein motif:TFAM:TIGR02506"
FT                   /protein_id="ADL54416.1"
FT                   /translation="MTNAASAPTSLSSAAGDKEANSSFDLYKVVRRNGSVVVFEPAKIS
FT                   VALTKAFIAVSGGPAAASARVRELVDQLTQGVVIALMRRQPHGGTLHIEDIQDQVELGL
FT                   MRSGEHDVARAYVLYREEHSRSRAQTQVQQPAHVINVTGKDGVVQPLDLARLSVLVQSA
FT                   CEGLGEVVDAELVLQVALKDMYDGVPLHEVHKCLILSARSMIEKEPAYNFVTARLLLNN
FT                   ICSEVLGEDVAPADMATRYADYFPKFIKRGIAAELLDEKLAGFDLPRLAAELDASRDLQ
FT                   FGYLGLQTLYDRYFLHIGGTRIEAPQVFFMRVAMGLALNEIDREARAIEFYRLLSGFDF
FT                   MCSTPTLFNSGSRRSQLSSCYLSTVEDNLEGIYDAIKDNALLAKFAGGLGNDWTPVRAL
FT                   GAHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLDLRKNT
FT                   GDDRRRTHDMNTSNWIPDLFMKRVMEGGNWTLFSPSDVKDLHDLFGIDFEIAYTAYEEK
FT                   AAAGQIKLYKTVQAASLWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTE
FT                   ITLNTNADEIAVCNLGSVNLPAHLYPEGHDLAGQIDHAKLRRTINTAMRMLDNVIDINY
FT                   YAVAKARNSNLKHRPVGMGIMGFQDCLHQLRLPYSSMEAVEFADRSMEAVCYYAYWAST
FT                   ELAEERGRYASYKGSLWDCGILPQDTLDLLREERGGYVEVDTSVSMDWDALRARIGQYG
FT                   MRNSNCVAIAPTATISNIIGVSACIEPTYQNLFVKSNLSGEFTVINDHLVAELKRLGLW
FT                   DEVMISDLKYFDGSLAKIDRIPAELRSLYATAFEVEPSWLIEAASRRQKWIDQAQSLNI
FT                   YMAGVSGRKLDDTYKLAWVRGLKTTYYLRTLGATSAEKSTGRAGALNAVSVGDAPAETT
FT                   QFCSIDNPECEACQ"
FT   gene            420982..422079
FT                   /locus_tag="Galf_0373"
FT   CDS_pept        420982..422079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0373"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: slt:Slit_2630 ribonucleoside-diphosphate
FT                   reductase; PFAM: ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54417"
FT                   /db_xref="GOA:D9SJR9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR9"
FT                   /inference="protein motif:PRIAM:1.17.4.1"
FT                   /protein_id="ADL54417.1"
FT                   /translation="MLTFDDEVITTNPAVDTLSSSAATDAASARIRVEDKRIINCKADV
FT                   NQLVPFKYKWAWEKYLAACANHWMPQEVNMTADIALWKSDKLSDDERRLIKRNLGFFTT
FT                   ADSLAANNIVLGSYRHITNPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNMYH
FT                   EVPSIRNKDEFLLPYIDVLTNPEFKTGTPEADQALLRSLIVFACIMEGLFFYVGFVQIL
FT                   ALGRQNKMTGAAEQYQYILRDESMHLNFGVDLINQIKMENPHLWTAAFREEIRGLMQKG
FT                   VELEYAYAEDTMPRGILGLNATMFKEYLRFIANRRCQQIGVDILYQGATNPFPWMSEMI
FT                   DLKKEKNFFESRVTEYQTGGTLSWD"
FT   gene            422362..423801
FT                   /locus_tag="Galf_0374"
FT   CDS_pept        422362..423801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0374"
FT                   /product="SEFIR domain protein"
FT                   /note="PFAM: SEFIR domain protein; KEGG: shm:Shewmr7_1857
FT                   SEFIR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54418"
FT                   /db_xref="GOA:D9SJR8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR013568"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJR8"
FT                   /inference="protein motif:PFAM:PF08357"
FT                   /protein_id="ADL54418.1"
FT                   /translation="MGNPKLFISYSWSSQDHEAWVIQLATDLRESGIDVVLDKWDLKEG
FT                   HDAHAFMERMVSDPEIKKVALICDKTYVDKADGRSGGVGTETQIISPEIYRSQAQDKFV
FT                   AIVKERDDEGKAYLPVYYRSRIYIDFSDPSLEAENFEKLIRWVYEQPLYKKPSLGQKPG
FT                   FLSEEQRAVSLGTSSRQRRALDAIKSGRDNAEAVMIDYLTTLADELEKFRIDASIEPFD
FT                   DEVIRNIEAFLPYRNEAIELFLSLALYRDSLETRTAIHRFFERIIPYLERPQNISSHRE
FT                   WDFDNFKFIVHELFLYALATLIRYERFESAAFLMANEYYVSGRSEYGKDAMVPFEVFHQ
FT                   YIKSLEHRNKRLELRRLSLRADLLEQRSKGSGIEFRYLMQADFILFMRDNIDRPNDQWH
FT                   WWPETLLYIVRHSGPLEVFARSRSTSYFERAKILLGVESKAALAPLLEAFGAERQRLPR
FT                   WEFTTLSPSGLLGFNEIATKP"
FT   gene            423878..424774
FT                   /locus_tag="Galf_0375"
FT   CDS_pept        423878..424774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_2681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54419"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS0"
FT                   /inference="similar to AA sequence:KEGG:Mmwyl1_2681"
FT                   /protein_id="ADL54419.1"
FT                   /translation="MNAYIRKNVLGPVPKLPISDVQFDAASQARVVLAAAFALEESYDL
FT                   LIGNYVEVEQELLTATASNAVRDLNEYHDFFELRSTINRRVVNLLTATRLYLDQAPQRL
FT                   SDCATEPNKARSEFKQRTHNHYDATFGYRFLEALRNHVQHCGLAVHSLRLEKKWIGEGE
FT                   SRELELSIRPFAERHYLGANTGFKATILDEMPEKVVLTLVIREYLQCIGDLHKLVRSHV
FT                   AERVKVARQTIQDHLSNYAKASDGSTVGLTAFRTGPQGQQESVPLLLDWDDVRVKLVSR
FT                   NSGLVALERHVVTGRAK"
FT   gene            425061..426035
FT                   /locus_tag="Galf_0376"
FT   CDS_pept        425061..426035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54420"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS1"
FT                   /inference="similar to AA sequence:KEGG:Vapar_2240"
FT                   /protein_id="ADL54420.1"
FT                   /translation="MSHENIERYLEETLGLTVAIKPWAEKSVLPYFLHDAYDFACIELL
FT                   GARYVLMLARDQAANAAKVRKDADTLGKASGEVAIYVAPVLSSYERKRLVGQHIPFIVP
FT                   GNQLYLPDLGIDLREYFRQRRAVPDKGLSPATQALLISALLNPWKAEVHPAELANGLGY
FT                   TSMTLSRAMKELENSGLASVVRVGRERRLRFEENAHAVWTKALPLLRDPVKQTVWAMPN
FT                   STVQQQARVAGESALADTTLLAEPAYPVYAISREQWKLAQKLGLLVLPSPEPGACLWQI
FT                   WCYDPNINPIAGSVDPFSLILSLRNERDERVQQALHEFEKGLI"
FT   gene            426032..426793
FT                   /locus_tag="Galf_0377"
FT   CDS_pept        426032..426793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0377"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   dol:Dole_0233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54421"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS2"
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /protein_id="ADL54421.1"
FT                   /translation="MIKGLDLFRHHFDDYTDRYVLIGGVAASLVMEEAGLDFRATKDID
FT                   LVLIVEAMDAEFGQHFWQFIQDGGYEIRERSGGKPQFYRFQKPTNPGFPVMLELFSRIP
FT                   DGLLLSVDAHLTPIPIDEAVSSLSAILLDNDYYQFILAGVHVSDGIAWVREDRLIPLKA
FT                   NAWLDMSKRVAQGETIDSQKVRKHLHDVLRLSQVLAPGTRIDLPARVAEDLNQFLGLIV
FT                   QENVDMKTLGLGKTNLAVIIDRISVAYGLTQ"
FT   gene            complement(426842..428590)
FT                   /locus_tag="Galf_0378"
FT   CDS_pept        complement(426842..428590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0378"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: swd:Swoo_0501 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54422"
FT                   /db_xref="GOA:D9SJS3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS3"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADL54422.1"
FT                   /translation="MSAIQQLLTDHIDIWTAAETEKRSGRGRASGNAGSVYGIKKLREL
FT                   ILELAVRGKLVPQDANDEPACELLKGIQAKKAKLIAEGKIKKDKPLAAITEDEKPFELP
FT                   KGWEWVRVGQVGHDWGQKEPDSNFTYIEVSAIDSTRGVVSSPGLVAPEDAPSRARKIVK
FT                   KGTVIYSTVRPYLLNIAVIEEEFSPEPIASTAFAIVHPFCLMPPRYFLSFFRSPVFVRY
FT                   VESVQMGIAYPAINDGQFFSGLIPLPPIEEQHRIVAKVDELMALCDQLENQHSNAAEAH
FT                   EKLVSHLLGTLTQSQNAEDFSANWQRIAAHFDTLFATDASIDALKQTLLQLAVMGKLVP
FT                   QNANDEPASELLKRIQAEKAKLISEGKIKKDKPLTPITDVEKPFELPLRWEWVRLSDIA
FT                   TQITDGAHHTPEYISDGVPFLSVKNLSSGCLDFTDTRFISPVAHADLTKRCNPEFDDIL
FT                   LTKIGTTGIAVVIDDPRPFSIFVSVALIKLPKILIDRDYLSLVINSPFVRQQSEDGTEG
FT                   VGNKNLVLRKINTFDIPFAPLAEQHRIVAKVDELMALCDQLKSRITDASRLQQKLADVL
FT                   VEQAVA"
FT   gene            complement(428587..430062)
FT                   /locus_tag="Galf_0379"
FT   CDS_pept        complement(428587..430062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0379"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: pnu:Pnuc_1133 N-6 DNA methylase; PFAM: N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54423"
FT                   /db_xref="GOA:D9SJS4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS4"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ADL54423.1"
FT                   /translation="MSISSTIKSIQDIMRKDVGVDGDAQRLSQLVWMLFLKIFDDRESE
FT                   WELLQDNYLSPLPEAYRWRNWAANPEGMTGEALKQFLDNEMFPALQQLEARGGDQRAYV
FT                   IRSVFEGAYNYMKSGQLIRQVVNKIQEGVDFNKAQERHLFGDMYEQLLRDLQAAGNAGE
FT                   FYTPRAVTEFMVRMTNPRLGEKVMDPACGTGGFLSCSIEHIRRQDVKTVDDEAALQASI
FT                   FGIEKKPMPHLLCTTNMILHGIDVPSNIRHDNTLARPLISWTPKERVDVVVTNPPFGGM
FT                   EEDGIETNFPAAFRTRETADLFLVLIMQLLKAGGRAALVLPDGFLFGEGIKTRIKEKLL
FT                   EECNLHTIVRLPNGVFAPYTGIKTNLLFFSKGAPTQHIWFYEHPYPAGVKSYNKTKPMK
FT                   IEEFDVEAAWWGVESDGFSHRVENEQAWKVSLDDIKARNYNLDCKNPHVGEQEIHDPDV
FT                   LLAQYAAMQSEIAALRNQLKTILGEALNREVQA"
FT   gene            complement(430065..430502)
FT                   /locus_tag="Galf_0380"
FT   CDS_pept        complement(430065..430502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_0599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54424"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS5"
FT                   /inference="similar to AA sequence:KEGG:Memar_0599"
FT                   /protein_id="ADL54424.1"
FT                   /translation="MTQPPKQVLHPDKFSFYIGDYGAIGYKLEMHDNILLYSSASSDRI
FT                   CGNAESIEVIPSPIKWRNFIAKLEAIGVWDWEDNYENPCVCDGTQWELNIALGDRHVQS
FT                   SGSNYYPGITDDPTCITFPDSSPQFDAFLLALKNLTGKRIN"
FT   gene            complement(430486..432879)
FT                   /locus_tag="Galf_0381"
FT   CDS_pept        complement(430486..432879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0381"
FT                   /product="Type I site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.3"
FT                   /note="PFAM: EcoEI R domain protein; type III restriction
FT                   protein res subunit; protein of unknown function DUF450;
FT                   KEGG: pnu:Pnuc_1134 EcoEI R domain-containing protein;
FT                   SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54425"
FT                   /db_xref="GOA:D9SJS6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS6"
FT                   /inference="protein motif:PRIAM:3.1.21.3"
FT                   /protein_id="ADL54425.1"
FT                   /translation="MTDNKKLSERDICTKYITPAVIQAGWDLFTQIREEVSFTKGRIIV
FT                   RGKLHTRGELKRADYILYYKSNIPLAVIEAKDNSHGVGSGMQQALNYAETLAVPFVFSS
FT                   NGNGFLFHDRTGMSDQTERELRLEEFPSPAELWQRYCLWKGIATEQALKTVEIPYYDDG
FT                   TSRAPRYYQVNAINNTIEAVAREQQRILLVMATGTGKTYTAFQIIWRLWKSGTKKRILF
FT                   LADRNILVDQTKNNDFKPFGAAMTKITKRQIDKSYEIYLSLYQAVTGSEEDQNIYRQFS
FT                   PDFFDLIVIDECHRGSASEDSAWRVILDYFSSATHIGLTATPKETKDVSSINYFGEPVY
FT                   SYTLKQGIEDGFLAPYKVVRIDIDKDLQGWRPSKGQADKNGLMIEDRIYNQIDMDRTLV
FT                   LEKRTELVARKITEYLAATDPYAKTIVFCDDIDHAERMRQALVNLNPERVKESRKYVMR
FT                   ITGDEIEGKAELGNFINPEERYPVIATTSKLMTTGVDAQTCKLVVLDQHIKSMTEFKQM
FT                   IGRGTRINEDYDKYWFTIMDFKKATELFADEAFDGPPIVIYEPEPDKPPAPPDELPVDE
FT                   HGNPLPPDTDGEEGGADLPTSDDFGGGSGPGTGRVKYVIGDVSVYVVSERVQYYGPEGK
FT                   LITESLKDYTRTTVRRDYASLKDFLLSWNKADRKAAILKELEEHGLLLEPLADEVGKDF
FT                   DAFDLICHVAFDQPPLTRRERAEQVKKRNYFTKYGEQARRVLETLLEKYADTGIQNIED
FT                   IKILTLDPFKNMGTASELVSAFGGKPAYLAALHELEQQLYDTAA"
FT   gene            complement(433589..436093)
FT                   /locus_tag="Galf_0382"
FT   CDS_pept        complement(433589..436093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0382"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   PAS fold-3 domain protein; histidine kinase A domain
FT                   protein; GAF domain protein; KEGG: phe:Phep_3858 PAS sensor
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; PAS domain containing protein;
FT                   PAC repeat-containing protein; histidine kinase A domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54426"
FT                   /db_xref="GOA:D9SJS7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADL54426.1"
FT                   /translation="MKIAPLPKDEQARMAALLDYEVLDTELDSALDSMVQLASYICQTP
FT                   IAAISLIDEHRQWFKASTGLDAKETSRDVAFCAHTILENETMIIENAQLDERFFDNPLV
FT                   VSAPEIRFYAGVPLAAPEGQHIGTLCVIDRVPRVLSPEQINAIKILANNIMAHLNLNLS
FT                   HRMSRQHVDSLNLKNAQLQTSQNLLTKLSHQLPGMLFQFRLFPDGNVSMPYASDGIFEI
FT                   FELPAVQIKEDASLLFTRVHPEDYEILMASIHESARTQQPWRLEYRVMLPMRGLRWLEG
FT                   QSRPEKLSDGSVIWHGYLSDVTERHQAAVSLHEVSERLALATQAGGVGVWDWDVVNNAL
FT                   TWDDQMFALYGLHRDQFVGAAEAWSSAILPEDTAQAQACMHNALANKQHYDTEFRVRWP
FT                   DGSIHNIRALASVKFDSAGKPLRMTGTNWDITELKQSQQALQRAKEVAESLAQSKSEFL
FT                   ANMSHEIRTPMNAVIGLSELALDSTDPAEKQSHLQQINDSSRSLMGILNDILDLSKIEA
FT                   HQLSVEKIQFNLTELLDSIQRIFTLSAAGCDIEFNVVRDADIHQLLLGDPLRLRQILTN
FT                   LLGNAFKFTQKGRVTLNVSKIENTTDSTTLRFSVKDNGIGMSDGQVSTLFQPFSQADSS
FT                   ISRRFGGTGLGLTISRNLAQLMGGDIKVESQAGAGSTFSVELTFSKVQVSDPQRRQSDK
FT                   APPELREIAHALRGKHVLLTEDNRINQLVASKMLEKIGLLVDIANNGEEAIQRLQEKTY
FT                   DIVLMDIQMPVMDGLEATRLIRQDTRFINLPIVAMSAGVTLDEKSACDKAGMTGFVAKP
FT                   INSSELINKLIELCFPYISDGI"
FT   gene            436586..437530
FT                   /locus_tag="Galf_0383"
FT   CDS_pept        436586..437530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0383"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: lhk:LHK_03113 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54427"
FT                   /db_xref="GOA:D9SJS8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS8"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADL54427.1"
FT                   /translation="MKIAFILLLLSVSACTTPPLQYKNVVLPQAVYSAQLQSDRPVVAL
FT                   ALGSGGDRGFAHIGVIKVLEANNIKVDLVLGTSAGSVVGALYAGGYDGVALEKLALEMD
FT                   REKLKDFDFSRRGYVRGEQLQDFINRALKNRSIEQLDKPFVAIATQLSSGRAVAFNRGN
FT                   TGMAVRASSSIPGVFYPVIIQGEEYVDGDLKKPVPVTIAREMGADFIIAVDISQQPKDS
FT                   PALLDIIDILKQSLRIMRQSILSQELASAQVVIRPVIGMTPEIDAASKLHLIKAGEEAA
FT                   TAALPMIREWLQKIAAEKALEQHPSSPLAVPRS"
FT   gene            437539..438846
FT                   /locus_tag="Galf_0384"
FT   CDS_pept        437539..438846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0384"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: slt:Slit_0388 para-aminobenzoate synthase,
FT                   subunit I; TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54428"
FT                   /db_xref="GOA:D9SJS9"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJS9"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADL54428.1"
FT                   /translation="MNFYSKELPYLSDAASYYAAIADLPWAAWLDSAGMARFDILTAQP
FT                   HHTLVLQEACEDPFALIRGELGASVAPVADVPFAGGALGYWSYDLTQGGADNLNAIMSI
FT                   GIYDWALVLDHQKKTARLMSHQRFSETAAVLADVLQRLSRLHSLPSEPFSVQGMIASNF
FT                   TKAAYAAAFDTVQGYLQAGDCYQVNLAQCFSAAATGDALCAYLELRELSPAPFSAYLNF
FT                   PEVQILCASPERFVSVCNGVVETRPIKGTRPRDADPLIDAQLACELSCHPKDRAENLMI
FT                   VDLLRNDLGKNCIAGSVRVPKLFDVESYAHVHHLVSTVQGELAPGRDALDLLRGCFPGG
FT                   SITGAPKVRAMQIIEQLESASRGIYCGAIGYAGFDGNMDTNIVIRTLVYSGGQIRCWAG
FT                   GGLVADSQCDAEYQETLDKAAALLALLKCYGGTVAG"
FT   gene            complement(438847..439344)
FT                   /locus_tag="Galf_0385"
FT   CDS_pept        complement(438847..439344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54429"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT0"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_0174"
FT                   /protein_id="ADL54429.1"
FT                   /translation="MNALWTTLLILLSNLAFSAPLSELIDKNVQSATHAYEISLPVAAV
FT                   LPDTPPSPANSTVQLWIHIRNSKQIELAQDIFRKLIQAKSQPWHIEQKPIQKVDDGPLK
FT                   SQLRYFKREDRSQAKKLLAALQKSIPKIELCDLSGKFDQIGWVKPGHYELWLSPDLSRL
FT                   QK"
FT   sig_peptide     complement(439288..439344)
FT                   /locus_tag="Galf_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.957 at
FT                   residue 19"
FT   gene            complement(439341..439745)
FT                   /locus_tag="Galf_0386"
FT   CDS_pept        complement(439341..439745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:EHI_167940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54430"
FT                   /db_xref="GOA:D9SJT1"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT1"
FT                   /inference="similar to AA sequence:KEGG:EHI_167940"
FT                   /protein_id="ADL54430.1"
FT                   /translation="MLERLKEYKELIAIIAFFLGGFFWLQSQYPSKNDVKDEFNSIRCQ
FT                   LNSYMKLTQLQILNQELEKQLNALKLQLASVNLAEAGGSASAISPAMKLEIDQMKSDFS
FT                   SVRNQLGQTTGEMKKIRDTLELGSCGKAGL"
FT   gene            complement(439869..441977)
FT                   /locus_tag="Galf_0387"
FT   CDS_pept        complement(439869..441977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0387"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: RelA/SpoT family protein; KEGG: slt:Slit_0398
FT                   (p)ppGpp synthetase I, SpoT/RelA; PFAM: RelA/SpoT domain
FT                   protein; TGS domain-containing protein; metal-dependent
FT                   phosphohydrolase HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54431"
FT                   /db_xref="GOA:D9SJT2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT2"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ADL54431.1"
FT                   /translation="MADAEFLIDEVSGYLKPEDVEHIRAAIEFSRIAHQGQTRQSGDPY
FT                   VTHPIAVARILTPLHLDAQSIIAALLHDVVEDTEITTEQIAEQFGKPVAELVGGLSKLE
FT                   KIHFETREDAQAENFRKMLLAMARDVRVILIKLADRLHNMRTLDSMRQDKCERIARETM
FT                   EIYAPIANRLGLNEIYLELQDLSFKHLHPNRYTVLAKALKVARGNRREVVGKILDAIRG
FT                   QLEKKQVQAEVTGREKNIYSIYKKMQLKSLAFSEVLDIYGFRVLVEDTNACYLALGALH
FT                   ALYKPIPGKIKDYIAIPKSNGYQSLHSTLFGPFGTPIEVQIRTREMHKIADAGVASHWL
FT                   YKNGHATISELHKKTHQWLQELLESLNDSRTSAEFMEHLKVDLFPDAVYIFTPKGKILS
FT                   LPRGATAVDFAYSVHTDIGNRCIAVKINHELVPLRSELKNGDRVEIITAAHAKPNPAWL
FT                   TYVTTNKARSHIRHFLKTMQSGESAQLGERLLGQALTALGFKSAEISEACWNKLLRDTG
FT                   VKTRQEILADIGLGRRLNMVVARQLACNGDAAPGDIVSNPVITILGTEGMAVQFATCCR
FT                   PIPGDPIIGVIKSGQGLVVHTHDCPLLRKGHSGQWLDVVWDKHITRTFAVNLKLLVANQ
FT                   RGVLAKVAAAIADAESNIENVSFANEGEYTALHFTLEVNNRLHLATIMRSLRMIPEVIR
FT                   IFRVQSAV"
FT   gene            complement(441996..442202)
FT                   /locus_tag="Galf_0388"
FT   CDS_pept        complement(441996..442202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0388"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="KEGG: slt:Slit_0399 DNA-directed RNA polymerase,
FT                   omega subunit; TIGRFAM: DNA-directed RNA polymerase, omega
FT                   subunit; PFAM: RNA polymerase Rpb6"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54432"
FT                   /db_xref="GOA:D9SJT3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT3"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ADL54432.1"
FT                   /translation="MARITVEECLAHIPNRFEMTLAAAFRARQIANGASHLVPESRDKP
FT                   TVVALREISKGKVGVEILNRGHA"
FT   gene            complement(442206..442823)
FT                   /locus_tag="Galf_0389"
FT   CDS_pept        complement(442206..442823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0389"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="SMART: guanylate kinase/L-type calcium channel
FT                   region; TIGRFAM: guanylate kinase; KEGG: slt:Slit_0400
FT                   guanylate kinase; PFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54433"
FT                   /db_xref="GOA:D9SJT4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT4"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ADL54433.1"
FT                   /translation="MSGSLFVISAPSGAGKTSLVHALLATNPQIDLSVSYTTRAPRKGE
FT                   VDGVAYHFVSRETFIEMSGRGEFLESAEVYGNFYGTSQNWIAQENAKDRDILLEIDWQG
FT                   AQQVRQQFAECVSIFILPPSIAALEQRLTGRGTDHSDVIKQRMAAASNDVAHVAEFDYV
FT                   IINDNLNEALKEFNAIVLAARLRGTKQLARHQNLINQLQNPE"
FT   gene            complement(443200..443694)
FT                   /locus_tag="Galf_0390"
FT   CDS_pept        complement(443200..443694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rcu:RCOM_1981590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54434"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT5"
FT                   /inference="similar to AA sequence:KEGG:RCOM_1981590"
FT                   /protein_id="ADL54434.1"
FT                   /translation="MFKYFAIASLLTVTGCASIAGEKMQPVSVQTIQDNKEVAGVGCTL
FT                   TNDAGKWFVTSPGSVTVHKSTGDLAIDCSKDGNIVGHETLVSKSNGAVWGNILAGGGIG
FT                   YIIDRNTGAGFNYPDSITIVLRKIGEVVGLVTPAIATTTPIVATTAPIVTATAPTEASK
FT                   N"
FT   sig_peptide     complement(443632..443694)
FT                   /locus_tag="Galf_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.874 at
FT                   residue 21"
FT   gene            complement(444164..445027)
FT                   /locus_tag="Galf_0391"
FT   CDS_pept        complement(444164..445027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0391"
FT                   /product="YicC-like domain-containing protein"
FT                   /note="PFAM: YicC-like domain-containing protein; domain of
FT                   unknown function DUF1732; KEGG: slt:Slit_0401 YicC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54435"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT6"
FT                   /inference="protein motif:PFAM:PF03755"
FT                   /protein_id="ADL54435.1"
FT                   /translation="MILSMTGYANTSADASSGTLSLELRAVNHRYLDIQLRMPEEFRVF
FT                   EGALRELISAQLQRGKVECRINYAAREVQGNTTLNRELLTQLAQWSCEVKSALPGARDL
FT                   SVADVLNWRGILATPAVSNDELRATLVSLMQAALLEFSASRSREGDKLKEFLLVRLEKI
FT                   ETLRAEVIPHVPAAIAAYETRLTNRLRDAMQGTDDERVRQEIALFASKIDVDEELSRLD
FT                   SHLTEMHRILRQGGAVGKRLDFLMQELNREANTLGSKSVDAEVSRSAMEMKILIEQMRE
FT                   QIQNLE"
FT   gene            445106..445891
FT                   /locus_tag="Galf_0392"
FT   CDS_pept        445106..445891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0392"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: slt:Slit_0402 protein serine/threonine
FT                   phosphatase; PFAM: Stage II sporulation protein E; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54436"
FT                   /db_xref="GOA:D9SJT7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT7"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADL54436.1"
FT                   /translation="MKFSIHQASHIGDRKYNQDRVAYAYSNDDLLMVLADGMGGHFHGE
FT                   VAASIAIDTFMSAFAGHSHAVDPQAFLSDTMQAAHQRIMSLPQKMDHTFPGTTCVAALI
FT                   QNGKLYWGYAGDSRLYLIRNGAVFAKTLDHSMVQMWLACGVIDEEEARTHPRRNQITNC
FT                   LGGVEDMFNIELGNPVELQSGDVVLLCSDGLSGPLFDKDLLAAFAGNPVEGVLDQLIVR
FT                   AVGLENGKADNATGLALRWGNAEDIHDTDVIISHILEIH"
FT   gene            445983..446699
FT                   /locus_tag="Galf_0393"
FT   CDS_pept        445983..446699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0393"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; KEGG: slt:Slit_0403
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54437"
FT                   /db_xref="GOA:D9SJT8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT8"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ADL54437.1"
FT                   /translation="MRPSSRQANQLREIRITRHYTKHAEGSVLIECGDTKVICTASVEE
FT                   RVPPHKKGSGEGWVTAEYGMLPRSTGSRMQREAAKGKQSGRTQEIQRLIGRSLRAVVDL
FT                   KKLGERTIQIDCDVIQADGGTRTASITGAYVALQDAVSSLIEKGLLTETPVTDAIAAIS
FT                   VGIYQGTPVLDLDYLEDSACDTDMNVVMLGSGHFVEVQGTAEGHAFSRVEMDQLLELAQ
FT                   NGIVDLIKMQQAALAG"
FT   gene            446703..447293
FT                   /locus_tag="Galf_0394"
FT   CDS_pept        446703..447293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0394"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="KEGG: slt:Slit_0404 non-canonical purine NTP
FT                   pyrophosphatase, RdgB/HAM1 family; TIGRFAM: non-canonical
FT                   purine NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54438"
FT                   /db_xref="GOA:D9SJT9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJT9"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ADL54438.1"
FT                   /translation="MNKLVIASNNAGKLREFSHMLQPLGIEVVTQSQLGITEAEEPHVT
FT                   FIENALAKARHASRLSGLPALADDSGICVEALGGAPGVYSARYAGDNPKSDGRNNEKLL
FT                   RDMQGVTDRRAHYYCVLVLVRHADDPQPVIAEGEWHGEIAHEERGEGGFGYDPMFWLPQ
FT                   LNKMSSELTHEEKHAISHRGQAMKVLLQHLKVA"
FT   gene            447290..448474
FT                   /locus_tag="Galf_0395"
FT   CDS_pept        447290..448474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0395"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="TIGRFAM: oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: HemN domain protein; Radical SAM domain
FT                   protein; KEGG: slt:Slit_0405 oxygen-independent
FT                   coproporphyrinogen III oxidase; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54439"
FT                   /db_xref="GOA:D9SJU0"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU0"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ADL54439.1"
FT                   /translation="MIPVSLISKSVAFTALPPLSLYIHVPWCVKKCPYCDFNSHEARGG
FT                   FSEKEYVDALIRDLEMALPQIWGRKVYTVFFGGGTPSLLSGEAITEILRQVRMLLPLSG
FT                   DAEITLEANPGTVEAAKFAAFRDAGVNRLSMGIQSFNDTHLQALGRIHTADEAKAAIDI
FT                   AQLHFDNINLDLMYALPKQTLDQALQDVQTALTFKPQHLSAYHLTLEPNTLFYRNPPSL
FT                   PDDDASADMQQAIEALLAENGYQHYETSAFAQPNRRSRHNLNYWKFGDYLGIGAGAHSK
FT                   LSFPDKIVREARYKQPQAYMQQVALGAPVQTEHEVSRDEIPFEFMMNALRLNEGFDAAL
FT                   FCERTSLSLISIQRELLDAEKRGLLSRDIQRIAPTLQGQRFLNDLLEIFLADKD"
FT   gene            complement(448445..449140)
FT                   /locus_tag="Galf_0396"
FT   CDS_pept        complement(448445..449140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0396"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /note="KEGG: slt:Slit_0408 tRNA
FT                   (guanine-N(7)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54440"
FT                   /db_xref="GOA:D9SJU1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU1"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADL54440.1"
FT                   /translation="MTNTDDLTKRHIRSYVLRQGRVTVAQQRAVDTLQAVYGIPYAPAP
FT                   LNLETAFGRSAPKILEIGFGMGDSTASIAQENPQNDYLCLEVHTPGVGNLFKVMGEQNI
FT                   SNIRIIQHDAVEVLRDMIGDGTLDGVHIFFPDPWHKARHNKRRLIQAPFIEKLMKKLKP
FT                   GGYIHVATDWENYAQQVLQVLSDEPLLENTATDYAPRPDYRPLTKFEKRGINLGHGVWD
FT                   LVFIRKENL"
FT   gene            complement(449199..449993)
FT                   /locus_tag="Galf_0397"
FT   CDS_pept        complement(449199..449993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0397"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   slt:Slit_0409 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54441"
FT                   /db_xref="GOA:D9SJU2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU2"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ADL54441.1"
FT                   /translation="MNDPLIIAGKSYSSRLLVGTGKYKDFTETRAALDASGAEIVTVAI
FT                   RRTNLGQNPNEPSLLDAVPMSKFTYLPNTAGCYTADDAVRTLRLARELLDGHSLVKLEV
FT                   LGDPQSLYPNVIETIAAAKILVAEGFQIMVYTSDDPIVAKQLEDIGCVAIMPLASLIGS
FT                   GMGILNPWNLQLIMDRVSVPVIVDAGVGTASDAAIAMELGCAGVLMNTAIAGAQNPVLM
FT                   ASAMKKATAAGREAFLAGRMPKKLYSASPSSPTAGIIASARS"
FT   gene            complement(450043..450246)
FT                   /locus_tag="Galf_0398"
FT   CDS_pept        complement(450043..450246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0398"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="KEGG: slt:Slit_0410 thiamine biosynthesis protein
FT                   ThiS; TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54442"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU3"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ADL54442.1"
FT                   /translation="MITVFVNGAERQLNDNCSIAELIEALGYTGRRIALEKNGDIVPRS
FT                   RYADSTLNEGDKLEIVVAVGGG"
FT   gene            450290..450363
FT                   /locus_tag="Galf_R0014"
FT                   /note="tRNA-Gly1"
FT   tRNA            450290..450363
FT                   /locus_tag="Galf_R0014"
FT                   /product="tRNA-Gly"
FT   gene            complement(450373..451605)
FT                   /locus_tag="Galf_0399"
FT   CDS_pept        complement(450373..451605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0399"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   slt:Slit_1252 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54443"
FT                   /db_xref="GOA:D9SJU4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL54443.1"
FT                   /translation="MPTPLTPQRERYLLLTLSGMQFSHILDFMIMMPLGPILMHEFSIT
FT                   THEFGFLVASYSFSAAFAGLLAATFVDKFERKRLLLTVFALFGLSTLACGFAPGYATLL
FT                   IARGLAGAFGGVMGAMVQTLVGDLIPFERRATASGVISSSFSLSTVAGVPLSLWLANHY
FT                   NWRAPFILIAVTTVVFMIIALRHLPDVRHHLNQARRAHPFSAMFDVLHDANHLRALIFT
FT                   MLILFSGFTVIPYITVYAVANVGILQHDIFYIYLAGGAATLVTSPLIGRWADRAGKVKI
FT                   YQIMAVASTVPLFAVTQIEAAPLWVWLISTTLFFVLISGRMIPAMAIITSAAIPKLRGT
FT                   FMSLNSATQQLASGLAATLAGFITTQSATGQIAGYDHVGYVAIAANILAIAFVARIVMH
FT                   ENTAEMRINRE"
FT   gene            451750..455364
FT                   /locus_tag="Galf_0400"
FT   CDS_pept        451750..455364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0400"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: phosphoesterase PHP domain protein; TIGRFAM:
FT                   DNA polymerase III, alpha subunit; KEGG: slt:Slit_2567 DNA
FT                   polymerase III, alpha subunit; PFAM: DNA polymerase III
FT                   alpha subunit; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54444"
FT                   /db_xref="GOA:D9SJU5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU5"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ADL54444.1"
FT                   /translation="MPSPVFVHLRLHSEYSITDGMARIDEAVDAAIADGMPALALTDLS
FT                   NFSGLVKFYKKTRGKGLKPVAGVDVFITNEADRDRPYRLLLLCQSSEGYLRLCRLLSRA
FT                   YLSNQYRERAELRREWFKDEGTEGLIALSGAHLGDVGCALMSGNVAEARRYAQGWAALF
FT                   EDRYYIEVQRAGFADEAAYVDAATALAAGLDLPVVATHPVQFLTSADFKAHEARVCIAE
FT                   GYVLNDKRREKAFTAQQYFKTQAEMSELFADLPEALQNSVEIARRCNLTLVLGKPRLPD
FT                   FPTPSGESLDDFMLSESERGLADRMAFLYPDEAERAEKFPQYHERLLFEINTIIKMGFP
FT                   GYFLIVADFIRWAKAYRSDAFPNGVPVGPGRGSGAGSLVAYCLLITDLDPLRYELLFER
FT                   FLNPERVSMPDFDVDFCQDGRELVIDYVKQKYGAACVSQIATFGTMASKAVIRDVGRVM
FT                   EFPYGLCDRLSKAIPLEGVKPVSLQKAREMEPEINAIAESEEGVPELLELAMRLEDLTR
FT                   NVGMHAGGVVIAPGKLTDFCPLYCADGGASVVSQFDKDDVEAIGLVKFDFLGLRTLTII
FT                   DWAVRHIHRLQARDRKGLPRTTNETTTELLREGSRIEDQTQVSTQSSVHNPQLFSIEAI
FT                   PLDDKPSYDLLKKCNTTAVFQLESRGMKDLIKRLQPDTFEDIVALVALFRPGPLESGMV
FT                   DDFVDRKHGRATADYFHPELEASLKPTYGVIVYQEQVMQISQIIGGYTLGGADMLRRAM
FT                   GKKDPAEMARQRDIFVSGALNREIDKDLATRLFDLMEMFAGYGFNKSHSAAYALVAYQT
FT                   AYLKAHHPAAFMAATLSGDLDNTEKVRTFYADTLQQGITILLPDVNSSGYAFSPTDEKT
FT                   ISYGLGAIKGTGEAAIASIVKARATGPFKDLFDFCRRVDKRAVNRRTIETLIRAGAFDS
FT                   INDHRAALMASVDAALASADQQARSINQDSLFGEDDADAVLIEQKSDVPRWSLREQLAF
FT                   EKVSLGIYLGGHPYQEYEKELTNFIKVRLGDLTPAFLGKNSGSGGYVSRRGVQVRLAGI
FT                   VSGLRLQQTRRGRMAVITLDDGSAQIELTVFNEEYEKSRQWIVEDELLVVEGKASLDEY
FT                   SGNIRVSGEELFNFAQARSRFARQLELHCNSSVNIAQLKEILKPWSGGACAVQINYNNE
FT                   VAVCQLRLGTDWQVTLDEALMRDLGVLLQPGNMQVVYG"
FT   gene            455357..456037
FT                   /locus_tag="Galf_0401"
FT   CDS_pept        455357..456037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0401"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: hau:Haur_2605 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54445"
FT                   /db_xref="GOA:D9SJU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54445.1"
FT                   /translation="MANTPLIRINGITLYFDGGQTRALNGVDLTIQEGEFVAIVGPSGS
FT                   GKSSILNVIGTLDTPTAGEIYFRDQAYSTIRDASLFRRENFGFIFQGFHLIPTLSALDN
FT                   VIVPTIGCEGSSHKARAEALLNSLGLQDRLDHFPGKLAGGERQRVAIARSLINQPRVIL
FT                   ADEPTGSLDSANAQQVLDLLAQVVREQGLTLIMVTHDASVSARADRIVHMRDGRVEHPL
FT                   GAFA"
FT   gene            456034..457161
FT                   /locus_tag="Galf_0402"
FT   CDS_pept        456034..457161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0402"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mth:MTH695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54446"
FT                   /db_xref="GOA:D9SJU7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU7"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL54446.1"
FT                   /translation="MNLFRFALDNLYRRPARSGLTVSAISLGIAAVVALTSIAWGFEAS
FT                   WQKANDARGTDLIVTRIASQNSMPSPFLAAKVQDALARLPHVKEVVGLLSEMLTVSEEA
FT                   PPAFVFGWVYGSYLWDHLRLIDGRWPADSDEAVVMVGSLASEMLHKKTGDQVEIEGQVF
FT                   KVAGIFESSAVVENGAVIMTLNRAQALTDKPGKVNFLNIKLDAGASEADLASIKEQVKK
FT                   TMPGFLAITSGELVGNNAIVRISKAMSNATILIATLVGALVVFNTMLMSINERTREIGI
FT                   LLALGWQRATIIKLVFTEAMLLSLLGGLLGILLGAGLAVGLEHLELMRGKIDAIFSIPF
FT                   LFAVLGLSVLLGVFGGLYPALKASRLLPSAALRHE"
FT   sig_peptide     456034..456159
FT                   /locus_tag="Galf_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.422 at
FT                   residue 42"
FT   gene            457158..457922
FT                   /locus_tag="Galf_0403"
FT   CDS_pept        457158..457922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hoh:Hoch_6085 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54447"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU8"
FT                   /inference="similar to AA sequence:KEGG:Hoch_6085"
FT                   /protein_id="ADL54447.1"
FT                   /translation="MKRLLVMLMCFAPLCHAEPGADELAGLMRQAKSTSGFSARMNVLV
FT                   TRPDGAHATPFKIAVIGRFSADKQQLRINGISPDFVRGRFFAAESVGSGEIRVVAYRTP
FT                   DKVSGVDSDARLFDSSLVLWDMFSPWWSWRRQALLAGERINGRECVMIRSSADDKHSAV
FT                   REVESCVDVSARLSLRTRLYDAHHALLRSLLVGKTLQKADSFMQTAKKLTLTDAEGVMT
FT                   QVEVYSGDEQYQIPADAFSALDAERDQKSGAR"
FT   sig_peptide     457158..457211
FT                   /locus_tag="Galf_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.994 at
FT                   residue 18"
FT   gene            457919..458722
FT                   /locus_tag="Galf_0404"
FT   CDS_pept        457919..458722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0404"
FT                   /product="uncharacterized conserved protein UCP07580"
FT                   /note="PFAM: uncharacterized conserved protein UCP07580;
FT                   KEGG: abo:ABO_0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54448"
FT                   /db_xref="GOA:D9SJU9"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJU9"
FT                   /inference="protein motif:PFAM:PF10118"
FT                   /protein_id="ADL54448.1"
FT                   /translation="MKARHADIGDLSHSWCNDDVVVSSVMETVSFVTPVLEGFFIRSVA
FT                   QGMRVHKDSALARRCQAFIREESSHSRAHKKFNTVLLGYLGRPPRGLAMVSAMLDAARQ
FT                   YLSVSQQLGLAAALEHLTAVMSKLYVGQQHGLKFASRYAQELFAMHAEEELGHRSVVFD
FT                   LWQANEPGGRFNRFVIIALVLLVGSVYVGLAVPWILYRKMERRLLKTLIALVKFTVKNI
FT                   GSTLAQLPVSELFSFIRGDFHPERLIDEKMAEKNHTTNAGKGASK"
FT   gene            458719..459315
FT                   /locus_tag="Galf_0405"
FT   CDS_pept        458719..459315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0405"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: slt:Slit_1321
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54449"
FT                   /db_xref="GOA:D9SJV0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV0"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ADL54449.1"
FT                   /translation="MNDMQTIVKVWDVPVRLFHWSLVLSFSAAYLTAGYRLGFLHIWIG
FT                   YFLCVLLLTRIVWGFAGNQYARFRAFVFSRAETISYLRAMLQGHPKPYLGHNPAGALMV
FT                   FALLGTLSLVFMSGLVTLAVIDFEGPVLYLANYVDDETSYMIRHVHEWLVNIALVLIPL
FT                   HLLGVLVGSIQHKENLVHAMITGKKCIASASRAPE"
FT   gene            459325..459903
FT                   /locus_tag="Galf_0406"
FT   CDS_pept        459325..459903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_1322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54450"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV1"
FT                   /inference="similar to AA sequence:KEGG:Slit_1322"
FT                   /protein_id="ADL54450.1"
FT                   /translation="MTLALRVNKLLAGMLLALLAGTGSAAELDLSLPASTYRPDTKFMG
FT                   ESTAEKTEADKDAQKFEPDLLSGSKLHQYLGVGTMVMAGMTFITHKHPVPGSNAPRDMS
FT                   GAHARYAKATVAMAAATVATGLLTHWDDFSLEDGWSDPDNLHVLLALSGAALMAYAVNK
FT                   SMHSSTPTSHAGMAELGAVGMGLAIKLTW"
FT   sig_peptide     459325..459402
FT                   /locus_tag="Galf_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 26"
FT   gene            459915..460316
FT                   /locus_tag="Galf_0407"
FT   CDS_pept        459915..460316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0407"
FT                   /product="Domain of unknown function DUF1924"
FT                   /note="PFAM: Domain of unknown function DUF1924; KEGG:
FT                   slt:Slit_1323 domain of unknown function DUF1924"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54451"
FT                   /db_xref="GOA:D9SJV2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV2"
FT                   /inference="protein motif:PFAM:PF09086"
FT                   /protein_id="ADL54451.1"
FT                   /translation="MNYLYALILSGLLALSPVASATPASDALLASYKAAGVIKADAATG
FT                   KANWTKETRDADGEMMSCSTCHGTDFSKSGKHHKTQKVIEPMSPRVNAERFTDEKKVEK
FT                   WFKRNCKDAWGRECTAQEKADFLTFFLAQ"
FT   sig_peptide     459915..459980
FT                   /locus_tag="Galf_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 22"
FT   gene            460330..460878
FT                   /locus_tag="Galf_0408"
FT   CDS_pept        460330..460878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0408"
FT                   /product="Dihaem cytochrome c"
FT                   /note="PFAM: Dihaem cytochrome c; KEGG: slt:Slit_1324
FT                   diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54452"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV3"
FT                   /inference="protein motif:PFAM:PF09626"
FT                   /protein_id="ADL54452.1"
FT                   /translation="MKMQFISAALLAVCISQAAVAEESLLWALMTPLRQKELVPVENKL
FT                   YKQECGACHFAYQPGLLPGKSWQKLLTHEALLDHFGEDADLDQEALKEIYDYALANAAE
FT                   KSYHKRSRKIAISTAEGEPPLRITEVRYIKRKHHDIPDKMIKGNKKVKSLSNCNACHTE
FT                   AAEGVFDEDAVSIPNYPKY"
FT   sig_peptide     460330..460395
FT                   /locus_tag="Galf_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            461037..462131
FT                   /locus_tag="Galf_0409"
FT   CDS_pept        461037..462131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0409"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: slt:Slit_2672 ATPase-like, ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54453"
FT                   /db_xref="GOA:D9SJV4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV4"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADL54453.1"
FT                   /translation="MSFSDMDVQSALKNLIDPNTHRDFVTGKSVKNIKISGCDVSLDIL
FT                   LGYPAKSVWDEIRVMVETQLKAVLPGVGKVSVTVTSKVVPHAVQRGVKLVDGVKNIIAV
FT                   ASGKGGVGKSTTAVNLALALAAEGARVGMLDADIYGPSQPMMLGISGQPVSRDGQSMEP
FT                   MINHDIQSMSIGYMIAGDDAPMIWRGPMVTQALDQLLRQTRWDNLDYLVVDLPPGTGDI
FT                   QLTLSQKVPVTGAVIVTTPQDIALLDARKGLKMFEKVGIKIIGIVENMSTHICSKCGHE
FT                   EHIFGAGGGEKMCADYDTEFLGGLPLDISIREQADSGVPTVVADPDGSIAKVYKQIARR
FT                   VAVKVAEMAQDHSAAFPKIVVQNT"
FT   gene            462244..462810
FT                   /locus_tag="Galf_0410"
FT   CDS_pept        462244..462810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0410"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="manually curated; TIGRFAM: deoxycytidine
FT                   triphosphate deaminase; KEGG: slt:Slit_2543 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54454"
FT                   /db_xref="GOA:D9SJV5"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV5"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADL54454.1"
FT                   /translation="MSIKSDKWIRRMAEQHGMIEPFEPNQVKEVDGKRIVSYGTSSYGY
FT                   DIRCSNEFKLFTNINSTIVDPKNFDPNSFVEVTADYCIIPPNSFALARTVEYFRIPRSV
FT                   LTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYANEGIAQVLFFESD
FT                   EECETSYKDRGGKYQGQVGVTLPKM"
FT   gene            462810..463037
FT                   /locus_tag="Galf_0411"
FT   CDS_pept        462810..463037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54455"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV6"
FT                   /inference="similar to AA sequence:KEGG:Slit_2542"
FT                   /protein_id="ADL54455.1"
FT                   /translation="MPLSQIKPIIWRSPKGEVVACVEKNKVMSENLQEIRQICQDALDD
FT                   AVLMGVDSKQVRQVLTGLIAELVDSYSPQD"
FT   gene            463273..463398
FT                   /locus_tag="Galf_0412"
FT   CDS_pept        463273..463398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54456"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54456.1"
FT                   /translation="MKFRFSSGVAEGNAFTETLSLPRLTNYSQFYFYSSLARSRS"
FT   gene            463395..465641
FT                   /locus_tag="Galf_0413"
FT   CDS_pept        463395..465641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0413"
FT                   /product="Lysine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /note="KEGG: slt:Slit_2541 lysine decarboxylase; PFAM:
FT                   Orn/Lys/Arg decarboxylase major region; Orn/Lys/Arg
FT                   decarboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54457"
FT                   /db_xref="GOA:D9SJV8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV8"
FT                   /inference="protein motif:PRIAM:4.1.1.18"
FT                   /protein_id="ADL54457.1"
FT                   /translation="MKFRFPIIIIDEDFRSENASGLGIRALADALVKEGMEVLGVTSYG
FT                   DLTSFAQQQSRASAFLLSIDDEEFGGGSAEETEVALKSLRAFVEEIRFKNEDIPIYLYG
FT                   ETRTSRHIPNDVLRELHGFIHMHEDTPEFVARHIIREARSYLDSLAPPFFRALLHYAQD
FT                   GSYSWHCPGHSGGVAFLKSPVGQMFHQFFGENMLRADVCNAVDELGQLLDHTGPVAASE
FT                   RNAARIFNSDHLFFVTNGTSTSNKIVWHSTVAPDDIVVVDRNCHKSILHSIMMTGAVPV
FT                   FLTPTRNHYGIIGPIPKSEFEPESIQRKIDANPFIKDKTKKPRILTITQSTYDGIVYNV
FT                   EMLKEMLDGRIDTLHFDEAWLPHAAFHDFYKDMHAIGKDRPQARESMIFATQSTHKLLA
FT                   GLSQASQILIREPQNRKLNKYIFNEAYLMHTSTSPQYAIIASCDVAAAMMEAPGGPALV
FT                   DESIAEALDFRRAMRKVDEEFGLDWWFQVWGPDVIAEEGVGSREDWVLKASDKWHGFGD
FT                   LAEGFNMLDPIKATIITPGLDVDGDFSDNGIPASMVTKYLAEHGVIVEKCGLYSFFIMF
FT                   TIGITKGRWNTLLTALQQFKDDYDKNQPLWRILPEFAAKYPRYERTGLRDLCQQIHDAY
FT                   KLHNVARMTTEMYLSDMQPAMKPSDAFARMAHEELDRVEIDDLEGRITAVLLTPYPPGI
FT                   PLLIPGEMFNKTIIDYLKFARDFSQKLPGFETDIHGLVAEEVDGVKRYFVDCVR"
FT   gene            465819..466022
FT                   /locus_tag="Galf_0414"
FT   CDS_pept        465819..466022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0414"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: azo:azo1134 cold-shock protein; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54458"
FT                   /db_xref="GOA:D9SJV9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJV9"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADL54458.1"
FT                   /translation="MATGTVKWFNDAKGFGFVTPDDGSEDLFAHFSAINMNGFKTLQEG
FT                   QKVSFEVTQGPKGKQASNIQAA"
FT   gene            466092..466586
FT                   /locus_tag="Galf_0415"
FT   CDS_pept        466092..466586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0415"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dar:Daro_1132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54459"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW0"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADL54459.1"
FT                   /translation="MTGLAQLHSDIDVRVHTILEGHADWLCGKGCDGCCRRLAEIPQLT
FT                   CAEWALLREGLAALSAERLQEIRGNMLAIRCQQDRPLTCPLLDRSNGTCPVYHQRPVAC
FT                   RTYGFYVQRDKGLYCHDIELQVDEGRLPSVVWGNHDAIDQRLAGLGESRSLSDWFEMDA
FT                   I"
FT   gene            complement(466629..466868)
FT                   /locus_tag="Galf_0416"
FT   CDS_pept        complement(466629..466868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54460"
FT                   /db_xref="GOA:D9SJW1"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW1"
FT                   /inference="similar to AA sequence:KEGG:Slit_0072"
FT                   /protein_id="ADL54460.1"
FT                   /translation="MFALPSIANLIISTLVFFIAAWYINRYLDEQGIPTGMTRSLLVFT
FT                   LASLVSWGSGEVVDWLNGTPPAPTDLSNLLKRTN"
FT   gene            complement(466868..468790)
FT                   /locus_tag="Galf_0417"
FT   CDS_pept        complement(466868..468790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0417"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; Peptidase U32, collagenase;
FT                   KEGG: slt:Slit_2532 peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54461"
FT                   /db_xref="GOA:D9SJW2"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW2"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADL54461.1"
FT                   /translation="MNTLELLAPAKNADIGREAILHGADAVYIGGPSFGARHNAGNSMA
FT                   DIAKLVGHAHKYNAQIFVTLNTMLHDAELEEARQLVVNCYEAGVDALIVQDMGLLELDL
FT                   PPIALHASTQCDIRTPQKAKFLSDAGFSQIVLARELNLKEIAAIRAAVPTDTLIEHFIH
FT                   GALCVAYSGQCYISHAHTGRSANRGDCSQACRLPYTLEDDKGRIVAFDKHLLSVKDNNQ
FT                   SDNLRALIDAGVRSFKIEGRYKDMSYVKNITGHYRRLFDEILNESPELVASSSGKTKLL
FT                   FTPDPDKTFHRGATDYFTNGRRDDIGAFDAPSFVGTQLGTITAVGADWFDLETDETLAN
FT                   SDGLNYLNNRDIVGLQANIVKPQTEGVWRIWPNEPISQLAGLRKGIAVNRNRDHSWEQV
FT                   LTKKSAERRIEIRAHFSDSKDGFSLTLQDEDGVKATATIPCDKQAALHRDEAENALREQ
FT                   LARFGSSDFVLKELDVNWSKPWFVPSSLANRLRRDAVEKLEAARHLAYARPARKTARDA
FT                   IYPDEALTYLANVNNHSAHAFYTRHGVKLIESAYEAHEEKDEVSLMITRHCLRFSLSLC
FT                   PKQAKGVIGVQGKVRADPMTLVNGSERLTLKFDCRACEMHVMGKIKKHILKSVPVTFHP
FT                   RGVKR"
FT   gene            complement(468787..469272)
FT                   /locus_tag="Galf_0418"
FT   CDS_pept        complement(468787..469272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0418"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="KEGG: slt:Slit_2522 dihydrofolate reductase; PFAM:
FT                   dihydrofolate reductase region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54462"
FT                   /db_xref="GOA:D9SJW3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW3"
FT                   /inference="protein motif:PRIAM:1.5.1.3"
FT                   /protein_id="ADL54462.1"
FT                   /translation="MSPCIVVAMAKNRTIGVNNTLPWRCPEDLKHFKTLTMGHHMIMGR
FT                   KTFDSIGKPLPGRTTVVVTRDRNLKIDGCLIAHSLPEALAACSDEPVFIVGGAEIYAQA
FT                   LPLADTLYITEIQQDVAGDAHFPNFDPSAWQEVAREIRTQELPQPLEYHFVTYRRAT"
FT   gene            complement(469269..470063)
FT                   /locus_tag="Galf_0419"
FT   CDS_pept        complement(469269..470063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0419"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="TIGRFAM: thymidylate synthase; KEGG: slt:Slit_2520
FT                   thymidylate synthase; PFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54463"
FT                   /db_xref="GOA:D9SJW4"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW4"
FT                   /inference="protein motif:TFAM:TIGR03284"
FT                   /protein_id="ADL54463.1"
FT                   /translation="MRTYLNLMQHVLDNGTKKSDRTGTGTVSVFGYQMRFDLAQGFPLV
FT                   TTKKCHMKSIIHELLWFLQGYTNIGYLKEHGVKIWDEWADEHGDLGPVYGHQWRSWEAV
FT                   DGRVIDQIKIAVDQLKNNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVSEGKLSCQL
FT                   YQRSADIFLGVPFNIASYALLTLMMAQVCNLEPGDFVHTFGDAHLYLNHLEQTQLQLSR
FT                   EPHPLPMMHINPDVKDIFSFKYEDFTLTGYDPHPAIKGKVAV"
FT   gene            470231..471664
FT                   /locus_tag="Galf_0420"
FT   CDS_pept        470231..471664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0420"
FT                   /product="peptidase M17 leucyl aminopeptidase domain
FT                   protein"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: slt:Slit_2519 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54464"
FT                   /db_xref="GOA:D9SJW5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW5"
FT                   /inference="protein motif:PFAM:PF00883"
FT                   /protein_id="ADL54464.1"
FT                   /translation="MLAQLNVSPTLPAASHLLVLAPKSKKIPDGLPHAEQLKAVLARRD
FT                   MKVAELAKSPVAASLPDGTLIVWVMLDFEKDTFALQVQVRKALQLLLEEHPKQIAIVVT
FT                   GEESECRRSAELALYVAWTNGAPLPVHKKKDDSKPLKQIVLHGFTGSFDAIRAQAEGNL
FT                   LCRTLTVTPPNELTPAIYRRHIAKLAVEHGWKCEEYDMKALRKMGAGAFVAVAQGSEVE
FT                   DAAIVHLSYRHSKAKKTVALVGKGICFDTGGHNLKPSRYMHNMHEDMNGSAVALGILLG
FT                   ATQQKLPVNIDCYLAIAQNHISAKAYKQNDIVVALNGTTIEVIHTDAEGRMVLADTLTL
FT                   ASREKPDLMIDFATLTGSMVEAVGNRYSGVLGNSDALLARAVSVGRETGERLCAFPMDE
FT                   DYEAELESKFADIKQCTLEGGADHILAMRFLNRFVEKNTPWLHVDLSAVRCEEGLGAVG
FT                   TDVTGFGVSWGLKMVSGEW"
FT   gene            complement(471688..472077)
FT                   /locus_tag="Galf_0421"
FT   CDS_pept        complement(471688..472077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0421"
FT                   /product="putative inner membrane protein"
FT                   /note="KEGG: slt:Slit_2516 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54465"
FT                   /db_xref="GOA:D9SJW6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW6"
FT                   /inference="similar to AA sequence:KEGG:Slit_2516"
FT                   /protein_id="ADL54465.1"
FT                   /translation="MTETASLISLFASSFLGATLLPGGSEAVLFAVLKAYPDSLWTALL
FT                   IATFGNTLGGMVSFYMGWLLPQTQQLKHVEKVRRFGTPVLLLAWLPLLGDALCLAAGWL
FT                   RLCWWQAALFMAIGKFARYWIIAQI"
FT   sig_peptide     complement(471994..472077)
FT                   /locus_tag="Galf_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.799 at
FT                   residue 28"
FT   gene            complement(472087..473748)
FT                   /locus_tag="Galf_0422"
FT   CDS_pept        complement(472087..473748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0422"
FT                   /product="SEC-C motif domain protein"
FT                   /note="KEGG: pnu:Pnuc_1096 sulfotransferase; manually
FT                   curated; PFAM: SEC-C motif domain protein;
FT                   Tetratricopeptide TPR_1 repeat-containing protein;
FT                   sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54466"
FT                   /db_xref="GOA:D9SJW7"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW7"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADL54466.1"
FT                   /translation="MTPKFGRNDPCPCASGKKYKRCCQSSEQTAPAPRPPSETDVSASI
FT                   QTALAHHQAGHLAHAEAIYTQIIQNSPRHPDALHYLGMLASQTDRGEMAVTLIRKAIHI
FT                   APSHLMHFNLATELRRQTRFEEAAESFRNALALKADFFEAYYSLGQLLQDMGEHAEAEA
FT                   CIRKAADLSPEYADVYVALASIYNDLGNFDASRSALTSALSIQPQHPAAWAMLSQTRKM
FT                   TLEDQAWLNTALSLIETQTMSLDQQTELLFAVGKYYDDTRQFDLAFPAYQQANELKKKI
FT                   DGSFDRARFTQFIDAIINAYGAPEQMQDREGASQSERPVFIVGMPRSGTSLIEQIIASH
FT                   PAAYGAGELEFWSQYGLSNEYATLKNLNKTQIAKLAQAYEQLIRQCDPLAARVIDKMPS
FT                   NFCWVGLIKTVFPHAKFIHAQRNPADICLSIYFQNFKFRHPYAADLNDLAYYYDEYSRL
FT                   MAHWTSALPTDSLLAVSYEELVSAPDTWIPKIIEFIGLDWDERCLNFHRTERKVATLSN
FT                   WSVRQKLYLSSKQRWRNYQSHIAPLLGLLDSDPSGK"
FT   gene            complement(473824..474588)
FT                   /locus_tag="Galf_0423"
FT   CDS_pept        complement(473824..474588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54467"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW8"
FT                   /inference="similar to AA sequence:KEGG:Slit_2508"
FT                   /protein_id="ADL54467.1"
FT                   /translation="MKLRYLPFITFALLCSSAQAFDLGGLKDQLKAATAQPAPATPAAN
FT                   PAGLTGISKTDQVGSLKQALTQGAETAVASLAKENGFLGNDKVRIPLPASLQKADSLMR
FT                   TLGMGKYADELTTSMNRAAEAAVPEAKTLLVGAVKNMSVADAKGILMGGNDSATQYFRK
FT                   NTEAALTGKFKPIVNKSMQKVKFAEKYDQFAGQGAKLGVVDPQDAKLDDYITRKAMDGL
FT                   FLMMAEQEKAIRANPMQAAGSLAQKVFSAIKF"
FT   sig_peptide     complement(474526..474588)
FT                   /locus_tag="Galf_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(474591..476351)
FT                   /locus_tag="Galf_0424"
FT   CDS_pept        complement(474591..476351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0424"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: slt:Slit_2507 dihydrolipoamide dehydrogenase;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; biotin/lipoyl
FT                   attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54468"
FT                   /db_xref="GOA:D9SJW9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJW9"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADL54468.1"
FT                   /translation="MSQTIEVKVPDIGDFKDIAIIEVSVKTGDTVTAEQSLITLETDKA
FT                   AMEVPSPAAGVVKELKVKVGDKVSKGSMVLVLEVPDSGIKIQYDADPKPDAGARSQDAA
FT                   TSEPRIPNPQSSDIHAEVVVLGAGPGGYTAAFRAADLGKQVVMIEKHSSLGGVCLNVGC
FT                   IPSKALLHVAKVISEAEEVSHHGVTFGKPAIDIDAIRSWKESVVNKLTGGLKQLAKQRK
FT                   VQVVQGVAKFVSANSISVATPEGEKLITFDHAIIAAGSSVARIPGFPYDDPRIIDSTGA
FT                   LALQDVPKRLLILGGGIIGLEMATVYDALGSKISVVELMDQLIPGADKDMVKPLHTRIA
FT                   KRYEAIYLKTKVTKIESLPEGLRVTFEGEQAPEPQLYDRVLMAVGRRPNGREINAEAAG
FT                   LTVNDRGFIPVDKQQRTNVPHIFAIGDIVGDPMLAHKAVHEGKVAAENIAGHKAYFEPL
FT                   TIPSVAYTDPEIAWMGLTETQAKAQGIAYEKGAFPWAASGRALSVGREEGMTKVLLDPV
FT                   SRRILGAGIVGVNAGELIAEAVLALEMGADMEDIGLTIHPHPTLSETLCFAAEMAEGTI
FT                   TDLLPPRKRG"
FT   gene            complement(476369..477658)
FT                   /locus_tag="Galf_0425"
FT   CDS_pept        complement(476369..477658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0425"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   slt:Slit_2506 gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54469"
FT                   /db_xref="GOA:D9SJX0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX0"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADL54469.1"
FT                   /translation="MRHPSGMKDIMENIQAYMQQVGIAARTASRTLAQADTSAKNRALG
FT                   EIATTLLEQSALILTANSRDVATARAAGLDEASIDRLTLTEKTIRAMSEGLLQIAQLPD
FT                   LIGAITDLNFRPSGIQVGKMRVPLGVIGIIYESRPNVTADAAGLCIKSGNAAILRGGSE
FT                   AIHSNQAIAACVHAGLKAAGLPESAVQVVATTDRAAVGELITMKEYVDVIVPRGGKSLI
FT                   ARISADAKVPVIKHLDGICHVYIDDEADLDKAIRIADNAKTHRYGVCNAMETLLVAEGV
FT                   AAQVLPPLCKLYLEKGVELRGDAACCALVPHMTLAVEEDWHTEYLAPILSVKIVTGMDE
FT                   AINHIATYSSQHTDTIVTENYSRAMRFLREVDSSSVMVNASTRFADGFEYGLGAEIGIS
FT                   TDKIHARGPVGLEGLTSQKYIVLGSGQIRV"
FT   gene            477711..478499
FT                   /locus_tag="Galf_0426"
FT   CDS_pept        477711..478499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0426"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: slt:Slit_2505 indole-3-glycerol-phosphate
FT                   synthase; PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54470"
FT                   /db_xref="GOA:D9SJX1"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX1"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADL54470.1"
FT                   /translation="MSDILNKILAVKAQEVAAARAIKPLELLRSEAEHVAPARDFVAAV
FT                   RAKIAAGKSAVIAEIKKASPSKGVLRADFNPAAIAVSYEAHGAACLSVLTDAQFFQGCP
FT                   EYLKLARAACHLPVLRKDFIVDEYQIYQARAMGADAILLIAAALDLATMQAFEALAHRL
FT                   GMAVLVEVHNSIELDAALQLTTPLIGVNNRNLRTFEVSLQNTLDLLPRIGSDRIVVTES
FT                   GILNSTDVALMRANKVDCYLVGEAFMRADNPGEELEKVFL"
FT   gene            478511..478744
FT                   /locus_tag="Galf_0427"
FT   CDS_pept        478511..478744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54471"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54471.1"
FT                   /translation="MLVVKKQHFVKLLLQMREWGCGHFFFGHNPFQKFASSDFLFSREH
FT                   VLPVKTHYLRSFYAKENYRSGYRRSNLSASIC"
FT   gene            478683..479750
FT                   /locus_tag="Galf_0428"
FT   CDS_pept        478683..479750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0428"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: slt:Slit_2478
FT                   porin gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54472"
FT                   /db_xref="GOA:D9SJX3"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX3"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADL54472.1"
FT                   /translation="MQKKIIALAIAAAISAPAFADTSNVTVYGLLNADFEGVTSNNVGA
FT                   GVSNSLNRVSSNATRLGLKGSENLGGNLKSIWQLEIQADLNGNAGNGFGNGTRNSNVGL
FT                   TGDFGTAFIGIWDTPYKVSHNKVELFDNTTFASAINVLGRTGSAGVNFNNRLKNSVQYW
FT                   TPNLSGFQAKVAYGTDNVQTTTLNQSVASLSATYENDMFYAAYGYETFKDATLATNAAT
FT                   AGNKSSGNRLVGAYKFDNGLVGLTYENLTGTTAGVSASRNAWELAGKYTMGASNIGLSY
FT                   VNAGNLGATVNSGSNQLSLRYGYNFSKRTELYGMYSALKNDANANYNLSGGTAVVGSVA
FT                   GAKLSGFGVGMVHSF"
FT   sig_peptide     478683..478745
FT                   /locus_tag="Galf_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            479876..480502
FT                   /locus_tag="Galf_0429"
FT   CDS_pept        479876..480502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0429"
FT                   /product="Ubiquinone biosynthesis family protein"
FT                   /note="PFAM: Ubiquinone biosynthesis family protein; KEGG:
FT                   slt:Slit_2474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54473"
FT                   /db_xref="GOA:D9SJX4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX4"
FT                   /inference="protein motif:PFAM:PF03232"
FT                   /protein_id="ADL54473.1"
FT                   /translation="MLNLDRFIVEFDKGLRTLFSRAHSARPYPDADVMEASMSDSEKSQ
FT                   AAALMRVNHSGEICAQALYQGQAMTARDPLVQQKLQHAAEEETEHLAWTAHRVHELGGH
FT                   LSVLNPFWYTASLSIGAFAGLLGDKWNLGFLSETEQQVGSHLQSHLAKLPVQDEKSRAI
FT                   VAQMYTDEIGHAEMAVELGGAPLPKPVQMLMKLNGKVMTGAAYHI"
FT   gene            480582..480941
FT                   /locus_tag="Galf_0430"
FT   CDS_pept        480582..480941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0430"
FT                   /product="S23 ribosomal protein"
FT                   /note="KEGG: slt:Slit_2521 S23 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54474"
FT                   /db_xref="GOA:D9SJX5"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX5"
FT                   /inference="similar to AA sequence:KEGG:Slit_2521"
FT                   /protein_id="ADL54474.1"
FT                   /translation="MKYSELIVWQKAMDLVTEIYKVTATFPVEERFGLSSQIRRAAVSV
FT                   PSNIAEGHGRKSTASYLNFLSIAFGSLMELETQIQIAVRLDFIREDAAVVLLSNTDEIG
FT                   KMLSGLKRSLAEKIK"
FT   gene            481145..482410
FT                   /locus_tag="Galf_0431"
FT   CDS_pept        481145..482410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54475"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX6"
FT                   /inference="similar to AA sequence:KEGG:Slit_0264"
FT                   /protein_id="ADL54475.1"
FT                   /translation="MKKIVLSIAAVMAAAAFAPEASAVPVFARQTGMACSACHFQHFPL
FT                   LNGFGRAFKSAGFTMMGAQGKVEGEHLDIPANLNFGILTTTGTESVSGATGNLKGGNSA
FT                   WFVPASGGELSMFYGGRIAEFAGFLSEMGLGKTAGTGAAKLALMFPVGDARVGVVAHTS
FT                   NGQGVAYSFETLNTGAVNTHKMTALNGNFAAGASSNPNGGHTGVYSASQYLRTNTAATG
FT                   LSLVASNPNLGFINVGKYDIAGVGTSTAGSLPLTYVRVAGLMEAGGFDMGAGIQSFSGA
FT                   SQLLGEVKATVIDFQAQGEVSGLGLGVYASYGTAPAIIGSLNALNANNAVTRSTFNIGA
FT                   ELGVIPGIATVQLAFRNANSGAVDAVGAKLTDNAIQVGATYELAQNIELSLTHSAQSGT
FT                   AWSTLAAPVGKTVTSLMMEALF"
FT   sig_peptide     481145..481216
FT                   /locus_tag="Galf_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.745 at
FT                   residue 24"
FT   gene            482565..482681
FT                   /locus_tag="Galf_0432"
FT   CDS_pept        482565..482681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54476"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL54476.1"
FT                   /translation="MSMIRRNFDQDRLEEYAMLHYRAAYSEAVINIQTIEFM"
FT   gene            482879..483970
FT                   /locus_tag="Galf_0433"
FT   CDS_pept        482879..483970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0433"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: slt:Slit_0624 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54477"
FT                   /db_xref="GOA:D9SJX8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX8"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADL54477.1"
FT                   /translation="MSSVSQLVQTLIRPEIQALSAYHVPDCTGLIKLDAMENPYLVPQS
FT                   LQDEIAQLVGAAHINRYPDPDPRELKEKIAQLLGLTDGMSVLLGNGSDELIQLLAMAVN
FT                   KPGAVLLSVEPSFVMYKMIATFVGMRYVGVPLADDYSLDFPATLAAIRREQPALVFLAY
FT                   PNNPTGNLFAKDQVREIIEASPGLVVIDEAYYAFASDSFVPQLAQYPNLLVMRTFSKLG
FT                   MAGLRLGFLVGSSQWLAQLEKLRLPYNVGVLPQLVAQKLLDNHDVLLRQAEQIKKDRVA
FT                   LHQALAAIKGVAVFDSEANFLLFRIANATGVFNGLKERGVLIKNLNGGHPMLTDCLRVT
FT                   VGTPEQNALFIAALQHCLQSTVD"
FT   gene            484042..484629
FT                   /locus_tag="Galf_0434"
FT   CDS_pept        484042..484629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0434"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="KEGG: slt:Slit_0625 imidazoleglycerol-phosphate
FT                   dehydratase; PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54478"
FT                   /db_xref="GOA:D9SJX9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJX9"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADL54478.1"
FT                   /translation="MRSAKVTRNTLETQISVELNLDGTGQSSFETGLPFLDHMLDQIAR
FT                   HGLLDITVVARGDLHIDAHHTVEDLGITLGQAFSRAVGDKKGLTRYGHAYVPLDEALSR
FT                   VVLDLSGRPGLVFNCEFVRGTIGEFDVDLFHEFFQGFVNHALVTLHIDNLTGANAHHQA
FT                   ETIFKAFGRALRMAIEVDPRMAGMMPSTKGCL"
FT   gene            484632..485267
FT                   /locus_tag="Galf_0435"
FT   CDS_pept        484632..485267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0435"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="KEGG: slt:Slit_0626 imidazole glycerol phosphate
FT                   synthase, glutamine amidotransferase subunit; TIGRFAM:
FT                   imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54479"
FT                   /db_xref="GOA:D9SJY0"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJY0"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADL54479.1"
FT                   /translation="MVDVAIVDYGMGNLRSVEQALRHVAPTGDIVVTDDAAVIAQAGRV
FT                   VFPGQGAMPDCMRELDARGLRNAVVDAAQTKPFLGICIGLQMLFEHSAEGDVPGLGVLT
FT                   GDVLRFAGGMQDAEGNKLKVPHMGWNQVRHHTDHPLWNGIAQDARFYYVHSYYVKPQDQ
FT                   SLIQATSDYPEPFVCAVARSNLFGVQFHPEKSQAAGLKLLQNFIHWNP"
FT   gene            485286..486032
FT                   /locus_tag="Galf_0436"
FT   CDS_pept        485286..486032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0436"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; KEGG: slt:Slit_0627
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54480"
FT                   /db_xref="GOA:D9SJY1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D9SJY1"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADL54480.1"
FT                   /translation="MLIIPAIDLKDGHCVRLKQGLMEESTVFSEDPAATAQHWLDQGAR
FT                   RLHLVDLNGAFAGKPKNEAAVRSIIASVGSDVPVQLGGGIRDLETIERYLDLGVTYIIV
FT                   GTAAVKVPGFLHEACDAFPGHIMVGLDAKGGKVAVNGWSKLTGHDVADLAKRFEDYGVE
FT                   AIIYTDIGRDGMLSGVNIEATVELARPLHVPVIASGGITNLDDVRKLCAVQGEGITGAI
FT                   TGRAIYEGTLDFRAAQALADELTPRL"
FT   gene            486032..486790
FT                   /locus_tag="Galf_0437"
FT   CDS_pept        486032..486790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0437"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="KEGG: slt:Slit_0628 imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; TIGRFAM: imidazoleglycerol
FT                   phosphate synthase, cyclase subunit; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54481"
FT                   /db_xref="GOA:D9SC16"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC16"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADL54481.1"
FT                   /translation="MLAKRIIPCLDVTRGRVVKGVSFVELRDAGDPVEIAKRYDEQGAD
FT                   ELTFLDITASSDDRGIIFRIIEQVASQVFIPLTVGGGVREVSDVRNLLNAGADKVSINT
FT                   SAVLNPQLVADAASRYGSQCIVVAIDAKQVEPGRWEVFTHGGRKATGLDVVEWAAKMQQ
FT                   LGAGEILLTSMDRDGQKKGFDLALTRLVTNALEIPVIASGGVGNLQHLADGVTQGGADA
FT                   VLAASIFHFGEYTVQQAKQFMATQGIEVRL"
FT   gene            486787..487206
FT                   /locus_tag="Galf_0438"
FT   CDS_pept        486787..487206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0438"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="KEGG: slt:Slit_0629 phosphoribosyl-AMP
FT                   cyclohydrolase; PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54482"
FT                   /db_xref="GOA:D9SC17"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC17"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ADL54482.1"
FT                   /translation="MKPGMQDTEQKNEPWLKRINWSDDGLIPAIAQDALTGRVLMVAWM
FT                   NREALLLTWQKSEAVYWSRSRRKLWHKGEESGHIQKVKEIRLDCDSDVILLQIEQQGGI
FT                   ACHTGRESCFFTRLEQGEWCEVDEVLKSPDEIYKK"
FT   gene            487203..487520
FT                   /locus_tag="Galf_0439"
FT   CDS_pept        487203..487520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0439"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="KEGG: slt:Slit_0630 phosphoribosyl-ATP
FT                   diphosphatase; TIGRFAM: phosphoribosyl-ATP diphosphatase;
FT                   PFAM: Phosphoribosyl-ATP pyrophosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54483"
FT                   /db_xref="GOA:D9SC18"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC18"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADL54483.1"
FT                   /translation="MTILQTLTQTIESRKLASPDSSYVAKLFSKGEDAILKKIGEEATE
FT                   TILASKEGDKAHIVYETADLWFHCMVMLSHHGLSADDVLTELARREGLSGITEKNSRGG
FT                   A"
FT   gene            487517..487864
FT                   /locus_tag="Galf_0440"
FT   CDS_pept        487517..487864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0440"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   slt:Slit_0631 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54484"
FT                   /db_xref="GOA:D9SC19"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC19"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADL54484.1"
FT                   /translation="MSDCLFCKIARGEIPCRKVFEDDDVLAFHDINPAAPVHFLLIPKP
FT                   HLNSLAEAEPRHAAMLGKLLLLAPKLAKEQGLDDGFRTVINTGRGGGQEVFHLHVHVIG
FT                   GGNIPPMVKRS"
FT   gene            487883..488104
FT                   /locus_tag="Galf_0441"
FT   CDS_pept        487883..488104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0441"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="KEGG: slt:Slit_0632 twin-arginine translocation
FT                   protein, TatA/E family subunit; TIGRFAM: twin-arginine
FT                   translocation protein, TatA/E family subunit; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54485"
FT                   /db_xref="GOA:D9SC20"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC20"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ADL54485.1"
FT                   /translation="MGSMSLWHWLIVLVVVMLVFGTKKLRNIGSDLGGAVKGFKEGMGT
FT                   PAEEPAKQIKEDGQTIEGEVKSKTHSNL"
FT   gene            488111..488443
FT                   /locus_tag="Galf_0442"
FT   CDS_pept        488111..488443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0442"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="KEGG: slt:Slit_0633 twin-arginine translocation
FT                   protein, TatB subunit; TIGRFAM: twin-arginine translocation
FT                   protein, TatB subunit; PFAM: sec-independent translocation
FT                   protein mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54486"
FT                   /db_xref="GOA:D9SC21"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC21"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ADL54486.1"
FT                   /translation="MFDFSFAELMVVMVVALVVIGPERLPKVARTLGHLYGRAQRYVNG
FT                   VKADISRDMAMDEYRQLQQKVQAEAAALQQSMQQAGQAVDAGVQEINQSVASPLPVKST
FT                   KALPES"
FT   gene            488443..489186
FT                   /locus_tag="Galf_0443"
FT   CDS_pept        488443..489186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0443"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="KEGG: slt:Slit_0634 sec-independent protein
FT                   translocase, TatC subunit; TIGRFAM: Sec-independent protein
FT                   translocase, TatC subunit; PFAM: Sec-independent
FT                   periplasmic protein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54487"
FT                   /db_xref="GOA:D9SC22"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC22"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ADL54487.1"
FT                   /translation="MSSSESFISHLIELRKRLMNAGIALLLVFICLFPWASDLYALLAQ
FT                   PLLAKLPKGGQMIATDVTTPFFVPLKVALMASFLIALPYILYQVWRFVAPGLYEHEKRM
FT                   IVPLIFASTVLFFCGMSFAYFVVFPVVFGFVTAAAPIGVAVMTDIDKYLSFVLSMFMAF
FT                   GITFQVPVAVVLLVRMGVVSVAKLREIRPYIIVGAFVIGAIFTPPDVVSQLMLALPLWL
FT                   LYEAGIVVASWTRPVEKPVQLGSRF"
FT   sig_peptide     488443..488553
FT                   /locus_tag="Galf_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.906 at
FT                   residue 37"
FT   gene            489191..490447
FT                   /locus_tag="Galf_0444"
FT   CDS_pept        489191..490447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0444"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mei:Msip34_0332 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54488"
FT                   /db_xref="GOA:D9SC23"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC23"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADL54488.1"
FT                   /translation="MTVTPNLLIELIAHSESVNLVWQLGVIAAIMLLAWWFDALFLKNL
FT                   LAAKTVQTVAIRGVKRIVFPLLNLFGVLIAREVFRYLDAPFVLLKLAIPLFLSLAFIRL
FT                   LVYVLHKVFSNSSKLRSWERTIAMLAWLGVALHVTGLLDAVLAGMDSLSFNAGHQHISL
FT                   LIILQGLISIAATVLVALWLGRFLETRIMDMQEMESSSRVLLAKVVRGALLILSVLVAL
FT                   SLVGIDIRVLSVFGGALGVGLGFGLQRIASNYICGFIILLDKSIRLGDVITLDNRTGTV
FT                   ARLTGRYMVLSGQDGAEFLIPNEMAITQALGNHSYTDRKIRIKISLQVAYNTPLERAMD
FT                   IMVEAARQQEHVMSDPAPTVNLIDFADNGILLELLVWLDAPEVSQAMLRSKINMEIWRE
FT                   FQKSGIEIPFPQREVRIKP"
FT   gene            complement(490450..491601)
FT                   /locus_tag="Galf_0445"
FT   CDS_pept        complement(490450..491601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0445"
FT                   /product="HtrA2 peptidase"
FT                   /EC_number="3.4.21.108"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: slt:Slit_0635 HtrA2
FT                   peptidase; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54489"
FT                   /db_xref="GOA:D9SC24"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC24"
FT                   /inference="protein motif:PRIAM:3.4.21.108"
FT                   /protein_id="ADL54489.1"
FT                   /translation="MRKHWLLFTQTVTIALALLFIVHTLKPELLPSAARNGVVTLYESG
FT                   SPAADGSAPLKGMSIAAKKAMPSVVNIFTSTTIKTPVNPFLDDPRFRFFFGDQDSTPQQ
FT                   SSSLGSGVIVSSDGFILTNHHVVEAADQIEVALADGRKARAHVIGSDPETDLAVIKVEL
FT                   PGGLPAVTFGHPETVHIGDMVLAIGNPFGVGQTVTMGIISALKRDHLGLNTFENFIQTD
FT                   AAINPGNSGGALVDSNGNLIGINSAIYSPNGGSLGIGFAIPATTAKKTMEQIIQNGSVT
FT                   RGWIGAGIQELTPALVESFKLPDANGVLITEVIRNSPAEQSGIKTADILLSIDNHAIDN
FT                   WSAMLDTVANLPPGTIATIQLLRDGHPVTTKVKIGKRPKPRPQ"
FT   gene            491645..492391
FT                   /locus_tag="Galf_0446"
FT   CDS_pept        491645..492391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0446"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   slt:Slit_0636 protein of unknown function DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54490"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC25"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ADL54490.1"
FT                   /translation="MNLYQLVDYNASVLQTAQFKDYSPNGLQVEGRGEVRRIATAVTAS
FT                   KQVIDESIAWGADAILVHHGYFWRNEAPCIVGVKKQRIAELLKHDVSLLAYHLPLDAHA
FT                   ELGNNARLAAALGLREQGRFGEQNIACYGALDVSQSLADFALGIESALQRAPLVIGHAG
FT                   KMLHRAAWCSGGGQGYFEAAIAQGVDVFVTGEISEQSYHLSRETGVAFISAGHHASERL
FT                   GIQALGEHLASRFDLEHRFFDQANPV"
FT   gene            complement(492388..493014)
FT                   /locus_tag="Galf_0447"
FT   CDS_pept        complement(492388..493014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54491"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC26"
FT                   /inference="similar to AA sequence:KEGG:Slit_0638"
FT                   /protein_id="ADL54491.1"
FT                   /translation="MNEEQAVLDFFAKPENLPLGLSVAEQMDEIRTRMNTSFWDQLCLR
FT                   LENRLAATPWQALTTEDRNAAGVLVGLQCKLRIEQTQSLFPMMEQQFLGGIWRVFFGLM
FT                   WQSTPTVEQLALPAVAALKQQLLDAGFKQNEAFMAWQWTPHYPLRRDFLQRFSLQPEVL
FT                   LDETEAILAPLLISYSSAIAAANASLQNLPRSMTISLDQLRRKRD"
FT   gene            493313..494002
FT                   /locus_tag="Galf_0448"
FT   CDS_pept        493313..494002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54492"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC27"
FT                   /inference="similar to AA sequence:KEGG:Slit_0640"
FT                   /protein_id="ADL54492.1"
FT                   /translation="MYRFLRFPILLVGLFLGASSFAANNSQPVLTTEDSLGPQVEQPIE
FT                   FPHNRHAGLKDASDPAKGGMEINCQYCHTYARRSAVAGIPPLQKCIGCHQNIESVRNKP
FT                   RIVELFKYWDAKKAVPWKKVHDLPDFVRFNHERHIKRFVEQQDRPVQEACGYCHGDVKE
FT                   MTVARRQKTLAMGWCASCHEKDHPVVAEGGTPIAGQAYWYSFQKPAAAMDANTKARGPN
FT                   DCWQCHK"
FT   sig_peptide     493313..493381
FT                   /locus_tag="Galf_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.763 at
FT                   residue 23"
FT   gene            494042..496267
FT                   /locus_tag="Galf_0449"
FT   CDS_pept        494042..496267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0449"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: slt:Slit_0641 molybdopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54493"
FT                   /db_xref="GOA:D9SC28"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC28"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADL54493.1"
FT                   /translation="MIDSGSVKQMAGHPFDRRDFLKVLGWSGAAVALSGCGNTSVEDGR
FT                   ETVVSYVEANDYMVPGIGVYFNSTCAQCDAGCSVNGRVREGRVLKLEGNPDSAINKGKL
FT                   CGLGQAGVQHHYNPDRVREPLLRNGNKGEAISWDKAYALIAEKLAGVQGEEIAFLSGGV
FT                   SGHLKVLLGNYLDSLGTKNHFVYEAIAPSVVRAANVKAFGVEMPRYRFDKAQVVLSFGA
FT                   DFLGSWVSPVHFSQQYAQFRKGVNGQRGVLIQVESKMTLTGANADRWLAVKPGTEGVLA
FT                   LGIINALGMATGDVAELVKGYDKARVSRETGVSTGQIDKIAALLKLRSPSLVLAGSAAE
FT                   GYAHGSQNAAAINLLNQVLGNVGKTIEAPVSVPFPQMAPSKGNTVALKNLNDGLAAGKY
FT                   KVVFNFAANPVFTAPGAFKFKDNFAKAGFKVAFAHYLDETALQADLVLPLDSALEDWGT
FT                   QVPEYLTEGAQINIQQPLMERLHADTRGMGDILLSLIKQKKADEYKGFEDYYAYLRGAV
FT                   LQNKGALGGGGVEDDTFWNDTLTNGIVKLAGTTTSLAAHASAAGLLLPAEAEADEHFPL
FT                   HLIPGVTASLRDGRHTNQPWLQESPDPLTTIVWDSWVEIHPKKAAELGIVEGDIVEVTS
FT                   KTGSVKAQVYLFPGIHPEAISIPVGRGHDAMGRYAKGYGVNPFQIMDAVFEAATGELAM
FT                   HETRVKISKTGQRVLVVKDEGAAGALQMGRKIAARVSTDQVDLSKEV"
FT   gene            496271..497125
FT                   /locus_tag="Galf_0450"
FT   CDS_pept        496271..497125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0450"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: slt:Slit_0642 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54494"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC29"
FT                   /inference="similar to AA sequence:KEGG:Slit_0642"
FT                   /protein_id="ADL54494.1"
FT                   /translation="MSVSNLLENWAQVRHEHPNNDKPHDPYKWAMAIDLDACTGCNACS
FT                   VACYAENNLPVVGREKFQHGQQMHWLRVERYWDEDGREFPDQGFQFLPMMCQQCEAAPC
FT                   ETVCPVAATNHTADGLNSQIYNRCIGSRYCSANCPFKVRYFNWYDYPTTDNVWPAEMQQ
FT                   QLNPDVSVRGKGVMEKCTFCVQRLSAAKVKAKGEGRIVAEGEVQTACQQACPTSAISFG
FT                   NIVNPESRVHKQWAAQQVELAKDKQDKNEGEAPSELRGYRILEELRAYPSVMYLERVRE
FT                   SAV"
FT   gene            497163..498527
FT                   /locus_tag="Galf_0451"
FT   CDS_pept        497163..498527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0451"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   slt:Slit_0643 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54495"
FT                   /db_xref="GOA:D9SC30"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC30"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ADL54495.1"
FT                   /translation="MRDIREDIAWAKINQDVMKSLENPRKMYWVILFLALMAFGFGVGC
FT                   EIYQYQTGMGVANLNNPQVWGLYIATFIFWIGMSHSGTLLSAILHLMHADWRKPIYRFA
FT                   EAMTTFSLMTAGLFVMVHIGRLWMFYYALPYPNDRGIWPNFQSPLLWDAMAIFTYLSSS
FT                   VLFLFVGMIPDLAIARDNMQPGWRQKLYTLLALGWEGTDRQWRNFRVTYLTIACFLIPL
FT                   AVSVHSIVASDFAMSQQPGWHVTSFPPYFVAGALYSGCAAIITLFIILRYVFKFEEYMT
FT                   KPILKKIVRLTFAIAMVWTYLNAVEFASVWYSHDGVSKDVLIQKMTGNYAPFWWGMIFC
FT                   GSVVPLVFAFKRFQTNIPVLFATSLLLNLGMWLERWMIVAPTFSHGYYPWTWDHEQWPS
FT                   MVQWGMVFGSFGWFTLLFLLFCKVFPSVSMYEVKEMVYHRTLHLKKSENAEQGAH"
FT   gene            498530..499060
FT                   /locus_tag="Galf_0452"
FT   CDS_pept        498530..499060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0452"
FT                   /product="Protein of unknown function DUF3341"
FT                   /note="PFAM: Protein of unknown function DUF3341; KEGG:
FT                   slt:Slit_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54496"
FT                   /db_xref="GOA:D9SC31"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC31"
FT                   /inference="protein motif:PFAM:PF11821"
FT                   /protein_id="ADL54496.1"
FT                   /translation="MSKRHLLALYGNFEEAEAVVQELRNATIKGFDVNDDMIVKSPIEH
FT                   PEVERFLGDKPVYVQWFTLIGALLGGIFGFFLISGAQANFYMQLKGGKPIVPFPPNFVL
FT                   TYEMFILGGVFITILGFLICAGLPAKRSPLYSTKVSVDNIAILVEADESAISELKAIFT
FT                   KHKALEIQEEAGK"
FT   gene            499057..499611
FT                   /locus_tag="Galf_0453"
FT   CDS_pept        499057..499611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0453"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: slt:Slit_0645
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54497"
FT                   /db_xref="GOA:D9SC32"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC32"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADL54497.1"
FT                   /translation="MKKLSLAITLLLAPTFAQAWPWSQDMVNQVSIKPQESVDAANPGM
FT                   AQFPKRSQPVAGTTVNVKDLDAAKKMANPIAADEASVAKGRRLYEIYCTPCHGKSGAGD
FT                   GLVGTKLPYKPWNLTSSNDVHPWDSKDYPDGYIFGVMSLGLAVMPSYANDLTATERWHV
FT                   VNYIRKVMQKGPAVTAAAQSK"
FT   sig_peptide     499057..499116
FT                   /locus_tag="Galf_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            499623..500636
FT                   /locus_tag="Galf_0454"
FT   CDS_pept        499623..500636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54498"
FT                   /db_xref="GOA:D9SC33"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC33"
FT                   /inference="similar to AA sequence:KEGG:Slit_0646"
FT                   /protein_id="ADL54498.1"
FT                   /translation="MLAYSNWAVLTVCFVVVLSLALSGVALCSVLHLVGAQWRFNVRHL
FT                   AVSLYALFPLAFVLLVVLLVGGSHTFPWWDVPVGHEAHMPGWYQPHWLMSREVVGMIFM
FT                   AALYWVFIQRQAVSENSPEDAKRFHTVATWIPFFFVLYSTMVAWDFEMTLVPHWHSAIY
FT                   GLQQFISNFGMFLAFMTVWIYFMNTKGKLVTPVPDKIYNYMAQMMLSFTLLWIYTFDAQ
FT                   YLTIWYGNLADETDRVFAMQDGDYAFIWWSMIVLKFVVPFVTFCFPGPRHNVTAINAVA
FT                   ICIIIGTLFERYVWIGGVTGTGNYPIVASIVIGGTVALIGYFLVRSYMQSRSLIKG"
FT   gene            500647..501240
FT                   /locus_tag="Galf_0455"
FT   CDS_pept        500647..501240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0455"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dar:Daro_0812 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54499"
FT                   /db_xref="GOA:D9SC34"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC34"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ADL54499.1"
FT                   /translation="MRLYSGTVCPYSHRCRIVLFEKGMDFEVIDVDLMDKSEDLAAISP
FT                   GGKVPVLVERDLVLTEANIINEYIDERFPHPQLMPADPVMRGRARLFLFRFEQELYSNV
FT                   NIIMQGGKTADKARASIRDNLTQLSQILTKQKYLLGNDFSMLDVSVAPLLWRLDHYGIV
FT                   LGKDAAPMLKYAERLFSRQGFIDSLTPAERAMRK"
FT   gene            501237..501623
FT                   /locus_tag="Galf_0456"
FT   CDS_pept        501237..501623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0456"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   slt:Slit_0648 stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54500"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC35"
FT                   /inference="protein motif:PFAM:PF04386"
FT                   /protein_id="ADL54500.1"
FT                   /translation="MSDLSTRPYLIRAIHEWCVDSGLTPYLAVRVNGRTEVPVAYVKDG
FT                   EIVLNLSAGAVRNMELGNDWITCSGRFGGSSFDLIVPVDAVIGIFAKETGQGLVFQGSG
FT                   SDSPPPGEAEIKSLPRKPQLSIVK"
FT   gene            complement(501674..502528)
FT                   /locus_tag="Galf_0457"
FT   CDS_pept        complement(501674..502528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0457"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: slt:Slit_0649 RNA polymerase, sigma 32
FT                   subunit, RpoH; TIGRFAM: RNA polymerase sigma factor RpoH;
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54501"
FT                   /db_xref="GOA:D9SC36"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC36"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ADL54501.1"
FT                   /translation="MNIANSLPMPSALGSLDSYIHLVRRYAVLSQEEEFDLATRFRNDN
FT                   DLDAARQLVLSHLRVVVSVARGYAGYGLPQADLIQEGNIGLMKAVKHYDPEFGVRLVSF
FT                   ALHWIRAEINEFVVRNWRMVKIATTKAQRKLFFNLRSLKQGLESLKPKQISEIAEQLNV
FT                   SEHDVIEMEARFAGHEVALDPAGSDDDDTYAPIQYLADSEEHEPSNILESSEGLSLRTQ
FT                   GLARALASLDDRSRRIVEARWLSEDQNATLHDLAAEFKVSAERIRQIEQKAMSKMHTFL
FT                   SAN"
FT   gene            complement(502678..502863)
FT                   /locus_tag="Galf_0458"
FT   CDS_pept        complement(502678..502863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54502"
FT                   /db_xref="GOA:D9SC37"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC37"
FT                   /inference="similar to AA sequence:KEGG:Slit_2376"
FT                   /protein_id="ADL54502.1"
FT                   /translation="MENSKCKVLILPFMIAAALWLIGGFFLSKELGMICVIFGIAIAGW
FT                   AAGNIMNSDCELSEEK"
FT   gene            complement(502971..503876)
FT                   /locus_tag="Galf_0459"
FT   CDS_pept        complement(502971..503876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0459"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   slt:Slit_2371 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54503"
FT                   /db_xref="GOA:D9SC38"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC38"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL54503.1"
FT                   /translation="MNTLSTQRGVIRTAFGRMFVSPLAGIVNILVIGIALSLPTGMYVL
FT                   LKNAQGLVAQLSGSPQISLFLTMDATPYSEEQIRRQLNDHPNIKAVEFISQTDALNALG
FT                   EETGLTDVIAGLDKNPLPDAFVVSPRSSNAKLLDELRNELQKIQGVDLAQLDSAWAYKL
FT                   EAFLEFAHIAVLVLASLLSLGLIAITFNTIRLQIVTQRDEIQVAKLIGATDAFIRRPFL
FT                   YFGAIQGLLGGIAAWLIVLSSLHLLKQPLANLSLLYGSNFALEPLSAADSASLLLFSLY
FT                   LGWLGAWLSVARHLSLIESR"
FT   gene            complement(503873..504574)
FT                   /locus_tag="Galf_0460"
FT   CDS_pept        complement(503873..504574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0460"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; KEGG: slt:Slit_2370 cell
FT                   division ATP-binding protein FtsE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54504"
FT                   /db_xref="GOA:D9SC39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC39"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ADL54504.1"
FT                   /translation="MITFDQVSKRYPGGIDVLKNVSFELAKGEMAYLSGHSGAGKSTLL
FT                   KLIAAIERPNSGTVLVNNQNVSKLKSDALPYLRRNFGLIFQDHKLLFDRNVFDNVLLPL
FT                   QICGFEHKESAKRVRAALDKVGLLNREKSNPIALSGGEQQRLCIARAIVNRPSILLADE
FT                   PTGNLDAEYAEEIMNIFNSFHQVGVTLLISTHDAALLRETNLRIIELKQGAIQPHSRYA
FT                   ADLHETQGVSA"
FT   gene            complement(504571..505536)
FT                   /locus_tag="Galf_0461"
FT   CDS_pept        complement(504571..505536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0461"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: slt:Slit_2369 signal recognition
FT                   particle-docking protein FtsY; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54505"
FT                   /db_xref="GOA:D9SC40"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC40"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADL54505.1"
FT                   /translation="MFSFLKKSTPAKAEETVAEKRSWIDRLKAGLSRTGNQLADLFSRG
FT                   GKIDDDLYEELETILITADVGMDATNTLLADLRRHVREHKLVEAEELKAGLAHCLLKLL
FT                   GPLAVPLHAETHKPFVIMMVGVNGAGKTTSIGKLAKYLQSQGLSVMLAAGDTFRAAARE
FT                   QLMTWGERNNVTVIAQQSGDAAAVIYDAVQAAQARKIDVVLADTAGRLTTQAHLMEEIK
FT                   KVKRVIAKVLPDAPHEVLLVLDANTGQNALSQVKAFDAALGVTGLILTKLDGTAKGGVI
FT                   AAIAKAHPIPVRFIGVGEGLDDLRPFDAQEFIDALLGLSA"
FT   gene            505642..507000
FT                   /locus_tag="Galf_0462"
FT   CDS_pept        505642..507000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0462"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   slt:Slit_2368 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54506"
FT                   /db_xref="GOA:D9SC41"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC41"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADL54506.1"
FT                   /translation="MRNFLFGVALLATGLQPAVGAEVFEKTLANGLKVIVREDHRAPVL
FT                   VQQIWYKAGSMDELTGKTGVAHVLEHLMFKGTKSVPAGEFSRRIAAAGGRENAFTSNDY
FT                   TAYFQQLHKSKLPLAMKLEADRMHNLDLSAAEFAKEIKVVMEERRMRTDDEPHALLQEK
FT                   MTAAVYVEHPYQHPVIGWMSDLEQMTVADARDWYKKWYAPNNATLVVAGDVAAPAVFAL
FT                   AERYYGSIPKQLQPPRRVYTEPVQLGIKRMVVKAPAELPLLVMSFHAPNIIDPKQDWKP
FT                   YALEMLAGVLSGNDSARLNKHLVREQQVASSVAAGYDSASRGPGVFTLEATPSEGRSIV
FT                   QMEAALRAEIEQLIKDGVSAEELQRVRAQVLAGEVYKLDSVFYQAMQIGQMESIGLGYR
FT                   SIPVMLEKLQAVTAEQVSEVAREFLQDDNLTVAVLDPQPLSGKPKQTGALHVH"
FT   sig_peptide     505642..505704
FT                   /locus_tag="Galf_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.826 at
FT                   residue 21"
FT   gene            506990..508312
FT                   /locus_tag="Galf_0463"
FT   CDS_pept        506990..508312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0463"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: slt:Slit_2367 peptidase M16 domain protein;
FT                   PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54507"
FT                   /db_xref="GOA:D9SC42"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC42"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADL54507.1"
FT                   /translation="MFIKNLICAVALCCAISMVQATPVIQYWQSASGAKVLFVENHDIP
FT                   MLDVAVSLSAGSRFDTVAKGGVAGLVHGLLDLGSEGMTEDAISSGMADIGAQLAGGLDQ
FT                   DRASVTLRTLSQPFERERALSIMARVLQHPVFPEAILAREKARLIAALKEAETKPESIA
FT                   GRAFQKAIYGAHPYALQVSGEIASVEKITVQDLQDFYRAHYAAGQAVVAIMGDVTRAEA
FT                   DAIAQQLTGELPAGVEPSAQPQVEMQIQASELRIPHPATQSHILIGAPGMSRSDPDYFP
FT                   LYVGNYILGGGGFVSRLMNEVREKRGLAYSVYSYFMPLKQQGAFQIGLQTKKAQADDAL
FT                   KLVRKTLSDFVAKGPTEKELLAAKQNIVGGFPLRIDSNKKILEYLSVIGFYDLPLSYLD
FT                   DFTGRVERVTARQIHEAFARHIQPERMATVIVGAPEGVDHQ"
FT   sig_peptide     506990..507055
FT                   /locus_tag="Galf_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            508278..508841
FT                   /locus_tag="Galf_0464"
FT   CDS_pept        508278..508841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0464"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="TIGRFAM: methyltransferase; KEGG: slt:Slit_2366
FT                   methyltransferase; PFAM: Conserved hypothetical protein
FT                   CHP00095"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54508"
FT                   /db_xref="GOA:D9SC43"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC43"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADL54508.1"
FT                   /translation="MSERRKESIINKVRIGGGELRSRVITFPDADGLRPTPDRVRETLF
FT                   NWLGQTLYGRRCLDLFAGSGALGFEAASRGAEHVLMLEKSLPVFRALQNNSDKLACANV
FT                   SLRHQDGLEFVRRDTACYDVIFLDPPFASDFLPRLLQVLPPRLTASGVVYVESGGAIDV
FT                   PLPWQVIKSGKAGQVWYQLIGLNT"
FT   gene            508838..509320
FT                   /locus_tag="Galf_0465"
FT   CDS_pept        508838..509320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0465"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; KEGG:
FT                   slt:Slit_2365 pantetheine-phosphate adenylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54509"
FT                   /db_xref="GOA:D9SC44"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC44"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ADL54509.1"
FT                   /translation="MIKVVYPGTFDPITSGHEDVVRRATGLFGEVIVAVAKSRANTLFT
FT                   LEERVEMAREVFSNYDNVRVEGFDGLLMSFVQSQQSRVVLRGLRAASDFEYEFQLAGMN
FT                   RNLYPEMETLFLTPAEQYTFISATMVREVARFGGDVGKFVSPSVAVRLQQKNGIVL"
FT   gene            509366..509620
FT                   /locus_tag="Galf_0466"
FT   CDS_pept        509366..509620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0466"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: slt:Slit_2364 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54510"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC45"
FT                   /inference="similar to AA sequence:KEGG:Slit_2364"
FT                   /protein_id="ADL54510.1"
FT                   /translation="MALLITDECINCDVCEPECPNDAISQGDTIYEIDPNKCTECVGHY
FT                   DTPQCVEVCPVDCIPKDPAHVENNAQLQAKYEKLMAAKR"
FT   gene            complement(509667..509981)
FT                   /locus_tag="Galf_0467"
FT   CDS_pept        complement(509667..509981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0467"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   gem:GM21_2508 protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54511"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC46"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ADL54511.1"
FT                   /translation="MPLFDKQVPPFYRWEGDTLILNVLGRPNSKQDAIGRVIGHQLEVY
FT                   AAAVPRRGGATAHMVQYLASIFSVPEHAITVVFGEKNVNKQLRIESPGKLPSVIQRAKK
FT                   "
FT   gene            complement(509981..510808)
FT                   /locus_tag="Galf_0468"
FT   CDS_pept        complement(509981..510808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0468"
FT                   /product="phosphoesterase"
FT                   /note="PFAM: phosphoesterase; KEGG: slt:Slit_2927
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54512"
FT                   /db_xref="GOA:D9SC47"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC47"
FT                   /inference="protein motif:PFAM:PF04185"
FT                   /protein_id="ADL54512.1"
FT                   /translation="MKRRSLFVLLLLTATATQAENLPRPDHVVVVIEENRGYSQIMAPL
FT                   KGDSYIHALARRGMLFTQSYAVAHPSQPNYLALFSGSTQGSRDDACPMSYAGENIASSL
FT                   INHKLSFSSFSESLPSAGSTVCWAGGYQRKHNPAANWQDNRLPPSVNLTFNDFPQDYSQ
FT                   LPTLSFVIPDQRNDMHDGSYFTADEWLKKHIDPYVTWAFKHNSLLILTWDEDNGSEGNR
FT                   IVTLLVGPMVKTGTSAQRINHYNVLRTLLDFYDLPAFNASLDAEPIKGVWLKR"
FT   sig_peptide     complement(510749..510808)
FT                   /locus_tag="Galf_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 20"
FT   gene            complement(510805..512352)
FT                   /locus_tag="Galf_0469"
FT   CDS_pept        complement(510805..512352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0469"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   Hemerythrin HHE cation binding domain protein; KEGG:
FT                   pat:Patl_2248 response regulator receiver modulated metal
FT                   dependent phosphohydrolase; SMART: metal-dependent
FT                   phosphohydrolase HD region; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54513"
FT                   /db_xref="GOA:D9SC48"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC48"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADL54513.1"
FT                   /translation="MNKEEGMLAISKLVFELTITSTTTADLDILLQRLFSILDSYYDLQ
FT                   LEARGAILLLNPRGRYFQVAQFGMDPAWTNKMRWDAPAFTRPHISAHCLLQDSLPSLEL
FT                   PTPAHMLLLPLHIEGKGLGYTVLFVPENYLMSETHCEFMEDLARALSSLVNRALTNEIL
FT                   RIRKLELEESRADVIRSLGVASEYRDNETGLHIMRMTNFAQAIAKSLGIPDAQRELLYI
FT                   AAPMHDVGKIGIADAVLLKPGKLTPEEFTIMKTHTDIGVTILEGKDELIAAARDIAGCH
FT                   HERWDGNGYPNGLVAEQIPLLARICAVADVFDALTSSRPYKTAWTVEDAYNWVISESGK
FT                   HFDPAVVAAFDAAMPDILRIRELYRDDIIDPKQVLTLPPIRRRENAWIPWDEKLSIGID
FT                   VIDEHHRYLFDLINDLYEVVANKRGAREVARLIKSLDAYAKIHFRAEEQMMNHYAYTRI
FT                   DRQLSQHHAFEEKIAEFYEELHDNPFVAQFDALAYLREWLIHHILVEDIQLVELTRK"
FT   gene            complement(512423..513253)
FT                   /locus_tag="Galf_0470"
FT   CDS_pept        complement(512423..513253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0470"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; KEGG:
FT                   slt:Slit_2362 formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54514"
FT                   /db_xref="GOA:D9SC49"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC49"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ADL54514.1"
FT                   /translation="MPELPEVETTRRGLAPYLADATVTGVVTRTPSLRWPIPENLNELL
FT                   NGQPVVSLSRRAKYLLLEFRHGTLILHLGMSGSLRILPTGTAPQPHDHFDLLLDNGCLM
FT                   RLRDPRRFGAVLWHQGNINTHPLLVKLGPEPLDDRDGNCRFNAHYLYQATRGRRVAIKQ
FT                   FIMDSAIVVGVGNIYASEALFSAGINPLSKAGELSFAHCEKLADVIRSTLNEAILAGGS
FT                   TLRDFVNASGNPGYFQQQHWVYSRAGEPCRICSAPIMQIKQGQRSSFYCTHCQK"
FT   gene            complement(513246..514601)
FT                   /locus_tag="Galf_0471"
FT   CDS_pept        complement(513246..514601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0471"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterized transport system;
FT                   KEGG: slt:Slit_2361 ABC-type uncharacterized transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54515"
FT                   /db_xref="GOA:D9SC50"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC50"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADL54515.1"
FT                   /translation="MLNKIMNSIALRNLLFVLLLLGIAVGLGYAASRHPLQRDITFNAS
FT                   NSLEPASINALNQLQGPVNITVYATLQDARLGDIRKVIRDFLSLYQRYKPDIKLVFIDP
FT                   EKEPARTRAARIQLNGEMVIEYAGRSEHLTLINEQTLTSTLMRLAHSRDQTVMYLDGHG
FT                   ERKLDGRANHDLGLLFGAKLKENGFKLNSLNLAIAQDVPSNIRVLVITQPQVDLMAGEI
FT                   DKLLHFIDRGGNLLWLVDAGPLHGLERLAEKIGLQLPAGIVIDPAAADMNAPATWSLGT
FT                   SYVPHAITSNFNLITAYPSARPLTWAENPDWQHHILLEVATRGWISQRDINALSGSPAF
FT                   DKQHDSKGPAVIALALNRNINDVEQRIVAVGNGAFLSNTFAGNGGNVDLGVNMINWLAN
FT                   DDTLISLQPRAARDSSIILSRTQLTAISSGLLLILPLLLAGVGTAIWWRRRA"
FT   sig_peptide     complement(514509..514601)
FT                   /locus_tag="Galf_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.913 at
FT                   residue 31"
FT   gene            complement(514605..515348)
FT                   /locus_tag="Galf_0472"
FT   CDS_pept        complement(514605..515348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0472"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /note="KEGG: slt:Slit_2360 putative ABC-2 type transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54516"
FT                   /db_xref="GOA:D9SC51"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC51"
FT                   /inference="similar to AA sequence:KEGG:Slit_2360"
FT                   /protein_id="ADL54516.1"
FT                   /translation="MIRLIAMREIRSLLSMPSTWFVLAVLQFILAWFFLARLEAFLEIQ
FT                   PQLAQLANPPGVTLTVAAPLFNTAALLLMMLVPMLTMRMIAEERRNQTLTLLLSSPLSG
FT                   RHIVLGKFLGLLTFLLTLLATLPLMLYTLALGTHLDHGLLLANCMGLTLLTASFIALGL
FT                   YLSALTAQPIIAAAGALIILMGLWLADIGSSAADSIWHQFSPMFHFQNFNAGLLDSADA
FT                   AFFVLFTSVFLLLTMKRLHNNRVYG"
FT   gene            complement(515345..516325)
FT                   /locus_tag="Galf_0473"
FT   CDS_pept        complement(515345..516325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0473"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: mfa:Mfla_0682 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54517"
FT                   /db_xref="GOA:D9SC52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC52"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54517.1"
FT                   /translation="MPQITLRARNLTRCFGKQQIIHDLSLELKRGEVLGLLGHNGAGKS
FT                   TTLQMLTGCLLPGSGEIDICGFDLRKTPVQAKAHIGYLPETPPLYRELCVEDFLTFAAR
FT                   LRGVKTADLTLALSQACLRCGLESVRKKIISTLSKGYQQRVGIAQAIIHSPAVIVLDEP
FT                   TVGLDPSQIRDIRNLIRELGNTSSVILSTHLLGEVESVCDRVEILHHGRLIYSDSSRQM
FT                   QEYGQATGFIITLRQPPVLSELSAIPGITSVEPLTDNQFRILHAPEDNPTSLVLSLAAS
FT                   HGWQLEQLTPLHETLEDVFVKITRNETTDATPTPSTSTERTEAII"
FT   gene            516384..518141
FT                   /locus_tag="Galf_0474"
FT   CDS_pept        516384..518141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0474"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: slt:Slit_2357 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54518"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC53"
FT                   /inference="similar to AA sequence:KEGG:Slit_2357"
FT                   /protein_id="ADL54518.1"
FT                   /translation="MCTRIKNCLAMSPFKHLILASLVLAGCAQTPVAPVAASAPDAAAP
FT                   EAVAAIEPVLPNVELSSELLYEFLLAEFASQRGHQALAVEGSQELARLTRDPRLAKRAA
FT                   QLALESGDMNRAVEAFRFWQETEPSALMATRILSSLLLRGGRLDEARIEFVKVLKSEEP
FT                   AVGAVFMQLYTMAASYPDKAAVLQLMRELAAPYPQVAEAHWLVAQLATAALEEKLALSE
FT                   VRRARELKPEWDAPVSLEAQLLNKSEPQKSLALLQRHLSVHPAAGGIRLQYARALLTQK
FT                   QYQAAREEFQLLATASPDNVDLAFAIALISLQLNDLSGAELQFKAALLKGGKTQDVIEY
FT                   FLGQLSEAREDEAEALTHYRGVTQGEYQLTAQLRMVYLLNKQGRLDDARAQLQQAQAVT
FT                   PAQRVQVLVIEAQLLSEAKRSTEAYRVLEQGMVKLPDQPDLLYEAAMLADKLGKFDVSE
FT                   KYLRRLIKLKPDHAHAYNALGYSLLERNVRIKEALALVERALQLTPDDFAIMDSVGWGY
FT                   YRSGKLDESVAMLQRAFAGNPDPEIAAHLGEVLWIRGDRAEAAKVWQDSLKAHPDNAPL
FT                   QAVMKRYMP"
FT   gene            518156..518689
FT                   /locus_tag="Galf_0475"
FT   CDS_pept        518156..518689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0475"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="KEGG: slt:Slit_2356 outer membrane lipoprotein LolB;
FT                   TIGRFAM: outer membrane lipoprotein LolB; PFAM: outer
FT                   membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54519"
FT                   /db_xref="GOA:D9SC54"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC54"
FT                   /inference="protein motif:TFAM:TIGR00548"
FT                   /protein_id="ADL54519.1"
FT                   /translation="MALLLTGCATMPPLSRPVQPEAVPFAMNGRISVKHNGARDSAGLR
FT                   WTHQDTSDEILLLTPLGQTAARIYRDDAHATLDNGDKHYSDTDVESLMQQVLGWRLQLD
FT                   HLHHWVLGLTVPGDEMLERDTLGRLTVLRQDGWEVRYMAYSGDKADSLPVRMKLSRANL
FT                   ELILLIDECEWNPK"
FT   gene            518686..519519
FT                   /locus_tag="Galf_0476"
FT   CDS_pept        518686..519519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0476"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; KEGG: slt:Slit_2355
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54520"
FT                   /db_xref="GOA:D9SC55"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC55"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADL54520.1"
FT                   /translation="MKLTCPAPAKLNLFLHVTGRRADGMHLLQTLFRFIDLSDTLHFEL
FT                   RTDGVVHRTNFIEAVPEEQDLCVRAARLLQKNTGCTLGADITLEKCIPMGGGLGGGSSD
FT                   AATTLIALNRLWSLGLTRDQLMELGLELGADVPVFLFGENAFAEGVGEKLQAYELPEAW
FT                   YVVLFPPVHVPTAKIFSHPELTRDSVSIIIRALRTQPLRNDLQSVVCRLYPEVASYIET
FT                   LGKYGSAMMTGSGACVFAEFPDQAQAEAVLQKLPQTMRGVAVKGLMKHPLQDWVL"
FT   gene            519529..519603
FT                   /locus_tag="Galf_R0015"
FT                   /note="tRNA-Gln1"
FT   tRNA            519529..519603
FT                   /locus_tag="Galf_R0015"
FT                   /product="tRNA-Gln"
FT   gene            519655..520605
FT                   /locus_tag="Galf_0477"
FT   CDS_pept        519655..520605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0477"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   slt:Slit_2354 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54521"
FT                   /db_xref="GOA:D9SC56"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC56"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADL54521.1"
FT                   /translation="MSYDSLMVFTGNANPKLAEAVVQQLGITLGRATVDRFSDGEVMVE
FT                   LLENVRGKDVFILQSSCAPTNDNLMEIMVMADALKRASAGRITAAMPYFGYARQDRRPR
FT                   SARVAITAKLVADMLTSAGIDRVLTMDLHADQIQGFFDIPVDNIYASPILLADVWRQNY
FT                   PNLIVVSPDVGGVVRARALAKQLDADLAIIDKRRPRHNVAKVMNIIGEVNGRTCLIMDD
FT                   LVDTANTLCEAAKALKEKGAVRVLAYCTHAVLSGPAIERIENSAIDELVVTDTIPLSEA
FT                   AKNCGRIRQLSTAELMAETIRRINNEESVSSLFTE"
FT   gene            520705..521313
FT                   /locus_tag="Galf_0478"
FT   CDS_pept        520705..521313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0478"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: slt:Slit_2353 ribosomal 5S rRNA E-loop binding
FT                   protein Ctc/L25/TL5; TIGRFAM: ribosomal 5S rRNA E-loop
FT                   binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54522"
FT                   /db_xref="GOA:D9SC57"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC57"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADL54522.1"
FT                   /translation="MTTTFNATTRKTQGTGASRRLRKAGSVPGVVYGSGEAVMIEMNHN
FT                   ELYYKLRAESFHASVLTMNLDGKEEAVQLRAFVNHPFRQQVQHLDFQRVDLSKKIHIKV
FT                   PLHFINQDIAPAVKTGGGKISHVMIEAEISCLPADLPAFIEVDLGGMQLGHSVHLGELK
FT                   LPRGVELCAHGEHAAEAVVATVHVPRGSVEAAAEAEAAK"
FT   gene            521391..521969
FT                   /locus_tag="Galf_0479"
FT   CDS_pept        521391..521969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0479"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   slt:Slit_2352 peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54523"
FT                   /db_xref="GOA:D9SC58"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC58"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADL54523.1"
FT                   /translation="MDPIRLIVGLGNPGREYEATRHNVGFWWVDELAEEAELNFKSEAK
FT                   FHGLSARGLVLGRELILLKPQTFMNLSGRSVGALAQFYKIAPAQILVVHDELDLQPGIA
FT                   RLKLGGSHGGHNGLKDIIAQLGGREFWRLRLGIGHPGDRAQVSDFVLGHPREAERELML
FT                   EAQHQSMQVLPSVLDGKMEAAMLKLHSRK"
FT   gene            522073..522762
FT                   /locus_tag="Galf_0480"
FT   CDS_pept        522073..522762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0480"
FT                   /product="cellulose biosynthesis protein"
FT                   /note="KEGG: bav:BAV2626 cellulose biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54524"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC59"
FT                   /inference="similar to AA sequence:KEGG:BAV2626"
FT                   /protein_id="ADL54524.1"
FT                   /translation="MSSLLLAGLTVLVIGDSHLASDGYLISTLHDGLMQQGAKVYTYGA
FT                   CGTPSGAWMKSIQPPCGSAFRLDNGPLRVRAGVAGFTKPLPDLVNLHHPDLIVVVNGDT
FT                   MASYKAASLPKSWVRDEVKTLTDGIKASGASCIWVGPAWGTEGGDNGKNYARVKEVSDF
FT                   LADNVSPCIYVSSLAMSKPGEWAPIPVPNKPGHFDGQHFQSEGYQAWGNAITKVIVSSD
FT                   ILQKIKH"
FT   gene            complement(522922..523557)
FT                   /locus_tag="Galf_0481"
FT   CDS_pept        complement(522922..523557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0481"
FT                   /product="cellulose biosynthesis protein"
FT                   /note="manually curated; KEGG: bav:BAV2626 cellulose
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54525"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC60"
FT                   /inference="similar to AA sequence:KEGG:BAV2626"
FT                   /protein_id="ADL54525.1"
FT                   /translation="MLLNGLGILIVGGSHIVYPGTLVTSLNNDLLDKGAQVHSLGVCGI
FT                   TPSQLTKTSKGACGAAERVGAGPLNMKLGSKAETIPIAKLIETEKPGLVIIVMGDTLAD
FT                   YRNTAGMSTPWVNSEIEQVTKEINRTKVRCVWVGPSWGQEGHSGGKTYARVQQVSNLLS
FT                   QRVSPCTYIDSLKMSQKGEWSTLDGIHYRDQYYKIWADKIVDELDKIK"
FT   gene            complement(523564..524793)
FT                   /locus_tag="Galf_0482"
FT   CDS_pept        complement(523564..524793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0482"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: pin:Ping_2944 membrane bound O-acyl
FT                   transferase, MBOAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54526"
FT                   /db_xref="GOA:D9SC61"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC61"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /protein_id="ADL54526.1"
FT                   /translation="MLRKPEFQPLLFCAVSYATVITLKGWNTGIFTLMVGISALIFVEL
FT                   FTISSKLRKFIAYCIFFVTPFLTVVGQVGVLTGLGRSSVSLEWQGIAFATSGIAFQIFQ
FT                   GKLGFNHLFGSILQPLRLISGPLAISIKPFNQLNVTRIRIYLGWIILGGFFYGVLASGI
FT                   ASLLVFKQSTESFDILLFSIIFEMYVYFNFCGISLIVLGVLNLVGVRTALNFNAPFSAN
FT                   NLIGYWQRWHISFAHVLKNLFFKPCRNLIGTSLSVIVVFLASSMWHGVTLNFLIWGMFH
FT                   AIGWLLTYHLSYLKWDRVKQLLNIFLMTVFILVGRIIFSEDNTNLLFIKLGNLSNFKWN
FT                   TDALALNISLDIQTWLTISACVAVILLEIFASNKMFQYKILRKNWVLLFLLSLTVVYGS
FT                   NGLGSAYGNR"
FT   gene            complement(524857..528567)
FT                   /locus_tag="Galf_0483"
FT   CDS_pept        complement(524857..528567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0483"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: cellulose synthase operon C domain protein;
FT                   KEGG: reu:Reut_B3525 TPR repeat-containing cellulose
FT                   synthase operon C"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54527"
FT                   /db_xref="GOA:D9SC62"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC62"
FT                   /inference="protein motif:PFAM:PF05420"
FT                   /protein_id="ADL54527.1"
FT                   /translation="MPINLHALSMLLVLSGLISQPVLAAESSTDTLLRGAKKWVEKDRA
FT                   DIAKTMLKKAILLDPNSQEALYMMGRIELKDGKSDEATKYLHKLKQTAPGGKRTQELND
FT                   AIYGKVAPTLKAPTASFVKPAPSLQAPTTSFIKPAKPVTKLKVATTKEAQSKQVKQIKK
FT                   SKQTEPELSPKVDKIDADEAAVRLANDPDIIARTDALDALADGNIDQAETSLLDIIKRR
FT                   PNDPEVIGGLGLVHQKRGNFIESEKYFIQAVAAAQGEESEAGRWESLIGTARFSQYMTN
FT                   AKALLNENKLPEAEAAIEQAIALKPGDPDTLAVRGNIKTEENNFPEAERLYREALKIEG
FT                   YNSFATRGLANLLVRMGRSEEALSFIEQVLNDYPNEWRKSPYSQASLLREAGNLYIAAH
FT                   QPSYAVKAFEQAVSVDPKNPWVRFSLAKHYISLDLIPLARGVIQEGVNLSPDDPAMHQV
FT                   QALVLLSLDDYKGALDSLNQIPENQLTQDLRETKNSALIKYYSQQANEKIAQGNRKEAM
FT                   HIMSVAQTLAQGDYSATEQVAEAWFRLDQQKLGLAAMRALPQPAPLQTQVRFASLLNRA
FT                   KQDQDLEAYLPTLRIPEGNDDTSKKYRASIQEIEFAMAGRHYDKLIKAGKTVQAQQFAD
FT                   TIMNANQLSTSDYFRFHRSYFSKAQLPENAIAMLNQEKEQSPDDMNIRYELAHAYSQDK
FT                   QSSNSQREIQELLAMTKSDDIDMRLRIAGLQQSVGDSNGARLTVRDLTTRFPNNTDVLF
FT                   QAGNIARSSGKYNQAMRYYQKSKAQSLQPQATNDTVIVSEQGPLLNLLPKSQDKRATKP
FT                   IALVSNKESDSIYRSALAGDTNKAKPQTAGLSAVDEAMNSIAAQRSAKIEAGLDIQSKT
FT                   AGNGTSTYNSIEVPMLARFPIGYEAHGTVQVDKVSIDAGSLPATFNDAALFGKIHITQT
FT                   PLAAPLAQTASGTSIGLGYEQSGVKADIGLVGQGFPVRNVVGGIRTGGDFGGLSYSLSL
FT                   SRRPYTGSLLSYAGAKDPISGITWGGVTNTGLSLYMSTTLGDFNVSGMGSYGLLRGQNV
FT                   LNNSRLYLRAAIDTDIYTTDDSVLNIGLSASYTSFAKNQAFYTFGHGGYYSPQSSLSFS
FT                   LPVELSGRADLLSYQVRASVSYSRTREDAAVFYPTDAALQAQAALGPNFPPGNSQAIYQ
FT                   GGTGGGFGYGLLAATEYRLTPNFALGGRFTMDRSAYYAPNNLFFYGRYMFNPETGAVKM
FT                   RPEFVTPYAQY"
FT   sig_peptide     complement(528493..528567)
FT                   /locus_tag="Galf_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.656 at
FT                   residue 25"
FT   gene            complement(528558..529712)
FT                   /locus_tag="Galf_0484"
FT   CDS_pept        complement(528558..529712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0484"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="KEGG: yen:YE4072A endo-1,4-D-glucanase; PFAM:
FT                   glycoside hydrolase family 8"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54528"
FT                   /db_xref="GOA:D9SC63"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC63"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADL54528.1"
FT                   /translation="MSNSSIYLCGALRFAAFLLIFTLTSYAHAATCDTSWPEWDAFKKN
FT                   LINENGRVVDGSAKDSHTTSEGQSYALFFSLVANDKTTFEKLVNWTEKNLSKEDIITHL
FT                   PSWILGKKEDDSYGVLDTNSASDSDLWIAYTLGEAGRLWENRRYVALSSLLANRILKNE
FT                   TLDIPGLGTVLLPGAVGFTPTTTSVRLNPSYAPLQLIHWFNTHSNDPRWASLLSSSKEL
FT                   IVKSSIKGYAPDWTIYQYNKGFQPDTGNERAGLGSYDAIRVYLWAGMLNKDSPEYKNIM
FT                   AALKPMAKLVEKMGVPPEFVHVDSGDVHGQGSSGFSAAMVPFLMAEGYDKAAEQQLMRI
FT                   DAQPIAKDSYYDQVLILFALGWQKDLYRFDSKGNLAPRWKSKCQ"
FT   sig_peptide     complement(529623..529712)
FT                   /locus_tag="Galf_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.891 at
FT                   residue 30"
FT   gene            complement(530064..530780)
FT                   /locus_tag="Galf_0485"
FT   CDS_pept        complement(530064..530780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0485"
FT                   /product="cell morphology protein"
FT                   /note="KEGG: pst:PSPTO_1031 cell morphology protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54529"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC64"
FT                   /inference="similar to AA sequence:KEGG:PSPTO_1031"
FT                   /protein_id="ADL54529.1"
FT                   /translation="MSKLIISVALIALSANTCAAEERPLSGLNILVLGESHMSISNYLI
FT                   SNLPNELVEKGAKVFSYGACGASAGDWLKTKSVPCSASRVDVGTIRERPSDVATTQPIS
FT                   NLITKHQPNLILLIMGDTMASYDSNTIPKSWVWQTVSALTHEIKAQGMRCVWVGPPWGE
FT                   DGGKYKKTNARVREFSDYLSTIVAPCTYIDSLSFAKMGEWKTFDGEHFDKWGYESWSKS
FT                   ITNALITPEMLKTLKQ"
FT   sig_peptide     complement(530721..530780)
FT                   /locus_tag="Galf_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.620 at
FT                   residue 20"
FT   gene            complement(530934..532352)
FT                   /locus_tag="Galf_0486"
FT   CDS_pept        complement(530934..532352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_1671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54530"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC65"
FT                   /inference="similar to AA sequence:KEGG:Pmen_1671"
FT                   /protein_id="ADL54530.1"
FT                   /translation="MIKHLIGSNLSKCFLYSMAMLITYNVPCASAAEAPEQMVLVGRDG
FT                   WLYFSHEMTKAAVEKPGIATSLEIIGKFNRVLKRKGVTLTIAMVPLKVRIYPEHLPTGM
FT                   TLSNDTITNYDRALSILKADGVDVIDLNSAFLRHKPKNSSDLPLYYPLDTHWSPTGALL
FT                   AAETIAAAIENTPSLKEKINAIPPTKYKFTWLEASETPQVAASTFDLVKHLPKASQNFP
FT                   LRNDRQFRVSKQSSSESSLLGEVNKPDITLMGSSYSGAWTKFPAGLRYTLQRNILDISV
FT                   EAPHGSWYGMELYLRNEAFQTHRPKLLIWEMPERDLIAPPDYQYREARYQSDNDEWLLR
FT                   VGAQTETTCIPSATVAKLEKSSNAAGNSTALTNSTSNDFVQINLNRSLDKLDYLAANVS
FT                   TTGSGNLKLEAVGNGASRHFNAVVTNDGAPHAVKFPLTVGGQNVTKVRIFPGKAKGFAM
FT                   DSLVVCRQSFDPTK"
FT   gene            complement(532360..532737)
FT                   /locus_tag="Galf_0487"
FT   CDS_pept        complement(532360..532737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54531"
FT                   /db_xref="GOA:D9SC66"
FT                   /db_xref="InterPro:IPR035422"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC66"
FT                   /inference="similar to AA sequence:KEGG:Trad_2831"
FT                   /protein_id="ADL54531.1"
FT                   /translation="MTIAYEALRTNVKPLVFNDKLNENHLKAMLSVYNLDSKNGTFDIL
FT                   TADGKTAVFSGIAAGKNMMLSVNPVSVNLILTKTGNKVARAKIPVSMMAGATYSILLLP
FT                   GEGGDPLIYIGQNKTERYTTQ"
FT   gene            533382..534545
FT                   /locus_tag="Galf_0488"
FT   CDS_pept        533382..534545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0488"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   slt:Slit_2128 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54532"
FT                   /db_xref="GOA:D9SC67"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC67"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL54532.1"
FT                   /translation="MTQVKNYYWRIAGFYFFYYAFIGMFAPYWSLYLQSIRFSAVEIGI
FT                   LMSVQPVMRMLAPSLWGWLADHTGKRLLVVQVAASLSAIFYLGVFVTTSFWGMLLVLAL
FT                   MSFFWSASMPLVEATTLSYLGKQTARYGRLRSWGSVGFIGSVVGLGYAFDYIAISWLLW
FT                   AGLICELGILLFSRQLPETQVVPHHTDQQPILKIFLRPSVMLLFGACFLMSAAHGPYYT
FT                   FFSIYLVEHGYAKSAVGGLWALGVICEIGVFILMPRLAHRYGFMRILIASFALAVVRFM
FT                   MIGWCVDFLLLLLIAQVLHAATFGAYHAASVGLIHELFQGKHQSRGQAMFGSLTYGAGG
FT                   MLGGLISGPVWQYYGANMLYTCSALMALLGLILVGWSSSGRFLQAAH"
FT   gene            534641..536770
FT                   /locus_tag="Galf_0489"
FT   CDS_pept        534641..536770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0489"
FT                   /product="cellulose synthase operon protein YhjU"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjU;
FT                   KEGG: vfm:VFMJ11_A1007 cellulose synthase operon protein
FT                   YhjU"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54533"
FT                   /db_xref="GOA:D9SC68"
FT                   /db_xref="InterPro:IPR017744"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC68"
FT                   /inference="protein motif:TFAM:TIGR03368"
FT                   /protein_id="ADL54533.1"
FT                   /translation="MNRATPKPNVSNNNDASRGVGHELPYWSGYLDRLGEQVKKTASTN
FT                   IWSGESVRVPATEASELKPAPQHRIRNPRGDRRMSAEQRRALMQTDVPAVSLPAWSAYL
FT                   AKLGQQLKPGVAKAAKARGTVPTYGIKRPIGDRRTGPRQRRSQSSSESIANTRLDKGRW
FT                   RYFVPRLLGRLVVNLRRVADPLEKIAYAHISLGLWGYYFAAKLALFGLGTITFHPMENL
FT                   LFAALLLLPVSSRLLYRLRAIFATLLALALLYYDSWLPDIRRLITQASQLSDFSWAYVV
FT                   ELSGRFFSWQTTGLLLALSIAYWIVSRRIRVGVFIVLGMLMLWGWQNAARLSADKAILN
FT                   VDLDMNKVLQDFFLKEAQRSILFVTPQTDAVPFDVIFIHVCSLSWDDVRAVGLEDHPLW
FT                   QRFDILMKKFNSAASYSGPAAIHFMRAKCGQTEHGVMYTTVADKCYLMNSLQLSGFEPN
FT                   LVLNHDGKFDDFLGQLKKHGRLNAPPMSLEGLEVAQHAFDRSPVYDDFSVLDRWLQTRQ
FT                   TSASSRVAMYYNTVSMHDGNHVSGADASSDTLVNYKNRLNKFLDETDRFLQKLETSGRR
FT                   AVVVMVPEHGAAIRGDKRQIAGLREIPTPSISLVPVGIKMVGGGVQREGDALTIDQPTS
FT                   YLAISHIIERTLEQSPFANGRFRSADYVQNYPHTRFVSQNETVTVAESQGQYYLSRGAS
FT                   QWDAYTEFNTLESGR"
FT   gene            537012..538412
FT                   /locus_tag="Galf_0490"
FT   CDS_pept        537012..538412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0490"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="KEGG: slt:Slit_2125 3-isopropylmalate dehydratase,
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; PFAM: aconitate hydratase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54534"
FT                   /db_xref="GOA:D9SC69"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC69"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ADL54534.1"
FT                   /translation="MSAETLYDKLWNSHVVRQDADGTALIYVDRQLVHEVTSPQAFEGL
FT                   RLAKRRPWRIASLLAVPDHNVPTTNRAAGITDPVSRIQVETLDANCAEFGITEFKMGDI
FT                   RQGVVHVMGPEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEHVMATQCLVAKK
FT                   SKSMEVRVEGVLGHGVTAKDIALAVIGLIGTAGGTGFAIEFTGSTVRSLSMEGRMTLCN
FT                   MAIEAGARAGMIAADDTTFAYLKGRPFAPQGAMWEQAVASWRNLHSDEGAVFDATFLLD
FT                   AAQIKPQVTWGTSPEMVVSIDGCVPDPAQMSQDKREGAERALVYMGLKANTPITEIKID
FT                   KVFIGSCTNGRIEDMRAAAAVARGKKVAANVMLAMVVPGSGLVKLQAEQEGLDKIFIEA
FT                   GFEWRDPGCSMCLAMNDDKLAAGERCASTSNRNFEGRQGQGGRTHLVSPEMAAAAAIAG
FT                   HFIDVSKI"
FT   gene            538423..538539
FT                   /locus_tag="Galf_0491"
FT   CDS_pept        538423..538539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0491"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: tau:Tola_3008
FT                   entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54535"
FT                   /db_xref="GOA:D9SC70"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC70"
FT                   /inference="protein motif:PFAM:PF08085"
FT                   /protein_id="ADL54535.1"
FT                   /translation="MKTIALLLAVFVLVGCNTVEGIGKDLKRGGEKIEKAAK"
FT   sig_peptide     538423..538488
FT                   /locus_tag="Galf_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.553 at
FT                   residue 22"
FT   gene            538540..539172
FT                   /locus_tag="Galf_0492"
FT   CDS_pept        538540..539172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0492"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: slt:Slit_2123 3-isopropylmalate dehydratase,
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54536"
FT                   /db_xref="GOA:D9SC71"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC71"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ADL54536.1"
FT                   /translation="MEKFTQLNGLVVPLDRANVDTDAIIPKQFLKSIKRSGFGPNAFDE
FT                   WRYLDHGEPGMDNSTRPLNTEFVLNQPRYQGAQVLLTRENFGCGSSREHAPWALEDYGF
FT                   RVIIAPSFADIFFNNCFKNGLLPIKLDANTVDALFKAEAATANFKLAIDLEAQTITLPD
FT                   GTVYPFIVDAFRKHCLLNGLDDIGLTLQHMDEISAFEAKHRAAQPWL"
FT   gene            539296..540360
FT                   /locus_tag="Galf_0493"
FT   CDS_pept        539296..540360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0493"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; KEGG:
FT                   slt:Slit_2122 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54537"
FT                   /db_xref="GOA:D9SC72"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC72"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ADL54537.1"
FT                   /translation="MKIAVLPGDGIGPEIVAQAAKVLDALKSDGLHIETEYAHLGGAGY
FT                   DAAGDPFPAATENLVKASDAVLLGAVGGYQYDALPRAMRPEQGLLRIRKSLNLFANLRP
FT                   AMVYPELVNASSLKPELVSGLDILILRELTGDIYFGQPRGIRTLESGERQGFDTMHYSE
FT                   SEIRRVAHVGFKSAMKRSYKLCSVDKANVLDTSMFWREIVTDVARDYPEVVLSHMYVDN
FT                   AAMQLVRAPKQFDVILTGNIFGDILSDEASMLTGSIGMLPSASLDENNKGLYEPCHGSA
FT                   PDIAGQDIANPLATILSVAMMMRYTFAREDVAQRIEGAVRSVLQQGLRTGDIFEAGMQK
FT                   VGCTAMGDAVVAAL"
FT   gene            540414..541436
FT                   /locus_tag="Galf_0494"
FT   CDS_pept        540414..541436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0494"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="SMART: Semialdehyde dehydrogenase NAD - binding;
FT                   TIGRFAM: aspartate-semialdehyde dehydrogenase; KEGG:
FT                   tgr:Tgr7_1248 aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54538"
FT                   /db_xref="GOA:D9SC73"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC73"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADL54538.1"
FT                   /translation="MSKQYDVCILGATGAVGEAMLAILEERKFPVRNLYLLASSRSAGT
FT                   EISFRGEELTVLDVEGFDFSLAQIGLFSAGGSVSEKYAPIAAAAGCVVIDNTAHFRYDR
FT                   DIPLVVPEVNPHAIAQYTNRGIIANPNCSTIQMLVALKPIKDAVGISRINVATYQAVSG
FT                   TGKEAIEELANQTRALFSSQDVEVEVYPKRIAFNVLPQIDVFMENGYTKEEMKMVWETQ
FT                   KIMEDDTIMVNPTAVRVPVFYGHSEALHIETKKKITASEARALLEKAPGVVVMDEHVPG
FT                   GWPTAVDAAGTDATYVGRIREDLSHPMGLDMWVVSDNVRKGAALNSVQIAEILIADYLK
FT                   "
FT   gene            541608..544142
FT                   /locus_tag="Galf_0495"
FT   CDS_pept        541608..544142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0495"
FT                   /product="FimV N-terminal domain"
FT                   /note="KEGG: slt:Slit_2120 FimV N-terminal domain protein;
FT                   TIGRFAM: FimV N-terminal domain; FimV C-terminal domain;
FT                   PFAM: Peptidoglycan-binding lysin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54539"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR020012"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC74"
FT                   /inference="protein motif:TFAM:TIGR03505"
FT                   /protein_id="ADL54539.1"
FT                   /translation="MKCTNMPRKLMVQLLGMTAGLSLSVLSYAVGLGGINVVSALGQPL
FT                   KAEIELVAVSGADKPSLVARLASPDAYKGAGLEYPFGVKYSFEVGSRANGDPYLKLNSN
FT                   REINDPFVSLLVELSWSSGRLMREYTFLLDPPGYVVAQPKAAAVEPLPAAVVESTPLEA
FT                   APVKPEEAVPVAVPVEKTVSRPAVRASRSSSDEITVKSGDTLNKIASEVKPADISLERM
FT                   LVALYRANADQFDGKNMNRIKTGKILRMPDRDEVAHLVQSEAVREIHAQSADWNSYRQK
FT                   LAGAALTTPRSESNKQVATGKISAPALDKTPLATESAKEVLRLSKGEMPGNKRAEAARA
FT                   AQDKRNAAAEEAIAKAQADKEEQARAALLEANMKDMQRLAQLKAEAAALIAGAASQAAA
FT                   SEVAEVAPESAVAAVSEVAAASAVASEVVAASAPVEVEGPSLMDRLQENATLLGLGAAA
FT                   LLALAGGIAIKRRKQQSGKAGKPAEDNAGASTGLLTVPVMPSPDTGDFTTTGADEIVPS
FT                   SDEVDPISEADLFLNFGRDEQAEEVLKDALQHSPDNHEIHLKLLGIYAKHQNAAAFAEI
FT                   SGLLEKTGDRDAIEQAGILAMQLADAPIEDVGTATQLMDAFEVEARDMEPVEEPVVAIS
FT                   DLVESELESELAPEAEPEAEQPISAETLDFDVTSTHPVPTPEVDFDVTSTSAAIPDVLD
FT                   FDIATNSSVSEVPEEESLPSLDDLIFDVTSSNSVSAEAVASIASAPEDDGMEFTLDFPL
FT                   DDVKDMATPSAPAINLSDISLDMDDVAVPVVEVSEAPKSEQWHEVATKLDLARAYQEMG
FT                   DEVGSREILDEVMREGDTAQQHEAELLIKQLG"
FT   gene            544202..544822
FT                   /locus_tag="Galf_0496"
FT   CDS_pept        544202..544822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_2119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54540"
FT                   /db_xref="GOA:D9SC75"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC75"
FT                   /inference="similar to AA sequence:KEGG:Slit_2119"
FT                   /protein_id="ADL54540.1"
FT                   /translation="MRLHPATQILIWCVLLMIMQFISPDRLLVAGACILMLAFMVSRHK
FT                   LVQLLSRTRWIMFSLCLIYGYTTIGTPVSQVLGDLSPSVEGLADGGLQLMRLIAALAGL
FT                   AILLDRLHRQALMSGLYCLFAPLSCFGLSRERLAVRLALTLHYAEAGMLRGSSWQDSLR
FT                   SLAAQNGQQAAENRTMELTLHGFSWLDKLLLVAMVILLWQVVR"
FT   gene            544819..545586
FT                   /locus_tag="Galf_0497"
FT   CDS_pept        544819..545586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0497"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: slt:Slit_2118 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54541"
FT                   /db_xref="GOA:D9SC76"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC76"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADL54541.1"
FT                   /translation="MRIALGVEYDGKPYCGWQSQPGGRTVQDTLQSALSHIADAPVTVN
FT                   AAGRTDTGVHALEQVVHFETDANRPLSAWVRGVNAMLPPSVVVRWAHPVPDEFHARFSA
FT                   QGRSYRYLLINKPVRSAIHAGKAGWFHLPLDIALMREAAGYLLGEHDFSAFRAAECQAK
FT                   SPVKCMNKIDIYLNGDVLVFDLEANAFLHHMVRNIVGCLVYVGKGKYPPAWMADLLASR
FT                   TRHLAAPTFSPDGLYLRRIQYDPTWCLPQQEMM"
FT   gene            545583..546224
FT                   /locus_tag="Galf_0498"
FT   CDS_pept        545583..546224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0498"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="KEGG: slt:Slit_2116 phosphoribosylanthranilate
FT                   isomerase; PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54542"
FT                   /db_xref="GOA:D9SC77"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC77"
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /protein_id="ADL54542.1"
FT                   /translation="MIRVKICGITRREDLLAVAACGADAIGLVFYSKSPRFVSCDLAAH
FT                   LLAVLPPFVTVVGLFVNASADDVREVMERVPLDVLQFHGDETPEYCVQFNKPYLKAIRV
FT                   KPGVDLLQCAADFHQAQGLLLDAHVEGIPGGTGAVFDWTLIPGQISLPLILSGGLNVEN
FT                   VAAGIQQVQPYAVDVSSGVEADNGISTLKGVKDAAKIARFMQEVKNVRLS"
FT   gene            546208..547404
FT                   /locus_tag="Galf_0499"
FT   CDS_pept        546208..547404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0499"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="KEGG: slt:Slit_2115 tryptophan synthase, beta
FT                   subunit; TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54543"
FT                   /db_xref="GOA:D9SC78"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC78"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADL54543.1"
FT                   /translation="MYDYPDITGHFGQFGGIYMAETLIPAVEELRVQYLRYRDDPEFKA
FT                   EFAYELKHYVGRPSPIYHAKNWSDRLGGAQIYLKREDLNHTGAHKINNAIGQALLARRM
FT                   GKKRVIAETGAGMHGVATATVAARYGMECIVYMGAEDIQRQSPNVYRMKLLGATVVPVT
FT                   SGSRTLKDACNEAIRDWVTNVESTFYIFGTAAGPHPYPMMVRDFQCVIGNEAKIQMPEM
FT                   IGRQPDAVIACVGGGSNAIGLFYPYIDVPDVQIIGVEAGGHGVESGMHAAPLTANSPVG
FT                   VLHGNKVNLIQDENGQIKETHSISAGLDYPGVGPEHCWLKDIGRAQYVAINDDEAMAAF
FT                   HDLCRFEGIIPALESSHALAHAAKIAPGMSTDKVLLVNLSGRGDKDINTVARLSGITL"
FT   gene            547401..548201
FT                   /locus_tag="Galf_0500"
FT   CDS_pept        547401..548201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0500"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /note="KEGG: slt:Slit_2114 tryptophan synthase, alpha
FT                   subunit; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54544"
FT                   /db_xref="GOA:D9SC79"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC79"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ADL54544.1"
FT                   /translation="MSRIQAAFEKLKQQQRRALIPFFTAGDPSPSVTVPLMHALVSSGA
FT                   DVIELGVPFSDPMADGPTIQRASERALKQGMSLRGVLDLVAEFRRTNDATPVVLMGYGN
FT                   PIEAMGWAKFAQRCADVGVDGVLTVDFPPEESSEAFEHLQRHGIDPIFLLAPTTEEARI
FT                   KQVAKLARGYVYYVSLKGVTGSGSIDLSAIEQKLPLLRQHIKLPIGVGFGIRDAATAKA
FT                   VASLCDGVVVGSRIVQVIEDSNEANVVDNVSALIKELRLAVDQA"
FT   gene            548212..549093
FT                   /locus_tag="Galf_0501"
FT   CDS_pept        548212..549093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0501"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="KEGG: slt:Slit_2113 acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; TIGRFAM: acetyl-CoA carboxylase,
FT                   carboxyl transferase, beta subunit; PFAM: carboxyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54545"
FT                   /db_xref="GOA:D9SC80"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC80"
FT                   /inference="protein motif:TFAM:TIGR00515"
FT                   /protein_id="ADL54545.1"
FT                   /translation="MSWFQKLLPPKINRREGDAKKNVPEGLWSKCPSCETVLYHSDLEK
FT                   NLGVCPKCSYHHRASARTRLDWLLDGEGRFEIGAEVLPVDTLKFKDSRKYSERLIASKK
FT                   STDEDDALVVMQGCIRDVPVVVACFEFAFMGGSMGSVVGERFVRGVQVALEQKCPFVCF
FT                   AASGGARMQEGLLSLMQMAKTCAALTQLSEEKLPFISVLTDPTMGGVSASFAFMGDVVI
FT                   AEPGALIGFAGARVIQQTVRETLPEGFQRAEFLLEHGAVDMIIDRREMRNQLATLITLL
FT                   TRQPAVVELDAA"
FT   gene            549106..550374
FT                   /locus_tag="Galf_0502"
FT   CDS_pept        549106..550374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0502"
FT                   /product="FolC bifunctional protein"
FT                   /note="KEGG: slt:Slit_2111 FolC bifunctional protein;
FT                   TIGRFAM: FolC bifunctional protein; PFAM: Mur ligase middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54546"
FT                   /db_xref="GOA:D9SC81"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC81"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ADL54546.1"
FT                   /translation="MPENLADWLTYLESLHPNTIALGLERVGEVRQRLQLAPDFPVIMV
FT                   GGTNGKGSVCAMLESVLYAAGYQVGCYTSPHLMHYNERVRIGKHAASDDELCASFEKIE
FT                   QVRGDIPLTYFEFGTLAAMQLFIDHKVEVAILEVGLGGRLDSVNVFDADCAIVTSVDID
FT                   HTDYLGETREAIAYEKAGIFRPDRVAIFADSELPRAIADHAEAIGAVLWCAGVDFGFKL
FT                   HQGQWDYRSLTCARSALPHPALRGAFQLNNASAVLAALDALQDRLPVSMAAIRRGLTEV
FT                   QLAGRFQFVPGKPQLILDVAHNPHAAHSLAHNLQSMPPCPHTYAVFGMLKDKDIAGVVA
FT                   ALKPCIDTWLVAGLAVPRGASSAILAQVLAEAGVTAEVLEFASIADALLHACNAAGEND
FT                   RIAAFGSFYTVADAMAAKKLRVV"
FT   gene            550433..551116
FT                   /locus_tag="Galf_0503"
FT   CDS_pept        550433..551116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0503"
FT                   /product="Sporulation domain-containing protein"
FT                   /note="PFAM: Sporulation domain-containing protein; KEGG:
FT                   slt:Slit_2110 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54547"
FT                   /db_xref="GOA:D9SC82"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC82"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADL54547.1"
FT                   /translation="MAKQPEDQNIKSRARRRLIGAIALTLAVVVILPMVLDSEPKITGQ
FT                   DIELRIPAADKAGEFVPGVTLSEVIEAPVQIESAVAGASETLPAASGKITVAEVKDKPV
FT                   VETPVVAIKEAEVREAKSVETRPVEDKKIEKKPVSDKPSEKTIEKPSEKLAGSYVVQVG
FT                   AFSNAEKAAQEADKLKGWGFKAYTEVIAGTTRVRVGPYVDRSKADEVRKMLEKHDLHPA
FT                   ITAVK"
FT   gene            551113..551607
FT                   /locus_tag="Galf_0504"
FT   CDS_pept        551113..551607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0504"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; KEGG:
FT                   slt:Slit_2109 colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54548"
FT                   /db_xref="GOA:D9SC83"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC83"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ADL54548.1"
FT                   /translation="MTGFDYAVIGIMLVSLSLGLWRGLVYEVLSLLGWPLAYLISRQFS
FT                   GVVAPMLPVSQDEARVALAYALVFIAVLIVWAMLVWIFTKLIKAVGLGLIDSLLGSLFG
FT                   LLRGMLVILILVWLAGTSSLPEQRFWLDAKFSKWAEDAALLSKAVLPDDIAARIHYRNR
FT                   N"
FT   gene            551620..553146
FT                   /locus_tag="Galf_0505"
FT   CDS_pept        551620..553146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0505"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: slt:Slit_2108 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54549"
FT                   /db_xref="GOA:D9SC84"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC84"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADL54549.1"
FT                   /translation="MCGILGVVSYSPANQLLYDGLQVLQHRGQDAAGIATMDGDTIHLH
FT                   KGNGLVRDVFRTRNMRALQGNTGIAHVRYPTAGSAVDHNEAQPFYVNSPFGIVLGHNGN
FT                   LTNAEELKKQLFVQDLRHVNTNSDSEVLLNVLAHELQSKSKGLRLDADSIFAAVSGVHQ
FT                   RCRGAYAVVAIIAGYGLLAFRDIYGIRPLVIGVNETPEGNEYLIASESVALDTLGFKFL
FT                   RDVAPGEAVFVDFQGRLYTRQCSDNAQLSPCIFEYVYFSRPDSVIDGISVHESRLYMGE
FT                   YLADKLARIWPDVKIDVVIPIPDSSRPSALQLANRLNILFREGFVKNRYIGRTFIMPGQ
FT                   AMRKKSVRQKLNAIGLEFKGKNVLLVDDSIVRGTTSREIVQMARDAGALKVYFASAAPP
FT                   VRYPNVYGIDMPSRAELIATGRTDEEICREIGADALIYQDLEDLKSSVRKANPAIAEFE
FT                   ASCFDGIYITGDITPAYLDKVERGRSAGKANKSADDDQMELELAMSASSM"
FT   gene            553203..554378
FT                   /locus_tag="Galf_0506"
FT   CDS_pept        553203..554378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0506"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /note="KEGG: slt:Slit_2107 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54550"
FT                   /db_xref="GOA:D9SC85"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC85"
FT                   /inference="protein motif:TFAM:TIGR01325"
FT                   /protein_id="ADL54550.1"
FT                   /translation="MNEENYQPETLAIRAGTVRSQFGEHSEAMFLTSSFVFDSAAQAAA
FT                   RFIGEEPGNIYARFTNPTVTMFEERLAALEGAEQCVATASGMSAILACVMGLLKAGDHI
FT                   VASRSLFGSTVNLFNNVIKKFGVETTYVSATDVTEWQAAVRPNTRLFFLETPSNPLTEI
FT                   SDIKAISQVAKGCGALLAVDNCFCTPILQRPLELGADVVIHSATKYLDGQGRVLGGAVL
FT                   GSRKNMEGVYGFLRTTGPTMSAFNAWVFLKGMETLKIRMDAHSASALQLASWLEAQPNV
FT                   SRVFYPGLPSHPQHELAMRQQKTGGGIVAFEVAGGKEAAWRVIDNTKLLSITANLGDTR
FT                   TTICHSASTTHARISPEARAAAGISDGLIRIAVGLEAIVDIQNDLARGLNV"
FT   gene            554378..554869
FT                   /locus_tag="Galf_0507"
FT   CDS_pept        554378..554869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0507"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: slt:Slit_2106 CinA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54551"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC86"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ADL54551.1"
FT                   /translation="MDVLAAQVGGLLKSHGVMLATAESCTGGGVAQAITEIAGSSAWFE
FT                   RGFVTYSNLSKQQMLGVEAATLEQYGAVSDAVVREMVAGALRYSAAQLALAVSGIAGPD
FT                   GGTPDKPVGTVWFAWGIKNSVMQTQRYQLAGNRSEVRAQAVRIALQGVIDMLNQRTETA
FT                   "
FT   gene            554950..556026
FT                   /locus_tag="Galf_0508"
FT   CDS_pept        554950..556026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0508"
FT                   /product="recA protein"
FT                   /note="TIGRFAM: recA protein; PFAM: RecA domain protein;
FT                   KEGG: slt:Slit_2105 RecA protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54552"
FT                   /db_xref="GOA:D9SC87"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC87"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ADL54552.1"
FT                   /translation="MDENKSKALMAALSQIEKQFGKGSIMRLGENEVAQDIQVVSTGSL
FT                   GLDIALGVGGLPRGRVIEIYGPESSGKTTLALQVIAEMQKLGGTAAFIDAEHALDPQYA
FT                   QKLGVKVEDLLISQPDNGEQALEITDMLVRSASVDVVVIDSVAALTPKAEIEGEMGDSQ
FT                   MGLHARLMSQALRKLTANIKRSNTLVIFINQLRMKIGVMFGNPETTTGGNALKFYASVR
FT                   LDIRRIGAIKKGDEVIGNETRVKVVKNKVAPPFKEALFDILYGEGTSREGEIIDLGVLH
FT                   KLIEKSGSWYSYNGEKIGQGKDNVREFLRTRSEMAFEIENKIRTLVGVALIEAGESPKA
FT                   AAKAKAAEKLALAGEEKA"
FT   gene            556010..556489
FT                   /locus_tag="Galf_0509"
FT   CDS_pept        556010..556489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0509"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: slt:Slit_2104
FT                   regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54553"
FT                   /db_xref="GOA:D9SC88"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC88"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ADL54553.1"
FT                   /translation="MKKRPEISLRGRALQYLARREYTRAELAAKLRPYAQVEDDFEQVQ
FT                   PVDLESVLDGLVDSGYLSDERAATQILHARRPRFGTHRITHEMHQKGLSEELIAEALPV
FT                   LKESELDTARDVWQRKFGILPHDAKEKAKQMRFLQSRGFGFDVIFKVLQATDEEN"
FT   gene            556692..559313
FT                   /locus_tag="Galf_0510"
FT   CDS_pept        556692..559313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0510"
FT                   /product="alanyl-tRNA synthetase"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: Alanyl-tRNA
FT                   synthetase, class IIc-like; phosphoesterase DHHA1;
FT                   Threonyl/alanyl tRNA synthetase SAD; KEGG: slt:Slit_2103
FT                   alanyl-tRNA synthetase; SMART: Threonyl/alanyl tRNA
FT                   synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54554"
FT                   /db_xref="GOA:D9SC89"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC89"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ADL54554.1"
FT                   /translation="MKSSEIRQQFLDFFASKGHAIVASSSLVPHDDPTLLFTNAGMNQF
FT                   KDVFLGFDKRPYVRAASSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRD
FT                   AISFAWELLTEVFKLPKERLYVTVYAEDDEAYDIWTKEMGLEASRVIRIGDNKGARYAS
FT                   DNFWMMGDTGPCGPCTEIFYDHGEHISGGLPGTPEEDGDRFIEIWNNVFMQFNRDEAGV
FT                   MHPLPKPSVDTGMGLERISAVLQHVHANYEIDLFQALINAAARETNCSDMDSPSLKVLA
FT                   DHIRACSFLIADGVIPGNEGRGFVLRRIIRRAIRHGYKLGAREAFFYKLVPDLVAQMGV
FT                   AYPELTAAQDRVKGVLKLEEERFFATIENGMAILEADLLAMKQAGNTVFNGETAFKLHD
FT                   TFGFPVDLTADVCREHGVTVDVAAFDAAMAQQKQQARAAGKFKMAANLEYEGPATLFHG
FT                   YETLEHAGCVLALYKDGVSVGELNEGDTGVVVLDNTPFYAESGGQTGDSGELRGSHGIF
FT                   AVEDTQKIQAAVFGHHGVLKTGKLLVGNGVQARVNMAARRATERNHSVTHLMHKALREV
FT                   LGAHVQQKGSQVDADKTRFDFVHSQPVTDSEVLRVEFIVNAEILSNAASQSRVMGIEDA
FT                   QQTGAMMLFGEKYGDEVRVLNIGSSIELCGGTHVARTGDIGLFKIVSESGVAAGVRRIE
FT                   AVTGEGALDLIQMQQRQLRAVADAVKAQPHEAAGRIAQLLDHQKSLEKELTALKSKLAS
FT                   AQGDELVAQAQDINGVKVLAALLPGADAAILRETLDKLKDKLKSAVILLASVTDGKVAL
FT                   IAGVTADQTAKVKAGELVNMAAQKVGGKGGGRPDMAQAGGTQPEHLAAALASVTDWVRN
FT                   KL"
FT   gene            559390..559482
FT                   /pseudo
FT                   /locus_tag="Galf_0511"
FT   gene            complement(559537..560913)
FT                   /locus_tag="Galf_0512"
FT   CDS_pept        complement(559537..560913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0512"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG: slt:Slit_2101
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54555"
FT                   /db_xref="GOA:D9SC90"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC90"
FT                   /inference="protein motif:PFAM:PF02878"
FT                   /protein_id="ADL54555.1"
FT                   /translation="MNTIQREIFKAYDIRGIVGKTLTSCVVEAIGHAIGSEAIARNQHT
FT                   IVIGRDGRLSGPQLSQALARGIQKSGIDVIDIGCVTTPMAYFAAFHLNTDCCVVLTGSH
FT                   NPPDYNGLKIVLAGETLFGEAIQALRCRIEQNDLTAGCGSYSLQDISAAYLSRIACDVK
FT                   PARPMKLTVDCGNGVAGAYAAELYRQLGCEVVELYCEVDGHFPNHHPDPSIPENLQDLI
FT                   AAVKSNGSELGLAFDGDGDRLGVVTRTGDIIYPDRQLMLFAADMLSRNQGATVIFDIKS
FT                   TRHLFDWVRSHGGVPIIWKTGHSLIKAKMRETGAQLAGEMTGHLFFQERWYGFDDGLYA
FT                   GARLLEILSNGADPSAVLNALPDSCSTPELHIKTREGENHALLAELNKNARFTDALEII
FT                   TIDGLRVEYKDGFGLARASNTTPAIVLRFEAETESALLRIQHEFRRLLIQAAPNLKLPF
FT                   "
FT   gene            complement(560944..562293)
FT                   /locus_tag="Galf_0513"
FT   CDS_pept        complement(560944..562293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0513"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: GGDEF domain containing protein; response regulator
FT                   receiver; PAS fold-3 domain protein; KEGG: diguanylate
FT                   cyclase with PAS/PAC sensor; SMART: GGDEF domain containing
FT                   protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54556"
FT                   /db_xref="GOA:D9SC91"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC91"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL54556.1"
FT                   /translation="MSDNSVLSVKILAVEDDTGDYGLIRVYLRMAGYIQNIVPDPVTWV
FT                   TTLAQAEQQVVLDRPDIILLDLSLPDSFGISTVKRMRMLLPTVPIIVLSGNNDNDIALA
FT                   ALEEGAQDYVIKGQYEHNALGKAISHALIRAKLEAKLIESEFRWKFAIEGSGDGLWDWD
FT                   VAQNIVFYSERWKQMLGYAENEVGNGLDEWEMRIHPDDKAGTLASVQAYLTGKSSSYLS
FT                   EHRVLSKDGDYKWILDRGMVVARDAEGHPIRLIGTHTDITERKRMEDQVRQLAFYDPLT
FT                   QLPNRRLLNDRLSRAMSAGKRSGGYGALMFLDLDNFKPINDTHDHILTIEAANRLRACV
FT                   REIDTVARFCGDEFVVMLSELDTNEQASTIEATRVAEKILACLSTPYQLTVKHEGQPDT
FT                   EVEYHCTTSIGLVLFLGHEICQDDIIICANAAMYQARHAGRNTIRFYQAE"
FT   gene            complement(562371..563378)
FT                   /locus_tag="Galf_0514"
FT   CDS_pept        complement(562371..563378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0514"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="KEGG: slt:Slit_2100 lipopolysaccharide
FT                   heptosyltransferase II; TIGRFAM: lipopolysaccharide
FT                   heptosyltransferase II; PFAM: glycosyl transferase family
FT                   9"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54557"
FT                   /db_xref="GOA:D9SC92"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC92"
FT                   /inference="protein motif:TFAM:TIGR02195"
FT                   /protein_id="ADL54557.1"
FT                   /translation="MHKILVIGPSWVGDCMLMQPMLMRLKQRHPGCLIDVLAPAWTAGL
FT                   LHALPEVNQAIVNPFGHGALNIKERYRLGVELRAGQYDQAIVLPNSLKSALIPFFANIP
FT                   LRTGFVGELRYGLLNDARPLNKHHLPLMVERFAELAEDRFGIIPRPLANPKLSVSAAQR
FT                   DTTLTKLGLTLEKPVAVFCPGAEYGPAKRWPIAYFAEIAQRLHAQGYAVWLVGSNKDRE
FT                   VAEKIVALGNPDTRNLCGSTDLSDAIALLSVATLVISNDSGLMHLAAALDRTLIALFGS
FT                   SSPEFTPPLSNSAQVVKLDIKCSPCFKRECPLGHFNCMNHLTPDLVWQKIHPVL"
FT   gene            complement(563422..563616)
FT                   /locus_tag="Galf_0515"
FT   CDS_pept        complement(563422..563616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0515"
FT                   /product="Zinc finger, CHCC-type"
FT                   /note="PFAM: Zinc finger, CHCC-type; KEGG: slt:Slit_2099
FT                   zinc finger, CHCC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54558"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC93"
FT                   /inference="protein motif:PFAM:PF10276"
FT                   /protein_id="ADL54558.1"
FT                   /translation="MSTITHRQIDVTAHDLPLTCPMPSAKLWNAHPRVALALDGEGEAH
FT                   CPYCGTLYKFKGERPKSHH"
FT   gene            complement(563628..564548)
FT                   /locus_tag="Galf_0516"
FT   CDS_pept        complement(563628..564548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0516"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="KEGG: slt:Slit_2098 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54559"
FT                   /db_xref="GOA:D9SC94"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC94"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADL54559.1"
FT                   /translation="MSMSDRDGFIWHDGKLVPWRDATTHVLTHTLHYGMGVFEGVRAYK
FT                   AAEGTAIFRLREHTERLFNSAHIFQMKMPYDKETIMEAHREVVRSNKLESCYIRPICFY
FT                   GSEAMGIAATTLSTHVAIAAWPWGAYLGDEGMQKGIRVKTSSFTRHHVNVNMCRAKSVT
FT                   TYANSILAHQEVANDGYDEALLLDVDGYVAEGAGENLFIVKKGRLYTPDLTSCLEGITR
FT                   DSVITLAKEMGIEVIEKRITRDEIYCAEEAFFTGTAAEVTPIRELDQRQIGAGSRGPIT
FT                   TLLQQAFFDCVAGRHPNHTDWLDYV"
FT   gene            564830..565354
FT                   /locus_tag="Galf_0517"
FT   CDS_pept        564830..565354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0517"
FT                   /product="cytochrome b561"
FT                   /note="KEGG: slt:Slit_2245 cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54560"
FT                   /db_xref="GOA:D9SC95"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC95"
FT                   /inference="similar to AA sequence:KEGG:Slit_2245"
FT                   /protein_id="ADL54560.1"
FT                   /translation="MTQYSNRMILVHWLTLALLVAAWFLGEELAEATDESQATIAGYLV
FT                   HGIVGGSVLLLTVLRLLFRRQDGTPPAMGDTAMDKLAKGIHHTLYTVLFLLPVSGMITI
FT                   ASSDAGKALLSGDASLLPVDGGYEHVFAHEVHEVLVTTLILLAIVHVLGAIKHQFIAKD
FT                   GLMERMLPRRK"
FT   gene            complement(565402..566007)
FT                   /locus_tag="Galf_0518"
FT   CDS_pept        complement(565402..566007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0518"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: mfa:Mfla_2394 two component transcriptional
FT                   regulator; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54561"
FT                   /db_xref="GOA:D9SC96"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC96"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54561.1"
FT                   /translation="MTIFETMRPHFESLTQRQREIARLLVSGMTNLEVAGQLCISVHTI
FT                   KAHRAEIMSRMQVNSFAELVNQFNRLTPPLPLTTPLHVIVVEDDEWYRDYLTDNLNERG
FT                   YSSIGVVDGEGLRAAWAQKPADVVILDIELGQGKENGLALATRILSNCPCGIIMVTAKG
FT                   AQDERLEGLSTGADAYFAKPVNIDELSITITNLARRLR"
FT   gene            566178..567302
FT                   /locus_tag="Galf_0519"
FT   CDS_pept        566178..567302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0519"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: dar:Daro_3172 response regulator receiver;
FT                   PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54562"
FT                   /db_xref="GOA:D9SC97"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC97"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54562.1"
FT                   /translation="MNDKPYILLIDDDEFSALVTVEMLASEYDIRHVESGAAALETIVK
FT                   AEPCLLLLDVEMPGMSGYEVCRTLREDHAIGELPIIFLSGRLSDEDRLAGYEAGGDDYL
FT                   TKPVSVDELRSKIKLALAHRTARQRLKTDLSSAFSTAMTAMSSSAEMGAVLQFMRNSFS
FT                   CPDYESLCREVLNTLCAYGFEASVKIHGRQGSVALSSNGPCSPLEESVLTNMSLQARLF
FT                   EFGSRTSCSYEHITIIVKSNSRDDPERHGRMKDNLAWLAEGANARVDSIESSAEVVRQH
FT                   AANKMLLERTHQALQRIDQRHRNQEIRSSRIFLELQKKFDQAMLTIGITQSQEEELASM
FT                   LETAILQAKALYDEGLEIDEHMECILEQLDKARN"
FT   gene            567318..568217
FT                   /locus_tag="Galf_0520"
FT   CDS_pept        567318..568217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0520"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: alv:Alvin_0396 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54563"
FT                   /db_xref="GOA:D9SC98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC98"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54563.1"
FT                   /translation="MIANILIVDDDEFLLSLTGDVLARFDFTVDTAKDGLVAWEKVDEN
FT                   PALYDLILLDRNMPRLDGMGLLQRMRSDSRFEKLPVIMLTAEDAQQDFLEGLATGASYY
FT                   LSKPVSEDVLNLVVKTALEESRAGRELYALMDQKDNQTDQQNFSYRTLSEARVLALQLA
FT                   KASGDPGRTLRGYSELLVNAVEHGNLGITYAEKNHLLREDCWCEEIDARLSRAPYAARR
FT                   VQVALAKTDTAVVVTITDQGAGFNWQSYLEFSDERIFDLNGRGIALSKATSFDRLEYLG
FT                   CGNCVVASVFFAGSQRSS"
FT   gene            568240..569115
FT                   /locus_tag="Galf_0521"
FT   CDS_pept        568240..569115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0521"
FT                   /product="response regulator receiver and Hpt phospho
FT                   transfer protein"
FT                   /note="KEGG: pin:Ping_0484 multi-sensor histidine kinase;
FT                   PFAM: response regulator receiver; Hpt domain protein;
FT                   SMART: response regulator receiver; Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54564"
FT                   /db_xref="GOA:D9SC99"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:D9SC99"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL54564.1"
FT                   /translation="MMKPPFFKLHQADDVNLAQAICIQTSAESDVRISAHPSNIRGDEP
FT                   DFKNLKNSECVPVALAGRHLILIAEDDEINLDMLQAQLELLGYVTEAACDGATALAMWR
FT                   SERYALLLTDCHMPNTDGFELTAAIRREEPAGIRLPIIAVTADAMQGVSERCIAQGMDD
FT                   YLSKPLLLDELGRMLIKWMPLPVRVADYPVWDGGTLSRLIGDKPDLRRRLLEKFLVKGR
FT                   MRIDEMLNVGEDRELAVHAAHALKSAARTVGALRLGELCQAMEDGVAMPGEVSVAFAAA
FT                   ECNIKAVLQS"
FT   gene            complement(569590..570345)
FT                   /locus_tag="Galf_0522"
FT   CDS_pept        complement(569590..570345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0522"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: slt:Slit_2028
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54565"
FT                   /db_xref="GOA:D9SCA0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA0"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ADL54565.1"
FT                   /translation="MTTPIDISEKDGIRYLHFGSSWVQGAMRINRPWNLELEYTQEMMA
FT                   SLLLRNEARWPRKILLIGLGAASLTKFLYRYRPDAHLTIVEIEPDVVATARHFFKLPED
FT                   DKRIHMIIGDGAEFVLGTNKKFDLILVDGFNEHAHPGQLNSLPFYQACRSCLSDQGVMA
FT                   VNLLGLCKGVLGGFAHILTAFNERALLFPSCPSGNTIAFATEGELINIDLEDLKTAAIA
FT                   LKEDSGLNLLPTLSRLEKAKICKDNTLTI"
FT   gene            complement(570360..571196)
FT                   /locus_tag="Galf_0523"
FT   CDS_pept        complement(570360..571196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0523"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: slt:Slit_2026 carbohydrate kinase, YjeF
FT                   related protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: protein of unknown function UPF0031"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54566"
FT                   /db_xref="GOA:D9SCA1"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA1"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ADL54566.1"
FT                   /translation="MNPQHIDEKRLVKRLPARPLDSHKGLFGKVVVIGGASGMAGAALL
FT                   TARAALKSGAGSVHVVLLAGNPPAVDFLQPELMLHDAESPLPPATVRVIGCGMGCDAVA
FT                   RNLLQDSLQSQIALVLDADALNLIALHAELRELLAQRSAPSVLTPHPGEAARLLACSTA
FT                   DIQSNRMASVQELAKIFACTVLLKGAGSLCATQDGVFINTTGNPGMSGPGMGDVLSGII
FT                   AAFIAQGLNTDDATLLAVSLHGAAGDALAKQRIAIGMTASELTDQTRRLLNQWRSI"
FT   gene            571276..575130
FT                   /locus_tag="Galf_0524"
FT   CDS_pept        571276..575130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0524"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase;
FT                   KEGG: slt:Slit_2025 phosphoribosylformylglycinamidine
FT                   synthase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54567"
FT                   /db_xref="GOA:D9SCA2"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA2"
FT                   /inference="protein motif:TFAM:TIGR01735"
FT                   /protein_id="ADL54567.1"
FT                   /translation="MFKVSVGSSALSAFRLEKLRAALITAAPDVVVADTRHCYFSALQG
FT                   AALDAAQAAVLDKVLGLTGQEQVPEGAPVLVVPRLGTISPWSTKATDIAQHCGLTGVVR
FT                   IERGVIYYLSAKNGAQLTDAQKALALPLLHDRMTESVLASVEDAAEKIFRHGEPQPLAS
FT                   VDILQGGAEALAAANREMGLALSVDEIDYLVENFKKLNRNPTDVELMMFAQANSEHCRH
FT                   KIFNADWVIDGVVQDMSLFGMIRNTHKVSPAGTVVAYSDNSSVIEGASVARFYPREGGA
FT                   YEFSEELTHTLMKVETHNHPTAIAPFAGAATGSGGEIRDEGATGIGSRPKAGLTGFSVS
FT                   NLNIPGFEQPWEADYGKPSRIVTALQIMLEGPLGGAAFNNEFGRPNLTGYFRTFEEQVD
FT                   GEMRGYHKPIMLAGGVGSISAIHTHKHDLPVGALVVHLGGPGMLIGLGGGAASSMDTGS
FT                   NAENLDFDSVQRGNPEMQRRAQEVIDRCWQLGENNPILSIHDVGAGGMSNALPELVHGG
FT                   GRGATFELRKIPLDETGMSPRQIWCNESQERYVLAIAPERLAEFRAFCERERCPFAVVG
FT                   VAVEDDQLIVHDTEFNNDPVNMSLSVLLGKPPKMTRNVVRETPKLAAFDTSSLDLKESI
FT                   ERVLRLPAVANKTFLISIGDRTVGGMTARDQMVGPWQVPVADVAVTLMGFNTHLGEAYA
FT                   LGERTPLALVNAAASGRMAVGEALTNIAAARIAKIGDIKLSANWMAAAGHHGEDAALFD
FT                   TVHAVGMELCPALGIGIPVGKDSMSMKSTWTDGDENKSVTSPLSLIVTAFAPCTDTRDT
FT                   LTPQLAEDADSTLLLIDLGNGQNRMGGSALAQVYKQVGSIAPDVDSAARLKSFFELIQS
FT                   LNSAGKLLAYHDRSDGGAFVSLCEMSFASHLGLAIQLDELPGDTLSALFNEELGAVVQV
FT                   KNSELAGVLQSVRGAGLAAYPVATTNQSGQILVSRGRDTLFSDTRVNLQRIWSELTYQM
FT                   QKLRDNPDCAQAEFDGLLDAANPGLHAKLTFDLESAPAILKSRPKMAILREQGVNGQVE
FT                   MAAAFDRAGFASVDVHMSDIISGRVNLSDFKGVAACGGFSYGDVLGAGEGWAKSILLNS
FT                   RARDEFEAFFNRNDTLALGVCNGCQMMSNLHEIIPGAQNWAHFSRNQSEQFEARFVMVE
FT                   VQESPSIFFDGMAGSRMPIVVAHGEGYADFGSEAKMNAAQVTLRYVDNRGVATETYPLN
FT                   PNGSPQGITGLTTADGRFSIMMPHPERVFRAVQNSWYPDDWQENGAWLKMFQNARRWVG
FT                   "
FT   gene            complement(575167..575967)
FT                   /locus_tag="Galf_0525"
FT   CDS_pept        complement(575167..575967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0525"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   slt:Slit_0337 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54568"
FT                   /db_xref="GOA:D9SCA3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA3"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADL54568.1"
FT                   /translation="MTCNSERKPIGLIDTHCHLDAAEFAGHQAELLLAAQSTGISHIVV
FT                   PSVSRANFASVSALCDEHPACSAAYGIHPMLIEAATPDDLRVLQDYLRTRNPVAVGEIG
FT                   LDFFIRSDNRARQEYFFVEQLKLAREFDLPVLLHTRRATDIVLKHLRQITVRGGIAHAF
FT                   SGSREQAEAFIKLGFKLGFGGAATFPRATRLRELAATLPLSCLVLETDAPDMPPEFVLR
FT                   GSPNKPEYLLRIAEILANVRGIPLEALALATTENARSVLAGLPR"
FT   gene            576001..577146
FT                   /locus_tag="Galf_0526"
FT   CDS_pept        576001..577146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0526"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: slt:Slit_0339
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54569"
FT                   /db_xref="GOA:D9SCA4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA4"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADL54569.1"
FT                   /translation="MLNCATYLRIFSTGLLMSGNTFGLIFTVTSFGESHGAAIGCVVDG
FT                   CPPGLALTEADIQHDLDRRKPGTSRHVTQRRESDTVEILSGVFEGKTTGTPIALLIRNE
FT                   DQRSRDYGNISETFRPGHADYTYTQKYGFRDHRGGGRSSARETAVRVAAGAIAKKWLNE
FT                   RYGVVIRGYISQLGEIEMPFVSWEGVNDNPFFAADPAVVAPLEDYMDALRKSGDSIGAA
FT                   LTVVAQNVPVGWGEPVYDRLDAEIAYALMGINAAKGVEIGDGFACVAQKGSVHGDEMTP
FT                   EGFLSNHAGGILGGISTGQDIVARLAIKPTSSIRIPRHSINAAGEPVMVETHGRHDPCV
FT                   GIRATPIAEAMLALVLIDHALRHRAQNADVVCGTPKIAGSI"
FT   gene            577209..577694
FT                   /locus_tag="Galf_0527"
FT   CDS_pept        577209..577694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slt:Slit_0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54570"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA5"
FT                   /inference="similar to AA sequence:KEGG:Slit_0661"
FT                   /protein_id="ADL54570.1"
FT                   /translation="MIETATLITLCMLYLIFFRPGKTPPLENPLVIERPGQYHLTLAPQ
FT                   LNLAQSFIEAIVRQIASLADVPANTETYYFEVRDSEVSAHGFECYLLAITRREGLLYIQ
FT                   AAPPLSKDQSTYLTVISEFAHRVLVRFPDDEAHAPAEEIVSAVQQASKQRGNQIKSL"
FT   gene            577691..578215
FT                   /locus_tag="Galf_0528"
FT   CDS_pept        577691..578215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54571"
FT                   /db_xref="GOA:D9SCA6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA6"
FT                   /inference="similar to AA sequence:KEGG:Daci_2448"
FT                   /protein_id="ADL54571.1"
FT                   /translation="MNEEDSGEWEPVTGWGVASYLFFALLILWLSHSEGHWVFLLDNAN
FT                   LALHEAGHPALSLISDRLTVYGGTLMQLVFPLSAGFHFYRRGETLSVAFAVLWLGENLF
FT                   NIAVYMADARVQILPLVGNGEHDWTEIFSRWGVLDWDTGIAALVRVAGWLLILAAAVWL
FT                   GYRHRSASVTF"
FT   gene            complement(578205..579851)
FT                   /locus_tag="Galf_0529"
FT   CDS_pept        complement(578205..579851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0529"
FT                   /product="transmembrane protein"
FT                   /note="KEGG: slt:Slit_0343 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54572"
FT                   /db_xref="GOA:D9SCA7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA7"
FT                   /inference="similar to AA sequence:KEGG:Slit_0343"
FT                   /protein_id="ADL54572.1"
FT                   /translation="MYFIKPTDPNPVTPAKAVMLALLCTVWVATGLVGHDPWKPEDAYS
FT                   FGVVYSMLQSGNWLIPTLAGEPFMANPPLYYWTAALTAKLLSPWLALHDGARLASGFYS
FT                   ALTLLFIGLAGRKLYGENRGWAASIILIGCIGMLVRSHEMITDLTLLTGCAMMLYGFAH
FT                   SQERALRAGIWTGLGCGIGFLSKGFISPLLFVLIASLLPALFRNWRCRNYLLSVGLSTL
FT                   VALPFLTIWPYLLHQQAPKLFAEWAWSLNIGGWLSFIQKGPDTEAFYYLKSLPWLAWPA
FT                   LPLAVWAVWRERKRLAQRDDLQLPLVAFVVMLVVLSLSTNVKEAYALPMLLPVALLATA
FT                   SLSMLKRGAANALDWFGLMTFALLAILLWWGWAGLLLDNHAKVTSLMKEYQPGFVPVFQ
FT                   NPAVAIAFASTVLWLVLVWRVGRSMRRAVVNWASGITLIWILAMTLWLPWLDSGKSYRG
FT                   MVASLSAAMPAEANCVARNASLGDAQRAMLHYFGNIITRRDPARFCELRLIQGEKISRP
FT                   LMDESRYEKIWEGSRKTDNHEQYRLYKEIKK"
FT   gene            complement(579861..581279)
FT                   /locus_tag="Galf_0530"
FT   CDS_pept        complement(579861..581279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0530"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: slt:Slit_0344
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54573"
FT                   /db_xref="GOA:D9SCA8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA8"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADL54573.1"
FT                   /translation="MRFLIIPLIAALLSGCAQNPVTGSNDFVMMSEKQEVAIGRQNDEQ
FT                   IKKQYKVYGSRALQDYVNRIGQKIAKQSHRPGLQYHFTVLDTPDINAFALPGGYVYITR
FT                   GIMAYLNSEAELAAVLGHEIGHVTARHGVRQQSAAQAANIGMTIASLFVPGINTMGGSN
FT                   LTNLIGGALLSGYGRDHELEADKLGAEYLARTDYDPQAIITVIGVLKNQELQDAILAKQ
FT                   EGREPRRYHGVFASHPDNDTRLKQAVAESDKLTSATHFTGRREFLAATEGLIFNENSDQ
FT                   GVVRYNAFYHGELGIALQFPKTWQIHNLPTSLIAVSPNGDVKMQMKLDEMPKGTPEAYT
FT                   RRMTSYSAQITNTYINGLPAALFEQPDTAGGVVFHDKQAFVLQAKGKDNNLLAAHRDEV
FT                   IRTVKSFHSITSDERQFLKPLTLHVITAKKGDSYAELAQDSPLGQSAENYLRLINANFP
FT                   DGEPVAGQQIKLVR"
FT   gene            complement(581394..581606)
FT                   /locus_tag="Galf_0531"
FT   CDS_pept        complement(581394..581606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0531"
FT                   /product="ribosomal protein L31"
FT                   /note="KEGG: slt:Slit_0345 ribosomal protein L31; TIGRFAM:
FT                   ribosomal protein L31; PFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54574"
FT                   /db_xref="GOA:D9SCA9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCA9"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ADL54574.1"
FT                   /translation="MKANTHPDYHEITVTCSCGNCFKTNSSMAKTTLSIEVCSECHPFY
FT                   TGTQKIVDTAGRIDKFRQKYATKAA"
FT   gene            complement(581744..582436)
FT                   /locus_tag="Galf_0532"
FT   CDS_pept        complement(581744..582436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0532"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: slt:Slit_0741 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54575"
FT                   /db_xref="GOA:D9SCB0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB0"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADL54575.1"
FT                   /translation="MSHAQEARRLLRAHRYGALSTLSKKLAGFPFGSITPYLTDHDGSL
FT                   IILISALAEHTKNIKQDPRVSLITHNQSSPDIQMQGRVTATGLAEPIRDHQSIVHRYLR
FT                   HFPEADDLLKLDFAFYRIIPVAIRHIAGVGQIHWINKEDYAAHAAEDFSAHEATLLRHI
FT                   NNEQQDALCQQLQRSHDVRSSSASAYGLDCDGLDVRTASHSFRLDFSQPLTHPKQFTSL
FT                   TELTFRSP"
FT   gene            complement(582433..583035)
FT                   /locus_tag="Galf_0533"
FT   CDS_pept        complement(582433..583035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0533"
FT                   /product="flavoprotein WrbA"
FT                   /note="KEGG: flavoprotein WrbA; TIGRFAM: flavoprotein WrbA;
FT                   PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54576"
FT                   /db_xref="GOA:D9SCB1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB1"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ADL54576.1"
FT                   /translation="MITDKEILVLYYSQHGATRQMAQLIARGIETIPGARARVRTVPKI
FT                   SAVCEATESAIPDNGAPYAELSDLEACAGLALGSPTRFGNMAGAMKHFWDGTSELWMKH
FT                   ALVGKPAALFTSSSSLHGGQESTLLSMMLPLLHHGMLITGIPYSEPELAATQSGGTPYG
FT                   ASHVAGLTSDMAISETEKKLCMALGRRLAQTALKLSS"
FT   gene            583064..584266
FT                   /locus_tag="Galf_0534"
FT   CDS_pept        583064..584266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0534"
FT                   /product="ribonuclease BN"
FT                   /note="KEGG: slt:Slit_0742 ribonuclease BN; TIGRFAM:
FT                   ribonuclease BN; PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54577"
FT                   /db_xref="GOA:D9SCB2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB2"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADL54577.1"
FT                   /translation="MQSQELFSFIRFVAARFRQDRCVQIASSLTFTTLLSVVPLITIAL
FT                   TLFSAFPVFGDFSTQIKTYLLGNLMPETAGRVITHYMEQFAESAGRLSALGVLFLTVTA
FT                   MLMMLTIDHAFNIIWRVSRPRTLLKRLVIYWAVLTLAPVLVGASLSLTSWLVGLSMGYA
FT                   KNIPFFGVGMLKALPVIFTTLAFAMLFRLVPNRYVPLSHALIGGIVASALFETMNRVFG
FT                   YYISHFPTYKLVYGAFASVPIFLMWVYFSWLTILLGAVVAASLPHWRTTEAPYLPAVVK
FT                   MLDALRVLKLMSDGMRQGVVMTIPALSSKLHLGFFTLEEIIERLVSADLVRKAEGHGWL
FT                   MMRDAAHIQASELLHLFVLDRSSLLVEEGDDPLKQWLAKCAASLESNTAVSLQTLFDEA
FT                   V"
FT   gene            584347..585150
FT                   /locus_tag="Galf_0535"
FT   CDS_pept        584347..585150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0535"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: slt:Slit_0690 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54578"
FT                   /db_xref="GOA:D9SCB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL54578.1"
FT                   /translation="MPAPSLVEIRDLNFTYDKRPVLQGINMTFPKGKLVAIMGLSGCGK
FT                   TTLLRHIGGALKPTRGYVKFDGQLMHELDPKALYLMRRKMGMLFQFGALFTDMSVYDNV
FT                   AFQMREHTDLSEEMIHNLVIMKLNAVGLRGAQHMMPSELSGGMARRVALARTMALDPML
FT                   VMYDEPFAGLDPISMTVIGDLIRSLNDALGATSIIVTHDIQESLKIVDYVYFMANGVIV
FT                   AEGTPDELRACDTDFVRQFVHGEMDGPVPFHYPGVDYRQALNLRA"
FT   gene            585155..585943
FT                   /locus_tag="Galf_0536"
FT   CDS_pept        585155..585943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0536"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   slt:Slit_0691 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54579"
FT                   /db_xref="GOA:D9SCB4"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB4"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADL54579.1"
FT                   /translation="MAVVKTISAIGHRIVDTVWRIGVAARFFFLTLLYSGNCLRRFHLV
FT                   IKELFSTGVMSLIIIIVAGLFVGMVLGLQGYETLKRYGSESALGVMVALGLVRELGPVM
FT                   AALLFASRAGSAMTAEIGLMKATEQISAMEMMAVNPIARIVAPRFWAGVISMPLLAALF
FT                   SAVGIFGGYLVGVVQIGVDEGSFWSQMQAAVDFREDIMNGIIKSVVFGTVVTVIALFEG
FT                   FDAPPTAEGVSGATTRTVVTSSLAILMLDFVLTAIMFRGA"
FT   gene            585947..586423
FT                   /locus_tag="Galf_0537"
FT   CDS_pept        585947..586423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0537"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: slt:Slit_0692 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54580"
FT                   /db_xref="GOA:D9SCB5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB5"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADL54580.1"
FT                   /translation="MERTTLDLWVGMFVVAGIGALVMLAMKVGNLGTYNVSETYQVHAY
FT                   FSNIGGLKPKASIRSAGVLVGRVTSISLDTERYEANVVMNVDKRYQFPKDTFANILTSG
FT                   LLGEQYIGLVPGGETEMIKDGDLLKQTQSAMVLEDLIGKFMYSKAAEPAKEESK"
FT   gene            586420..587037
FT                   /locus_tag="Galf_0538"
FT   CDS_pept        586420..587037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0538"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   slt:Slit_0693 toluene tolerance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54581"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB6"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ADL54581.1"
FT                   /translation="MKRILLSMVVGLSCVTAQAEIQAPDAMIKDVAQEVIVIIKQDAGS
FT                   KADNQKKILALVDARVLPNFDFTHMTQLAVGRYWRQATPEQQKALVAEFRNMLVRTYAN
FT                   ALSMYRDQKIEVRPVKMNAGDKEVVVNTRIIKSSGQPTLVDYKMEKEADGWKVYDVVIE
FT                   AVSLVTNYRGQFATTIQQSGIDGLIKELSGMNAGSVRKADVK"
FT   sig_peptide     586420..586479
FT                   /locus_tag="Galf_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            587034..587312
FT                   /locus_tag="Galf_0539"
FT   CDS_pept        587034..587312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0539"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: slt:Slit_0694 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54582"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB7"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADL54582.1"
FT                   /translation="MIEQTEDALLLSGRLTMSTVPALYESGLKVLAEKDLLVDMSRVET
FT                   VDSAAVSMLLGWSRAAQARQGALRVTGMPASLLSLANLYGVADMLPH"
FT   gene            587363..587605
FT                   /locus_tag="Galf_0540"
FT   CDS_pept        587363..587605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0540"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: bgl:bglu_1g03280
FT                   predicted transcriptional regulator, BolA superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54583"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB8"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ADL54583.1"
FT                   /translation="MVTPESIQQDIASNMATTHLTVTGDGQHFEAIVVSQEFSGKSRIG
FT                   RQQLVYKTLGDRMKGEIHALSMKTYTPEEWAQASN"
FT   gene            587636..588886
FT                   /locus_tag="Galf_0541"
FT   CDS_pept        587636..588886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0541"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: slt:Slit_0695 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54584"
FT                   /db_xref="GOA:D9SCB9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCB9"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADL54584.1"
FT                   /translation="MQKLAIQGGYRLKGEVKISGAKNAALPIMCASLLTADALHLSNLP
FT                   DMHDVKTMVRLLQQMGVRIASGDQTATFNAGAVDKLEAPYDMVKTMRAAILVLGPLLTR
FT                   FGEARVSLPGGCAIGSRPVDLHIKGLQAMGASIHIEHGYIHATAKRLQGARICFDLISV
FT                   TGTENLMMAGVLAEGVTVLENAAREPEVVDLANCLIAMGAKIEGAGSDKITIFGVDALH
FT                   GAEYAVMPDRIESGTFLVAAAATGGQITLTGARADTLDNVLDKLREAGALIEVDGERIS
FT                   IAMNGRPRAVNLRTAPYPAFPTDMQAQFMAMNAIAEGSSKVVETIFENRFMHVQELQRL
FT                   GALIEIEGNTAVIQGRAQLEGANVMATDLRASASLVIAGMVAQGETIVDRIYHLDRGYE
FT                   HIEAKLSALGAKIRRIQ"
FT   gene            588973..589611
FT                   /locus_tag="Galf_0542"
FT   CDS_pept        588973..589611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0542"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   slt:Slit_0696 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54585"
FT                   /db_xref="GOA:D9SCC0"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC0"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADL54585.1"
FT                   /translation="MITIALSKGRIFEETMPLLAAAGITALDDPETSRKLILDTNRSDV
FT                   RLIIVRASDVPTYVQYGAADIGVAGKDVLNEHGGQGLYQPLDLNIARCRMMVAVRDDFD
FT                   YESAVKQGARLRVATKYVNAAREHFAAKGVHIDLIKLYGSMELAPLVGLSDVIVDLVSS
FT                   GGTLRANHLKAVEHISDVSSRLVVNQAALKLKRDKIQPMLDAFAQALIK"
FT   gene            589621..590922
FT                   /locus_tag="Galf_0543"
FT   CDS_pept        589621..590922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0543"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   slt:Slit_0697 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54586"
FT                   /db_xref="GOA:D9SCC1"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC1"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADL54586.1"
FT                   /translation="MKIKQLSSSDANFSAELTALLAFEETADEKLEATVAAILSDVKNR
FT                   GDAAVLEYTSRFDRLTIADAAGMELPRAELRAAFDGLPVEQRVALEAAAARVTEYHQKQ
FT                   VQASWRYEDADGTLLGQQVTPLDRVGLYVPGGKAAYPSSVLMNALPAKVAGVAELIMVV
FT                   PTPDGLKNQLVLAAAYLSGVDRVFTIGGAQAVAALAYGTATIPKVDKIVGPGNAYVAAA
FT                   KRRVFGICGIDMIAGPSEILVICDGHTNPDWIAMDLFSQAEHDELAQAILLSPDADFIA
FT                   AVAASANRLLEQMPRRDIIRTALENRGALIHVASLDEACEISNRIAPEHLEMSVEQPED
FT                   YLPKLKHAGAIFMGRYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIQVS
FT                   PQGAKTLGKIAATLALGEGLQAHAQSAMYRSEIN"
FT   gene            590974..591058
FT                   /locus_tag="Galf_R0016"
FT                   /note="tRNA-Tyr1"
FT   tRNA            590974..591058
FT                   /locus_tag="Galf_R0016"
FT                   /product="tRNA-Tyr"
FT   gene            591121..591194
FT                   /locus_tag="Galf_R0017"
FT                   /note="tRNA-Gly2"
FT   tRNA            591121..591194
FT                   /locus_tag="Galf_R0017"
FT                   /product="tRNA-Gly"
FT   gene            591205..591279
FT                   /locus_tag="Galf_R0018"
FT                   /note="tRNA-Thr1"
FT   tRNA            591205..591279
FT                   /locus_tag="Galf_R0018"
FT                   /product="tRNA-Thr"
FT   gene            591325..592515
FT                   /locus_tag="Galf_0544"
FT   CDS_pept        591325..592515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0544"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: mei:Msip34_0299 translation elongation factor
FT                   Tu; TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain-containing
FT                   protein; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54587"
FT                   /db_xref="GOA:D9SCC2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC2"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADL54587.1"
FT                   /translation="MAKSKFERTKPHVNVGTIGHVDHGKTTLTAAITMVLCKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLSKYDF
FT                   PGDDIPVIKGSAMLAIKGDQSDIGEPAIFRLAEALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEIEIVGIKPTLKTTCTGVEMFRKLLDQGQAGDNVGVLL
FT                   RGTKREEVERGQVLCKPGSIKPHTKFTAEIYVLGKEEGGRHTPFFQGYRPQFYFRTTDV
FT                   TGAVELPAGTEMVMPGDNVSITVALINPIAMEEGLRFAIREGGRTVGAGVVAKVIE"
FT   gene            592584..592659
FT                   /locus_tag="Galf_R0019"
FT                   /note="tRNA-Trp1"
FT   tRNA            592584..592659
FT                   /locus_tag="Galf_R0019"
FT                   /product="tRNA-Trp"
FT   gene            592694..593041
FT                   /locus_tag="Galf_0545"
FT   CDS_pept        592694..593041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0545"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: slt:Slit_0754 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54588"
FT                   /db_xref="GOA:D9SCC3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC3"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADL54588.1"
FT                   /translation="MSDKIKLLFAFLLVVAGIAGYYYLHDSAAVLRLLSVLAGVLLAVG
FT                   VASTSESGRQFIAFGRDSIAEAKRVVWPTRKETLQTTGVVILFAITMALFLWLVDASLM
FT                   TMVNKLMGRAE"
FT   sig_peptide     592694..592768
FT                   /locus_tag="Galf_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.725 at
FT                   residue 25"
FT   gene            593041..593574
FT                   /locus_tag="Galf_0546"
FT   CDS_pept        593041..593574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0546"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: slt:Slit_0755 NusG antitermination
FT                   factor; SMART: NGN domain-containing protein; KOW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54589"
FT                   /db_xref="GOA:D9SCC4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC4"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADL54589.1"
FT                   /translation="MAMSWYVVHTYSQFEKSVSRALVERIAREGMQEKFGQILVPVEEV
FT                   VELKGGQKVTSERKFFPGYVLVEMEMTDESWHLVKNTPKVTGFLGGSAMRPTPISEKEV
FT                   QNIMQQMQAGVEKPRPKVLFEVGESVRVKEGPFTDFTGMVEEVNYDKNKIRVAVTIFGR
FT                   ATPVELDFGQVEKG"
FT   gene            593697..594128
FT                   /locus_tag="Galf_0547"
FT   CDS_pept        593697..594128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0547"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: slt:Slit_0756 ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54590"
FT                   /db_xref="GOA:D9SCC5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC5"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADL54590.1"
FT                   /translation="MAKKVIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAA
FT                   TQGVEPGLPIPVVITAFADKSFTFIMKTPPATILIKKAVGIQKGSATPHTVKVGHLTRK
FT                   QAEEIATTKMADLTAANMDAAVRIIAGSARSIGITVEGE"
FT   gene            594128..594814
FT                   /locus_tag="Galf_0548"
FT   CDS_pept        594128..594814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0548"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: slt:Slit_0757 ribosomal protein L1; TIGRFAM:
FT                   ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54591"
FT                   /db_xref="GOA:D9SCC6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC6"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADL54591.1"
FT                   /translation="MSKRYKAIATKVDRNKLYALTDALALVKENAVAKFDESIDVAVNL
FT                   GIDARKSDQLVRGSVVLPRGTGKTVRVAVFAQGAKAEEARAAGADIVGFDDLAESIKAG
FT                   NLDFDVVIASPDAMRLVGQLGQVLGPRGLMPNPKVGTVSADVAGAVRNAKAGQVQYRND
FT                   KNGIIQCTIGRASFAPEALRENLLALIDALAKAKPAASKGVFMKKVSLSSTMGVGVRVD
FT                   QASFTA"
FT   gene            595112..595642
FT                   /locus_tag="Galf_0549"
FT   CDS_pept        595112..595642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0549"
FT                   /product="ribosomal protein L10"
FT                   /note="KEGG: slt:Slit_0758 ribosomal protein L10; manually
FT                   curated; PFAM: ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54592"
FT                   /db_xref="GOA:D9SCC7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC7"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADL54592.1"
FT                   /translation="MSLNLQEKQTVVAEVSAQVAQSQTIVLAEYRGIKVADITKLRATA
FT                   RESGVYLHVLKNTLARRAVQGTSFEALADSMVGPLVYSMSADAVAAAKVMCEFAKTNPL
FT                   LVVKAGSMAGSVMSADQVAVLAATPSRDELIARLMATMNATTAKFVRTLAAIRDANGVV
FT                   DAPAEVAAEAAAV"
FT   gene            595667..596038
FT                   /locus_tag="Galf_0550"
FT   CDS_pept        595667..596038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0550"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: mei:Msip34_0293 ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54593"
FT                   /db_xref="GOA:D9SCC8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC8"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADL54593.1"
FT                   /translation="MAITNAELMDAVASMTVLELSELIKQMEEKFGVSAAAVAVAGPAA
FT                   GPAAAAAEQSEFDVILATVGDNKVSVIKAVRVITGLGLKEAKDLVDAAPKVVKEGVSKA
FT                   DADAIAKQLIEAGATAEVK"
FT   gene            596164..600243
FT                   /locus_tag="Galf_0551"
FT   CDS_pept        596164..600243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0551"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: slt:Slit_0760 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 2; RNA polymerase Rpb2 domain 3; RNA polymerase
FT                   Rpb2 domain 7; RNA polymerase beta subunit; DNA-directed
FT                   RNA polymerase, beta subunit, external 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54594"
FT                   /db_xref="GOA:D9SCC9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCC9"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADL54594.1"
FT                   /translation="MSYSFTEKKRIRKSFGKRIGALPVPFLLSTQLEAFAAFLQEATAP
FT                   EKRKNEGLQAAFNGIFPIESHSKNARLDFVSYMLGTPAFDVKECQQRGLTYASPLRARV
FT                   RLTIMDKEASKPTVKEVKEQEVYMGEMPLMTNTGSFVINGTERVIVSQLHRSPGVFFEH
FT                   DRGKTHSSGKLLFSARIIPYRGSWLDFEFDAKDYVYFRIDRRRKMPVTILLRSLGYTNE
FT                   DMLGMFYEFDTFQLGKKGGIQFEVVAERLRGEIARFDILDKSGKTIVATDKRITVRHIR
FT                   QMQEAGIDKLAVADDFLLGRVIANNVIDKESGEIIANANDVMTEELLRKLQDANVTKLN
FT                   TLYTNDLDQGAYISQTLRTDETTDKWTARVAIYRMMRPGEPPTEESVEGLFNGLFFSEE
FT                   RYDLSVVGRMKFNRRVGREELTGSPILSNEDIVAVVKILVELRNGRGEIDDIDHLGNRR
FT                   VRAVGELAENQFRVGLARVERAVKERLGQAEADNLMPHDLINAKPISAAIKEFFGSSQL
FT                   SQFMDQTNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIG
FT                   LINSLALYARTNEYGFIETPYRKVTNGCVSNDVDYLSAIEESTYTIAQANAELDKKGRF
FT                   TDDIVSARRHNEFVLAAPDTINYMDVSPSQVVSVAACLIPFLEHDDANRALMGANMSRQ
FT                   AVPCLRAEKPLVGTGIERTVALDSGTAVQAIRGGRIDYVDAARIVVRVNDEETTAGEVG
FT                   VDIYNLIKYTRSNQNTNINQRPLVKVGDVIARGDVVADGASTDMGELALGQNVLVAFMP
FT                   WNGYNYEDSILISERIIAQDRFTSIHIEELTVVARDTKLGTEEITRDIPNLSEVQLGRL
FT                   DDCGIVHIGAEVAVGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVSAGS
FT                   SGTVIDVQVFTREGLQRDKRAQQIVDDELNRYKKDLADQMRIVESDAFTRLEKLLLDKV
FT                   ANGGPKKLAKGSLLTADYLSGVEHHQWFDIRLADDEVAAQMEQVKDGLAQKRLEFDAAF
FT                   ELKKKKMTQGDELQAGVQKMVKVYVAVKRRLQPGDKMAGRHGNKGVISRIVPVEDMPYM
FT                   ADGTPVDVVLNPLGVPSRMNIGQILETHLGWAANGLGKKIDQMLQTNAKITELRGFLDK
FT                   IYNNNNGQSVDFKSFTDDEIIELCRNLRKGVPFATPVFDGASEEEIKYMLALADLPLSG
FT                   QTTLHDGRTGEAFDRPVTVGYKHVLKLHHLVDDKMHARSTGPYSLVTQQPLGGKAQFGG
FT                   QRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYENIVKGDHKIDAGMPESFNVV
FT                   IKEIRSLAIDMDLERN"
FT   gene            600341..604588
FT                   /locus_tag="Galf_0552"
FT   CDS_pept        600341..604588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0552"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; KEGG:
FT                   slt:Slit_0761 DNA-directed RNA polymerase, beta' subunit;
FT                   SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54595"
FT                   /db_xref="GOA:D9SCD0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCD0"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADL54595.1"
FT                   /translation="MKSLLDLFKQVTQKEEFDAIKIGLASPEKIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTLSKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVTEPGMTPLNRGQLLSDD
FT                   DYLAKTEEYGDEFTALMGAEGVRALLSGLDVMSEIETLRADLQATGSETKIKKYAKRLK
FT                   VLEAFSASGIKPQWMVLEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLRR
FT                   LLELKAPDIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRQLKSLADMIKGKSGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPQLKLHQCGLPKKMALELFKPFIFSRLEAMGLATTIKASKR
FT                   MVEAEEPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCTAFN
FT                   ADFDGDQMAVHVPLSLEAQMECRTLLLASNNVLSPANGEPIIVPSQDIVLGLYYMTREN
FT                   IGVKGEGSMFANIAEVSRAYESREVDLQAKVIVRLKEFHKDEAGEFVEKLVRHDTTVGR
FT                   ALLSEVLPAGLPFALINKALKKKEISRLINASFRQCGLRDTVIMADKLMYTGFTYATRA
FT                   GISICIDDMLMPPEKADLIGAAEKEVMEIHTQYTSGLVTDGERYNKVVDIWGRTGDMVA
FT                   KAMMDQLSSEPVLDRITGEVRMTNGKPMMQESLNSIYMMADSGARGSAAQIRQLSGMRG
FT                   LMAKPDGSIIETPITANFREGLSMLQYFISTHGARKGLADTALKTANSGYLTRRLVDVT
FT                   QDLVVVEEDCGTVNGAMMKAIVEGGEVIEALRERILGRVLSRDVVNPESGETLYEIGCL
FT                   LDETAVERIEALGVDEVEVRAPLKCETRFGLCAKCYGRDLGRGSMVNVGEAVGVIAAQS
FT                   IGEPGTQLTMRTFHVGGAASRNVVASQVEGKSNGVLKYSPNMRVVTTLRGEAIVVARSA
FT                   EIIIADDYGRERERHKIPYGATLVIKEGAAVRAGEVLATWDPHTRPIITEYAGRVSFQN
FT                   VEEGVTVAKQIDEVTGLSTLVVIDPKQRTAAQNKAGTMVRPMVRLFDESGEDVKLTGTE
FT                   TAVSVTFQTGCIITVEDGQMVGIGDVLARIPQESSKTRDITGGLPRVAELFEARIPKDA
FT                   GMLAECTGTVSFGKETKGKQRLVITDVEGLASEFLIPKEKHVLVHDGQMVTRGEMIVDG
FT                   PADPHDILRLLGVAELARYITDEVQEVYRLQGVKINDKHIEVIVRQMLRRVQVKEVGDT
FT                   RFIVGEQVERADLLEENEKMSAAGKEPATFEFMLLGITKASLSTDSFISAASFQETTRV
FT                   LTEAAIMGKRDELRGLKENVIVGRLIPAGTGMAYHNARRKQGLGIDMAQGRDFMAAESA
FT                   PAGELLDSAVVSE"
FT   gene            604700..605074
FT                   /locus_tag="Galf_0553"
FT   CDS_pept        604700..605074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0553"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: mmb:Mmol_0340 ribosomal protein S12; TIGRFAM:
FT                   ribosomal protein S12; PFAM: ribosomal protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54596"
FT                   /db_xref="GOA:D9SCD1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCD1"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADL54596.1"
FT                   /translation="MPTINQLIRKPRVAIVEKSKVPALGSSPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDT
FT                   AGVKDRKQSRSKYGTKRPKK"
FT   gene            605117..605587
FT                   /locus_tag="Galf_0554"
FT   CDS_pept        605117..605587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0554"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: slt:Slit_0763 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54597"
FT                   /db_xref="GOA:D9SCD2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D9SCD2"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADL54597.1"
FT                   /translation="MPRRREVPKREVLPDPKFGNQDLSKFVNVLMTAGKKSVAERILYG
FT                   ALEQVGKKTGKDAIEIFNLALTNAKPQVEVKSRRVGGANYQVPVEVRPSRRMALSMRWL
FT                   REAARKRGEKSMGMRLAGELIDASEGRGGAVKKREEVHRMAEANKAFSHFRF"
FT   gene            605624..607717
FT                   /locus_tag="Galf_0555"
FT   CDS_pept        605624..607717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Galf_0555"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: slt:Slit_0764 translation elongation factor G;
FT                   TIGRFAM: translation elongation factor G; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain IV; elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Galf_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL54598"
FT                   /db_xref="GOA:D9SCD3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro