(data stored in ACNUC7421 zone)

EMBL: CP002160

ID   CP002160; SV 1; circular; genomic DNA; STD; PRO; 5262222 BP.
XX
AC   CP002160; ACPD01000000-ACPD01000160;
XX
PR   Project:PRJNA32609;
XX
DT   14-AUG-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Clostridium cellulovorans 743B, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Clostridium cellulovorans 743B
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-5262222
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N., Mikhailova N.,
RA   Hemme C.L., Woyke T.;
RT   "Complete sequence of Clostridium cellulovorans 743B";
RL   Unpublished.
XX
RN   [2]
RP   1-5262222
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N., Mikhailova N.,
RA   Hemme C.L., Woyke T.;
RT   ;
RL   Submitted (04-AUG-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a081268b1387412d3b826ba75191789f.
DR   BioSample; SAMN00002614.
DR   EnsemblGenomes-Gn; Clocel_R0001.
DR   EnsemblGenomes-Gn; Clocel_R0002.
DR   EnsemblGenomes-Gn; Clocel_R0003.
DR   EnsemblGenomes-Gn; Clocel_R0004.
DR   EnsemblGenomes-Gn; Clocel_R0005.
DR   EnsemblGenomes-Gn; Clocel_R0006.
DR   EnsemblGenomes-Gn; Clocel_R0007.
DR   EnsemblGenomes-Gn; Clocel_R0008.
DR   EnsemblGenomes-Gn; Clocel_R0009.
DR   EnsemblGenomes-Gn; Clocel_R0010.
DR   EnsemblGenomes-Gn; Clocel_R0011.
DR   EnsemblGenomes-Gn; Clocel_R0012.
DR   EnsemblGenomes-Gn; Clocel_R0013.
DR   EnsemblGenomes-Gn; Clocel_R0014.
DR   EnsemblGenomes-Gn; Clocel_R0015.
DR   EnsemblGenomes-Gn; Clocel_R0016.
DR   EnsemblGenomes-Gn; Clocel_R0017.
DR   EnsemblGenomes-Gn; Clocel_R0018.
DR   EnsemblGenomes-Gn; Clocel_R0019.
DR   EnsemblGenomes-Gn; Clocel_R0020.
DR   EnsemblGenomes-Gn; Clocel_R0021.
DR   EnsemblGenomes-Gn; Clocel_R0022.
DR   EnsemblGenomes-Gn; Clocel_R0023.
DR   EnsemblGenomes-Gn; Clocel_R0024.
DR   EnsemblGenomes-Gn; Clocel_R0025.
DR   EnsemblGenomes-Gn; Clocel_R0026.
DR   EnsemblGenomes-Gn; Clocel_R0027.
DR   EnsemblGenomes-Gn; Clocel_R0028.
DR   EnsemblGenomes-Gn; Clocel_R0029.
DR   EnsemblGenomes-Gn; Clocel_R0030.
DR   EnsemblGenomes-Gn; Clocel_R0031.
DR   EnsemblGenomes-Gn; Clocel_R0032.
DR   EnsemblGenomes-Gn; Clocel_R0033.
DR   EnsemblGenomes-Gn; Clocel_R0034.
DR   EnsemblGenomes-Gn; Clocel_R0035.
DR   EnsemblGenomes-Gn; Clocel_R0036.
DR   EnsemblGenomes-Gn; Clocel_R0037.
DR   EnsemblGenomes-Gn; Clocel_R0038.
DR   EnsemblGenomes-Gn; Clocel_R0039.
DR   EnsemblGenomes-Gn; Clocel_R0040.
DR   EnsemblGenomes-Gn; Clocel_R0041.
DR   EnsemblGenomes-Gn; Clocel_R0042.
DR   EnsemblGenomes-Gn; Clocel_R0043.
DR   EnsemblGenomes-Gn; Clocel_R0044.
DR   EnsemblGenomes-Gn; Clocel_R0045.
DR   EnsemblGenomes-Gn; Clocel_R0046.
DR   EnsemblGenomes-Gn; Clocel_R0047.
DR   EnsemblGenomes-Gn; Clocel_R0048.
DR   EnsemblGenomes-Gn; Clocel_R0049.
DR   EnsemblGenomes-Gn; Clocel_R0050.
DR   EnsemblGenomes-Gn; Clocel_R0051.
DR   EnsemblGenomes-Gn; Clocel_R0052.
DR   EnsemblGenomes-Gn; Clocel_R0053.
DR   EnsemblGenomes-Gn; Clocel_R0054.
DR   EnsemblGenomes-Gn; Clocel_R0055.
DR   EnsemblGenomes-Gn; Clocel_R0056.
DR   EnsemblGenomes-Gn; Clocel_R0057.
DR   EnsemblGenomes-Gn; Clocel_R0058.
DR   EnsemblGenomes-Gn; Clocel_R0059.
DR   EnsemblGenomes-Gn; Clocel_R0060.
DR   EnsemblGenomes-Gn; Clocel_R0061.
DR   EnsemblGenomes-Gn; Clocel_R0062.
DR   EnsemblGenomes-Gn; Clocel_R0063.
DR   EnsemblGenomes-Gn; Clocel_R0064.
DR   EnsemblGenomes-Gn; Clocel_R0065.
DR   EnsemblGenomes-Gn; Clocel_R0066.
DR   EnsemblGenomes-Gn; Clocel_R0067.
DR   EnsemblGenomes-Gn; Clocel_R0068.
DR   EnsemblGenomes-Gn; Clocel_R0069.
DR   EnsemblGenomes-Gn; Clocel_R0070.
DR   EnsemblGenomes-Gn; Clocel_R0071.
DR   EnsemblGenomes-Gn; Clocel_R0072.
DR   EnsemblGenomes-Gn; Clocel_R0073.
DR   EnsemblGenomes-Gn; Clocel_R0074.
DR   EnsemblGenomes-Gn; Clocel_R0075.
DR   EnsemblGenomes-Gn; Clocel_R0076.
DR   EnsemblGenomes-Gn; Clocel_R0077.
DR   EnsemblGenomes-Gn; Clocel_R0078.
DR   EnsemblGenomes-Gn; Clocel_R0079.
DR   EnsemblGenomes-Gn; Clocel_R0080.
DR   EnsemblGenomes-Gn; Clocel_R0081.
DR   EnsemblGenomes-Gn; Clocel_R0082.
DR   EnsemblGenomes-Gn; Clocel_R0083.
DR   EnsemblGenomes-Gn; Clocel_R0084.
DR   EnsemblGenomes-Gn; Clocel_R0085.
DR   EnsemblGenomes-Gn; Clocel_R0086.
DR   EnsemblGenomes-Gn; Clocel_R0087.
DR   EnsemblGenomes-Gn; Clocel_R0088.
DR   EnsemblGenomes-Gn; Clocel_R0089.
DR   EnsemblGenomes-Gn; Clocel_R0090.
DR   EnsemblGenomes-Gn; Clocel_R0091.
DR   EnsemblGenomes-Gn; Clocel_R0092.
DR   EnsemblGenomes-Gn; Clocel_R0093.
DR   EnsemblGenomes-Gn; Clocel_R0094.
DR   EnsemblGenomes-Gn; Clocel_R0095.
DR   EnsemblGenomes-Gn; Clocel_R0096.
DR   EnsemblGenomes-Gn; Clocel_R0097.
DR   EnsemblGenomes-Gn; Clocel_R0098.
DR   EnsemblGenomes-Gn; Clocel_R0099.
DR   EnsemblGenomes-Gn; Clocel_R0100.
DR   EnsemblGenomes-Gn; Clocel_R0101.
DR   EnsemblGenomes-Gn; Clocel_R0102.
DR   EnsemblGenomes-Gn; Clocel_R0103.
DR   EnsemblGenomes-Gn; Clocel_R0104.
DR   EnsemblGenomes-Gn; Clocel_R0105.
DR   EnsemblGenomes-Gn; Clocel_R0106.
DR   EnsemblGenomes-Gn; Clocel_R0107.
DR   EnsemblGenomes-Gn; Clocel_R0108.
DR   EnsemblGenomes-Gn; Clocel_R0109.
DR   EnsemblGenomes-Gn; Clocel_R0110.
DR   EnsemblGenomes-Gn; Clocel_R0111.
DR   EnsemblGenomes-Gn; Clocel_R0112.
DR   EnsemblGenomes-Gn; EBG00001012993.
DR   EnsemblGenomes-Gn; EBG00001012994.
DR   EnsemblGenomes-Gn; EBG00001012995.
DR   EnsemblGenomes-Gn; EBG00001012996.
DR   EnsemblGenomes-Gn; EBG00001012997.
DR   EnsemblGenomes-Gn; EBG00001012998.
DR   EnsemblGenomes-Gn; EBG00001012999.
DR   EnsemblGenomes-Gn; EBG00001013000.
DR   EnsemblGenomes-Gn; EBG00001013001.
DR   EnsemblGenomes-Gn; EBG00001013002.
DR   EnsemblGenomes-Gn; EBG00001013003.
DR   EnsemblGenomes-Gn; EBG00001013004.
DR   EnsemblGenomes-Gn; EBG00001013005.
DR   EnsemblGenomes-Gn; EBG00001013006.
DR   EnsemblGenomes-Gn; EBG00001013007.
DR   EnsemblGenomes-Gn; EBG00001013008.
DR   EnsemblGenomes-Gn; EBG00001013009.
DR   EnsemblGenomes-Gn; EBG00001013010.
DR   EnsemblGenomes-Gn; EBG00001013011.
DR   EnsemblGenomes-Gn; EBG00001013012.
DR   EnsemblGenomes-Gn; EBG00001013013.
DR   EnsemblGenomes-Gn; EBG00001013014.
DR   EnsemblGenomes-Gn; EBG00001013015.
DR   EnsemblGenomes-Gn; EBG00001013016.
DR   EnsemblGenomes-Gn; EBG00001013017.
DR   EnsemblGenomes-Gn; EBG00001013018.
DR   EnsemblGenomes-Gn; EBG00001013019.
DR   EnsemblGenomes-Gn; EBG00001013020.
DR   EnsemblGenomes-Gn; EBG00001013021.
DR   EnsemblGenomes-Gn; EBG00001013022.
DR   EnsemblGenomes-Gn; EBG00001013023.
DR   EnsemblGenomes-Gn; EBG00001013024.
DR   EnsemblGenomes-Gn; EBG00001013025.
DR   EnsemblGenomes-Gn; EBG00001013026.
DR   EnsemblGenomes-Gn; EBG00001013027.
DR   EnsemblGenomes-Gn; EBG00001013028.
DR   EnsemblGenomes-Gn; EBG00001013029.
DR   EnsemblGenomes-Gn; EBG00001013030.
DR   EnsemblGenomes-Gn; EBG00001013031.
DR   EnsemblGenomes-Gn; EBG00001013032.
DR   EnsemblGenomes-Gn; EBG00001013033.
DR   EnsemblGenomes-Gn; EBG00001013034.
DR   EnsemblGenomes-Gn; EBG00001013035.
DR   EnsemblGenomes-Gn; EBG00001013036.
DR   EnsemblGenomes-Gn; EBG00001013037.
DR   EnsemblGenomes-Gn; EBG00001013038.
DR   EnsemblGenomes-Gn; EBG00001013039.
DR   EnsemblGenomes-Gn; EBG00001013040.
DR   EnsemblGenomes-Gn; EBG00001013041.
DR   EnsemblGenomes-Gn; EBG00001013042.
DR   EnsemblGenomes-Gn; EBG00001013043.
DR   EnsemblGenomes-Gn; EBG00001013044.
DR   EnsemblGenomes-Gn; EBG00001013045.
DR   EnsemblGenomes-Gn; EBG00001013046.
DR   EnsemblGenomes-Gn; EBG00001013047.
DR   EnsemblGenomes-Gn; EBG00001013048.
DR   EnsemblGenomes-Gn; EBG00001013049.
DR   EnsemblGenomes-Gn; EBG00001013050.
DR   EnsemblGenomes-Gn; EBG00001013051.
DR   EnsemblGenomes-Gn; EBG00001013052.
DR   EnsemblGenomes-Gn; EBG00001013053.
DR   EnsemblGenomes-Gn; EBG00001013054.
DR   EnsemblGenomes-Gn; EBG00001013055.
DR   EnsemblGenomes-Gn; EBG00001013056.
DR   EnsemblGenomes-Gn; EBG00001013057.
DR   EnsemblGenomes-Gn; EBG00001013058.
DR   EnsemblGenomes-Gn; EBG00001013059.
DR   EnsemblGenomes-Gn; EBG00001013060.
DR   EnsemblGenomes-Gn; EBG00001013061.
DR   EnsemblGenomes-Gn; EBG00001013062.
DR   EnsemblGenomes-Gn; EBG00001013063.
DR   EnsemblGenomes-Gn; EBG00001013064.
DR   EnsemblGenomes-Gn; EBG00001013065.
DR   EnsemblGenomes-Gn; EBG00001013066.
DR   EnsemblGenomes-Gn; EBG00001013067.
DR   EnsemblGenomes-Gn; EBG00001013068.
DR   EnsemblGenomes-Gn; EBG00001013069.
DR   EnsemblGenomes-Gn; EBG00001013070.
DR   EnsemblGenomes-Gn; EBG00001013071.
DR   EnsemblGenomes-Gn; EBG00001013072.
DR   EnsemblGenomes-Gn; EBG00001013073.
DR   EnsemblGenomes-Gn; EBG00001013074.
DR   EnsemblGenomes-Gn; EBG00001013075.
DR   EnsemblGenomes-Gn; EBG00001013076.
DR   EnsemblGenomes-Gn; EBG00001013077.
DR   EnsemblGenomes-Gn; EBG00001013078.
DR   EnsemblGenomes-Gn; EBG00001013079.
DR   EnsemblGenomes-Gn; EBG00001013080.
DR   EnsemblGenomes-Gn; EBG00001013081.
DR   EnsemblGenomes-Gn; EBG00001013082.
DR   EnsemblGenomes-Gn; EBG00001013083.
DR   EnsemblGenomes-Gn; EBG00001013084.
DR   EnsemblGenomes-Gn; EBG00001013085.
DR   EnsemblGenomes-Gn; EBG00001013086.
DR   EnsemblGenomes-Gn; EBG00001013087.
DR   EnsemblGenomes-Gn; EBG00001013088.
DR   EnsemblGenomes-Gn; EBG00001013089.
DR   EnsemblGenomes-Gn; EBG00001013090.
DR   EnsemblGenomes-Gn; EBG00001013091.
DR   EnsemblGenomes-Gn; EBG00001013092.
DR   EnsemblGenomes-Gn; EBG00001013093.
DR   EnsemblGenomes-Gn; EBG00001013094.
DR   EnsemblGenomes-Gn; EBG00001013095.
DR   EnsemblGenomes-Gn; EBG00001013096.
DR   EnsemblGenomes-Gn; EBG00001013097.
DR   EnsemblGenomes-Gn; EBG00001013098.
DR   EnsemblGenomes-Gn; EBG00001013099.
DR   EnsemblGenomes-Gn; EBG00001013100.
DR   EnsemblGenomes-Gn; EBG00001013101.
DR   EnsemblGenomes-Gn; EBG00001013102.
DR   EnsemblGenomes-Gn; EBG00001013103.
DR   EnsemblGenomes-Gn; EBG00001013104.
DR   EnsemblGenomes-Gn; EBG00001013105.
DR   EnsemblGenomes-Gn; EBG00001013106.
DR   EnsemblGenomes-Gn; EBG00001013107.
DR   EnsemblGenomes-Gn; EBG00001013108.
DR   EnsemblGenomes-Gn; EBG00001013109.
DR   EnsemblGenomes-Gn; EBG00001013110.
DR   EnsemblGenomes-Gn; EBG00001013111.
DR   EnsemblGenomes-Gn; EBG00001013112.
DR   EnsemblGenomes-Gn; EBG00001013113.
DR   EnsemblGenomes-Gn; EBG00001013114.
DR   EnsemblGenomes-Tr; Clocel_R0001-1.
DR   EnsemblGenomes-Tr; Clocel_R0002-1.
DR   EnsemblGenomes-Tr; Clocel_R0003-1.
DR   EnsemblGenomes-Tr; Clocel_R0004-1.
DR   EnsemblGenomes-Tr; Clocel_R0005-1.
DR   EnsemblGenomes-Tr; Clocel_R0006-1.
DR   EnsemblGenomes-Tr; Clocel_R0007-1.
DR   EnsemblGenomes-Tr; Clocel_R0008-1.
DR   EnsemblGenomes-Tr; Clocel_R0009-1.
DR   EnsemblGenomes-Tr; Clocel_R0010-1.
DR   EnsemblGenomes-Tr; Clocel_R0011-1.
DR   EnsemblGenomes-Tr; Clocel_R0012-1.
DR   EnsemblGenomes-Tr; Clocel_R0013-1.
DR   EnsemblGenomes-Tr; Clocel_R0014-1.
DR   EnsemblGenomes-Tr; Clocel_R0015-1.
DR   EnsemblGenomes-Tr; Clocel_R0016-1.
DR   EnsemblGenomes-Tr; Clocel_R0017-1.
DR   EnsemblGenomes-Tr; Clocel_R0018-1.
DR   EnsemblGenomes-Tr; Clocel_R0019-1.
DR   EnsemblGenomes-Tr; Clocel_R0020-1.
DR   EnsemblGenomes-Tr; Clocel_R0021-1.
DR   EnsemblGenomes-Tr; Clocel_R0022-1.
DR   EnsemblGenomes-Tr; Clocel_R0023-1.
DR   EnsemblGenomes-Tr; Clocel_R0024-1.
DR   EnsemblGenomes-Tr; Clocel_R0025-1.
DR   EnsemblGenomes-Tr; Clocel_R0026-1.
DR   EnsemblGenomes-Tr; Clocel_R0027-1.
DR   EnsemblGenomes-Tr; Clocel_R0028-1.
DR   EnsemblGenomes-Tr; Clocel_R0029-1.
DR   EnsemblGenomes-Tr; Clocel_R0030-1.
DR   EnsemblGenomes-Tr; Clocel_R0031-1.
DR   EnsemblGenomes-Tr; Clocel_R0032-1.
DR   EnsemblGenomes-Tr; Clocel_R0033-1.
DR   EnsemblGenomes-Tr; Clocel_R0034-1.
DR   EnsemblGenomes-Tr; Clocel_R0035-1.
DR   EnsemblGenomes-Tr; Clocel_R0036-1.
DR   EnsemblGenomes-Tr; Clocel_R0037-1.
DR   EnsemblGenomes-Tr; Clocel_R0038-1.
DR   EnsemblGenomes-Tr; Clocel_R0039-1.
DR   EnsemblGenomes-Tr; Clocel_R0040-1.
DR   EnsemblGenomes-Tr; Clocel_R0041-1.
DR   EnsemblGenomes-Tr; Clocel_R0042-1.
DR   EnsemblGenomes-Tr; Clocel_R0043-1.
DR   EnsemblGenomes-Tr; Clocel_R0044-1.
DR   EnsemblGenomes-Tr; Clocel_R0045-1.
DR   EnsemblGenomes-Tr; Clocel_R0046-1.
DR   EnsemblGenomes-Tr; Clocel_R0047-1.
DR   EnsemblGenomes-Tr; Clocel_R0048-1.
DR   EnsemblGenomes-Tr; Clocel_R0049-1.
DR   EnsemblGenomes-Tr; Clocel_R0050-1.
DR   EnsemblGenomes-Tr; Clocel_R0051-1.
DR   EnsemblGenomes-Tr; Clocel_R0052-1.
DR   EnsemblGenomes-Tr; Clocel_R0053-1.
DR   EnsemblGenomes-Tr; Clocel_R0054-1.
DR   EnsemblGenomes-Tr; Clocel_R0055-1.
DR   EnsemblGenomes-Tr; Clocel_R0056-1.
DR   EnsemblGenomes-Tr; Clocel_R0057-1.
DR   EnsemblGenomes-Tr; Clocel_R0058-1.
DR   EnsemblGenomes-Tr; Clocel_R0059-1.
DR   EnsemblGenomes-Tr; Clocel_R0060-1.
DR   EnsemblGenomes-Tr; Clocel_R0061-1.
DR   EnsemblGenomes-Tr; Clocel_R0062-1.
DR   EnsemblGenomes-Tr; Clocel_R0063-1.
DR   EnsemblGenomes-Tr; Clocel_R0064-1.
DR   EnsemblGenomes-Tr; Clocel_R0065-1.
DR   EnsemblGenomes-Tr; Clocel_R0066-1.
DR   EnsemblGenomes-Tr; Clocel_R0067-1.
DR   EnsemblGenomes-Tr; Clocel_R0068-1.
DR   EnsemblGenomes-Tr; Clocel_R0069-1.
DR   EnsemblGenomes-Tr; Clocel_R0070-1.
DR   EnsemblGenomes-Tr; Clocel_R0071-1.
DR   EnsemblGenomes-Tr; Clocel_R0072-1.
DR   EnsemblGenomes-Tr; Clocel_R0073-1.
DR   EnsemblGenomes-Tr; Clocel_R0074-1.
DR   EnsemblGenomes-Tr; Clocel_R0075-1.
DR   EnsemblGenomes-Tr; Clocel_R0076-1.
DR   EnsemblGenomes-Tr; Clocel_R0077-1.
DR   EnsemblGenomes-Tr; Clocel_R0078-1.
DR   EnsemblGenomes-Tr; Clocel_R0079-1.
DR   EnsemblGenomes-Tr; Clocel_R0080-1.
DR   EnsemblGenomes-Tr; Clocel_R0081-1.
DR   EnsemblGenomes-Tr; Clocel_R0082-1.
DR   EnsemblGenomes-Tr; Clocel_R0083-1.
DR   EnsemblGenomes-Tr; Clocel_R0084-1.
DR   EnsemblGenomes-Tr; Clocel_R0085-1.
DR   EnsemblGenomes-Tr; Clocel_R0086-1.
DR   EnsemblGenomes-Tr; Clocel_R0087-1.
DR   EnsemblGenomes-Tr; Clocel_R0088-1.
DR   EnsemblGenomes-Tr; Clocel_R0089-1.
DR   EnsemblGenomes-Tr; Clocel_R0090-1.
DR   EnsemblGenomes-Tr; Clocel_R0091-1.
DR   EnsemblGenomes-Tr; Clocel_R0092-1.
DR   EnsemblGenomes-Tr; Clocel_R0093-1.
DR   EnsemblGenomes-Tr; Clocel_R0094-1.
DR   EnsemblGenomes-Tr; Clocel_R0095-1.
DR   EnsemblGenomes-Tr; Clocel_R0096-1.
DR   EnsemblGenomes-Tr; Clocel_R0097-1.
DR   EnsemblGenomes-Tr; Clocel_R0098-1.
DR   EnsemblGenomes-Tr; Clocel_R0099-1.
DR   EnsemblGenomes-Tr; Clocel_R0100-1.
DR   EnsemblGenomes-Tr; Clocel_R0101-1.
DR   EnsemblGenomes-Tr; Clocel_R0102-1.
DR   EnsemblGenomes-Tr; Clocel_R0103-1.
DR   EnsemblGenomes-Tr; Clocel_R0104-1.
DR   EnsemblGenomes-Tr; Clocel_R0105-1.
DR   EnsemblGenomes-Tr; Clocel_R0106-1.
DR   EnsemblGenomes-Tr; Clocel_R0107-1.
DR   EnsemblGenomes-Tr; Clocel_R0108-1.
DR   EnsemblGenomes-Tr; Clocel_R0109-1.
DR   EnsemblGenomes-Tr; Clocel_R0110-1.
DR   EnsemblGenomes-Tr; Clocel_R0111-1.
DR   EnsemblGenomes-Tr; Clocel_R0112-1.
DR   EnsemblGenomes-Tr; EBT00001540235.
DR   EnsemblGenomes-Tr; EBT00001540241.
DR   EnsemblGenomes-Tr; EBT00001540247.
DR   EnsemblGenomes-Tr; EBT00001540253.
DR   EnsemblGenomes-Tr; EBT00001540257.
DR   EnsemblGenomes-Tr; EBT00001540262.
DR   EnsemblGenomes-Tr; EBT00001540269.
DR   EnsemblGenomes-Tr; EBT00001540274.
DR   EnsemblGenomes-Tr; EBT00001540283.
DR   EnsemblGenomes-Tr; EBT00001540291.
DR   EnsemblGenomes-Tr; EBT00001540295.
DR   EnsemblGenomes-Tr; EBT00001540300.
DR   EnsemblGenomes-Tr; EBT00001540305.
DR   EnsemblGenomes-Tr; EBT00001540311.
DR   EnsemblGenomes-Tr; EBT00001540316.
DR   EnsemblGenomes-Tr; EBT00001540322.
DR   EnsemblGenomes-Tr; EBT00001540327.
DR   EnsemblGenomes-Tr; EBT00001540333.
DR   EnsemblGenomes-Tr; EBT00001540339.
DR   EnsemblGenomes-Tr; EBT00001540344.
DR   EnsemblGenomes-Tr; EBT00001540348.
DR   EnsemblGenomes-Tr; EBT00001540365.
DR   EnsemblGenomes-Tr; EBT00001540367.
DR   EnsemblGenomes-Tr; EBT00001540379.
DR   EnsemblGenomes-Tr; EBT00001540384.
DR   EnsemblGenomes-Tr; EBT00001540388.
DR   EnsemblGenomes-Tr; EBT00001540393.
DR   EnsemblGenomes-Tr; EBT00001540398.
DR   EnsemblGenomes-Tr; EBT00001540404.
DR   EnsemblGenomes-Tr; EBT00001540410.
DR   EnsemblGenomes-Tr; EBT00001540416.
DR   EnsemblGenomes-Tr; EBT00001540420.
DR   EnsemblGenomes-Tr; EBT00001540428.
DR   EnsemblGenomes-Tr; EBT00001540444.
DR   EnsemblGenomes-Tr; EBT00001540452.
DR   EnsemblGenomes-Tr; EBT00001540458.
DR   EnsemblGenomes-Tr; EBT00001540466.
DR   EnsemblGenomes-Tr; EBT00001540472.
DR   EnsemblGenomes-Tr; EBT00001540479.
DR   EnsemblGenomes-Tr; EBT00001540481.
DR   EnsemblGenomes-Tr; EBT00001540483.
DR   EnsemblGenomes-Tr; EBT00001540501.
DR   EnsemblGenomes-Tr; EBT00001540511.
DR   EnsemblGenomes-Tr; EBT00001540514.
DR   EnsemblGenomes-Tr; EBT00001540518.
DR   EnsemblGenomes-Tr; EBT00001540525.
DR   EnsemblGenomes-Tr; EBT00001540532.
DR   EnsemblGenomes-Tr; EBT00001540538.
DR   EnsemblGenomes-Tr; EBT00001540545.
DR   EnsemblGenomes-Tr; EBT00001540551.
DR   EnsemblGenomes-Tr; EBT00001540562.
DR   EnsemblGenomes-Tr; EBT00001540569.
DR   EnsemblGenomes-Tr; EBT00001540577.
DR   EnsemblGenomes-Tr; EBT00001540586.
DR   EnsemblGenomes-Tr; EBT00001540591.
DR   EnsemblGenomes-Tr; EBT00001540598.
DR   EnsemblGenomes-Tr; EBT00001540603.
DR   EnsemblGenomes-Tr; EBT00001540610.
DR   EnsemblGenomes-Tr; EBT00001540617.
DR   EnsemblGenomes-Tr; EBT00001540624.
DR   EnsemblGenomes-Tr; EBT00001540632.
DR   EnsemblGenomes-Tr; EBT00001540633.
DR   EnsemblGenomes-Tr; EBT00001540636.
DR   EnsemblGenomes-Tr; EBT00001540643.
DR   EnsemblGenomes-Tr; EBT00001540648.
DR   EnsemblGenomes-Tr; EBT00001540652.
DR   EnsemblGenomes-Tr; EBT00001540662.
DR   EnsemblGenomes-Tr; EBT00001540667.
DR   EnsemblGenomes-Tr; EBT00001540670.
DR   EnsemblGenomes-Tr; EBT00001540672.
DR   EnsemblGenomes-Tr; EBT00001540674.
DR   EnsemblGenomes-Tr; EBT00001540677.
DR   EnsemblGenomes-Tr; EBT00001540680.
DR   EnsemblGenomes-Tr; EBT00001540684.
DR   EnsemblGenomes-Tr; EBT00001540687.
DR   EnsemblGenomes-Tr; EBT00001540688.
DR   EnsemblGenomes-Tr; EBT00001540691.
DR   EnsemblGenomes-Tr; EBT00001540697.
DR   EnsemblGenomes-Tr; EBT00001540698.
DR   EnsemblGenomes-Tr; EBT00001540702.
DR   EnsemblGenomes-Tr; EBT00001540705.
DR   EnsemblGenomes-Tr; EBT00001540708.
DR   EnsemblGenomes-Tr; EBT00001540712.
DR   EnsemblGenomes-Tr; EBT00001540713.
DR   EnsemblGenomes-Tr; EBT00001540718.
DR   EnsemblGenomes-Tr; EBT00001540719.
DR   EnsemblGenomes-Tr; EBT00001540724.
DR   EnsemblGenomes-Tr; EBT00001540730.
DR   EnsemblGenomes-Tr; EBT00001540731.
DR   EnsemblGenomes-Tr; EBT00001540733.
DR   EnsemblGenomes-Tr; EBT00001540735.
DR   EnsemblGenomes-Tr; EBT00001540739.
DR   EnsemblGenomes-Tr; EBT00001540743.
DR   EnsemblGenomes-Tr; EBT00001540745.
DR   EnsemblGenomes-Tr; EBT00001540748.
DR   EnsemblGenomes-Tr; EBT00001540749.
DR   EnsemblGenomes-Tr; EBT00001540753.
DR   EnsemblGenomes-Tr; EBT00001540756.
DR   EnsemblGenomes-Tr; EBT00001540759.
DR   EnsemblGenomes-Tr; EBT00001540762.
DR   EnsemblGenomes-Tr; EBT00001540764.
DR   EnsemblGenomes-Tr; EBT00001540768.
DR   EnsemblGenomes-Tr; EBT00001540771.
DR   EnsemblGenomes-Tr; EBT00001540774.
DR   EnsemblGenomes-Tr; EBT00001540777.
DR   EnsemblGenomes-Tr; EBT00001540779.
DR   EnsemblGenomes-Tr; EBT00001540781.
DR   EnsemblGenomes-Tr; EBT00001540783.
DR   EnsemblGenomes-Tr; EBT00001540785.
DR   EnsemblGenomes-Tr; EBT00001540787.
DR   EnsemblGenomes-Tr; EBT00001540788.
DR   EnsemblGenomes-Tr; EBT00001540791.
DR   EnsemblGenomes-Tr; EBT00001540793.
DR   EnsemblGenomes-Tr; EBT00001540795.
DR   EnsemblGenomes-Tr; EBT00001540797.
DR   EnsemblGenomes-Tr; EBT00001540801.
DR   EnsemblGenomes-Tr; EBT00001540804.
DR   EnsemblGenomes-Tr; EBT00001540805.
DR   EnsemblGenomes-Tr; EBT00001540808.
DR   EnsemblGenomes-Tr; EBT00001540812.
DR   EnsemblGenomes-Tr; EBT00001540815.
DR   EnsemblGenomes-Tr; EBT00001540818.
DR   EuropePMC; PMC3008519; 20889752.
DR   EuropePMC; PMC5767839; 29348922.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002160.
DR   SILVA-SSU; CP002160.
DR   StrainInfo; 158286; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085037
CC   Source DNA and organism available from Christopher L. Hemme
CC   (hemmecl@ou.edu)
CC   Contacts: Christopher L. Hemme (hemmecl@ou.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Clostridium cellulovorans 743B, ATCC 35296
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: ATCC 35296
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemoorganotroph
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   Sequencing Depth    :: 30x
CC   GOLD Stamp ID       :: Gi02570
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 16224
CC   Gene Calling Method :: Prodigal
CC   Isolation Site      :: cellulose digester
CC   Source of Isolate   :: ATCC 35296
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Nonmotile
CC   Sporulation         :: Sporulating
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5262222
FT                   /organism="Clostridium cellulovorans 743B"
FT                   /strain="743B"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:573061"
FT   gene            99..1454
FT                   /locus_tag="Clocel_0001"
FT   CDS_pept        99..1454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   cno:NT01CX_0867 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49792"
FT                   /db_xref="GOA:D9SMK7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADL49792.1"
FT                   /translation="MNVHLSDIWDKTLTIIKGELTEVSFNTWIKSITPEYIDDTTITFG
FT                   VPNDFTRGILESRYKDLVINAINMVTSKKYNVEFKIISEDVITSDDSEPKIQKQHIIAT
FT                   VSPDEMNSVLNPKYTFNSFVIGNSNRFAHAACLAVAESPAKAYNPLFIYGGVGLGKTHL
FT                   MHAIGHYILKNNSKAKVAYVSSEKFTNELINSIKDDKNEEFRNKYRNVDLLLIDDIQFI
FT                   AGKERTQEEFFHTFNALYDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDF
FT                   ETRIAILKKKADVEKLNVPNEVLTYIATTIKSNIRELEGALIRIVAFSSLTNKEISVDL
FT                   AQEALKDIISNRATKQITIELIQEIVASYYNLKIEDFKSARRTKNIAYPRQIAMFLCRK
FT                   LTDNSLPKIGEEFGGRDHTTVIHAYEKINEAYKSDESLKNIIEILTKRINQN"
FT   gene            1715..2818
FT                   /locus_tag="Clocel_0002"
FT   CDS_pept        1715..2818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: cno:NT01CX_0866 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49793"
FT                   /db_xref="GOA:D9SMK8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADL49793.1"
FT                   /translation="MNFTCDKTNLQEAISIAQKAVTGKSTMPILQGLLLNARGNKLTIN
FT                   SSDIDLGIETKCNANIKEEGSIVVDSKLFGDIIRKLPNSEIQIKSISEGTIEITCQRSR
FT                   FTLVHMKADEFPQLPYIDEDEIISIPQKLIKNMIRSTIFAIAIDETRPILTGILFEIKN
FT                   RTLNLVALDGFRLALKKETIDTEQEFSAVIPGKTLHEVVKILEDEGDVDITFTTNHILF
FT                   NLGETKVVSRLLEGEFIKYQAIIPEEHELSISVNRASLLNSIERASLVSKDASSNLIKF
FT                   NISEDNIVITSNSQLGDVREEVSIKLLKGNELQIAFNSKYLIDALKIMEEETITLQFTS
FT                   AVSPCIIKNIENDNVIYLVLPVRISNS"
FT   gene            2995..3252
FT                   /locus_tag="Clocel_0003"
FT   CDS_pept        2995..3252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="KEGG: cno:NT01CX_0865 S4 domain-containing protein;
FT                   TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49794"
FT                   /db_xref="GOA:D9SMK9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK9"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADL49794.1"
FT                   /translation="MIKIVNKESQHKYAEDIMSEIVIETEFIKLDSFMKLAAIVSSGSE
FT                   AKMIIKSQEVTVNGEIEERRGKKLYKGDVVEFNGESYKVV"
FT   gene            3443..4537
FT                   /locus_tag="Clocel_0004"
FT   CDS_pept        3443..4537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: cno:NT01CX_0864 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49795"
FT                   /db_xref="GOA:D9SML0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADL49795.1"
FT                   /translation="MFIENLKLRNFRNYKELNIDLYSGVNVFTGDNAQGKTNVLEAIYY
FT                   CSLGKSHRTNKDKELILWDALSGQLEVTVNKTRLNKKIKIDILKEGKKAISINSIKLKK
FT                   ISELIGICNVVMFSPEDLKIVKDSPSYRRKFLDIELCKLNSKYYFNLVQYNKVLNERNV
FT                   VLKSNNGNNLDIIEVYDMQLAKFGSHIVKDRVDYINKLNRYGQEIHKDITVSKEKISFS
FT                   YITDAKNLNGIEVELINLLKKNRQRDFIKKSTTVGPHRDDFSIEINDIDTRSYGSQGQQ
FT                   RTSILTIKFASLKIIKELIGEYPILLLDDVLSELDTNRQKYILNSIKDVQTVITCTGMN
FT                   EINNYLNDDYKLFIVNEGCIEEKI"
FT   gene            4556..4819
FT                   /locus_tag="Clocel_0005"
FT   CDS_pept        4556..4819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49796"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML1"
FT                   /inference="similar to AA sequence:KEGG:CLI_0005"
FT                   /protein_id="ADL49796.1"
FT                   /translation="MFLHLGENVVVPVRDVIGIFDIDTTMYGADTVQFLRLAEEDGFIE
FT                   KITNDKPKSFIVAEVNKKSKIFLSPISSATLCKRTQSIYEEY"
FT   gene            4849..6759
FT                   /locus_tag="Clocel_0006"
FT   CDS_pept        4849..6759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: cno:NT01CX_0862 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49797"
FT                   /db_xref="GOA:D9SML2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADL49797.1"
FT                   /translation="MTDKKQSYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEI
FT                   VDNSIDEALAGFCKNIDVIIHEDNSISVKDDGRGMPVGMHAKMNRPAVEVIMTILHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSETCIVTVSIDGKIHRQEFHRGNVATELEVIGETE
FT                   EHGTEVFFTPDHEIFETLEFDYDTLVQRLRELAFLNKGINISIEDRRNDKSDSFHYDGG
FT                   IKSFVSYLNRNKEALFPEPIYIEGIQNDILVEIALQYNDTYQENIFSFANNIDTAEGGT
FT                   HLAGFKNAMTRVINDYARKFGFLKENDKNLSGEDVREGLTAIISVKIPEPEFEGQTKTK
FT                   LGNSEVRGIVDSILGGSVSTFLEENPSVGKIIVDKALTASRAREAAKKARELTRRKSIL
FT                   ESTSLPGKLADCSSKDPSECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQR
FT                   LDKILGSDTIRSMITAFGAGIGKDFDLDKLRYHRIIIMTDADVDGAHIRTLLLTFFYRY
FT                   MRDMIEKGHVYIAQPPLYKVSRNKKEWYAYNDDELKDILKDIGGKDNSTVIQRYKGLGE
FT                   MDAQQLWDTTMDPEHRLLLKVDMGEAMMADEIFTILMGEKVEPRREFIQENAKNVVNLD
FT                   V"
FT   gene            6781..9294
FT                   /locus_tag="Clocel_0007"
FT   CDS_pept        6781..9294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: cac:CAC0007 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49798"
FT                   /db_xref="GOA:D9SML3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADL49798.1"
FT                   /translation="MNNNEGKTLPVDISNEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMYELGITPDKPHRKCARIVGDVLGKYHPHGDSSVYDALVRLAQDFSMRYTLVD
FT                   GHGNFGSVDGDGAAAMRYTEARMDKMANEMVRDINKNTVDFIPNYDGDEQEPTVIPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHNLTEVIDGVNLLIENPEATVLDLMTKIKGPDFPTAGI
FT                   IMGKSGIREAYETGRGKVVVRANATIEEDGGRHKIIVTEIPYQVNKAKLIENIADLVKD
FT                   KKIVGISDLRDESDRDGMRIVIELKRDANPNVILNQLYKHTKLQDSFGIIMLALVDNQP
FT                   KVLNLKEVLVHYLNFQKEVITRRTQFELEKAEARAHILEGLKIALDNIDEVISIIRSSK
FT                   STNEAKERLQERFALSEKQSTAIVEMRLRSLTGLERQKIEDELSELMALINKLKEILAN
FT                   EALILNIIRDELNEIKGRFGDERRTAIEASQNDINIEDLIQEHKVVVTLTRAGYIKRIA
FT                   ESTYSAQKRGGKGIQAATTKEDDIVENIFVTSTHDHILFFSNFGRVYTLKGYEIPEAGR
FT                   TAKGTNVINLLLLRPEEKIQAVITLSEFEKSQYLVFGTKKGIIKKTTLEDFSNIRKNGL
FT                   NAVGLREDDELISVRLSSGEDQIIMVTQNGYSIRFKEEDVRPMGRTATGVKGISLRDED
FT                   NVVSMEIVDESMDILVVSENGYGKRTPIGEYKCQNRGGMGIITYKVSEKTGKVVAATMV
FT                   NDEHEIMIINSADIVIRINSKEISTTGRSAMGVTLMRNNDETKVLAIAKVISDDEEIED
FT                   LQEHNEIQSLEQEAEVQEDTNNSEE"
FT   gene            9730..11232
FT                   /locus_tag="Clocel_R0001"
FT   rRNA            9730..11232
FT                   /locus_tag="Clocel_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            11633..14535
FT                   /locus_tag="Clocel_R0002"
FT   rRNA            11633..14535
FT                   /locus_tag="Clocel_R0002"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            14605..14721
FT                   /locus_tag="Clocel_R0003"
FT   rRNA            14605..14721
FT                   /locus_tag="Clocel_R0003"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.83"
FT   gene            14725..14801
FT                   /locus_tag="Clocel_R0004"
FT                   /note="tRNA-Met1"
FT   tRNA            14725..14801
FT                   /locus_tag="Clocel_R0004"
FT                   /product="tRNA-Met"
FT   gene            14803..14878
FT                   /locus_tag="Clocel_R0005"
FT                   /note="tRNA-Ala1"
FT   tRNA            14803..14878
FT                   /locus_tag="Clocel_R0005"
FT                   /product="tRNA-Ala"
FT   gene            15174..15683
FT                   /locus_tag="Clocel_0008"
FT   CDS_pept        15174..15683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0008"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: ctc:CTC00088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49799"
FT                   /db_xref="GOA:D9SML4"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML4"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL49799.1"
FT                   /translation="MGIKRVRQFVIQLTDTMREEDYIYVNKYLTSKETIIFRKLSKNDQ
FT                   KHCVRVAKGLENIIIEKCGDNYNKAEIIKYIRLGLLHDIGKSFKKVNVINKSVLVMLNS
FT                   LTKGKLIKFVNIKSIDCYYNHGEKGYEMLKDQCDDKEFLQVIRYHHNRNYNNVAVKLLR
FT                   DIDDKN"
FT   gene            15828..16331
FT                   /locus_tag="Clocel_0009"
FT   CDS_pept        15828..16331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0009"
FT                   /product="3H domain-containing protein"
FT                   /note="PFAM: 3H domain-containing protein; KEGG:
FT                   cbf:CLI_0020 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49800"
FT                   /db_xref="GOA:D9SML5"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML5"
FT                   /inference="protein motif:PFAM:PF02829"
FT                   /protein_id="ADL49800.1"
FT                   /translation="MSPDERRKFILNKLIDDKEVLKGQVLAEFLKVTRQIIVKDIAILK
FT                   AEGHNIISTPKGYMIQQENKDLKKVIAVFHDEKDIETELSIIVKYGGIIEDIRVEHAVY
FT                   GEITAMLMIKTIYEVQSFIQKLKDSKPLSALTGGVHLHLIRYKDEEMLQNILRELKEKN
FT                   LLLE"
FT   gene            16516..19251
FT                   /locus_tag="Clocel_0010"
FT   CDS_pept        16516..19251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0010"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   cbf:CLI_0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49801"
FT                   /db_xref="GOA:D9SML6"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML6"
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /protein_id="ADL49801.1"
FT                   /translation="MAYKNGVLKKFIVPIVVVFFLLVGFFNSIVNLIVNIQWYEEVKYL
FT                   AIYFTKLKSLAIVTIPLFFVFFILIFLYYKSIRKSFNKSRSAVDTGSNKRNKLVFLVDA
FT                   VISFFLSISIGNGFWYEILQFVNSTNFNDTDPIFNKDISFYIFKLPLLKGIYQVLLTTL
FT                   ILLIIATVIFYIAVTAYDRLNKTVNNNVINLNKSNIKIISMEIAQFAGKQLASLAALVL
FT                   LVTSYGYVLKGYEIVYSSAGVVYGASYTDVTITLNFFRAIAIVSFVAAIVVFMSILRKK
FT                   IKPIAVSVIAIFVLTAIQPLVSTATESIIVKSNQRNLEKKYIGYNIDYTRKAFDINDIK
FT                   YEEYDVNRNLTAEDINNNRGIIDNIKINSYKPALEFYNQVQSMKYYYDYNDIDIDRYTV
FT                   DGKFTQVFLGTRELNPASLTQGTNTWEGKHLLYTHGYGVAMSKVNSITESGKPNFIIKD
FT                   IPMENKSGIKIENPRIYFGEADSNYVIVNTKSGEVDYPEGGENKLNKYDGNGGIKLSFA
FT                   KKLLYAAYFGSEKILLSNEITADSKIMFNRTITDRINKIAPFLTYDRDPYMVISEGKLY
FT                   WIIDGYTTSNRYPMSQPYNNINYIRNSVKVVIDAYNGDTNFYISDEKDPLIQTYKKIYP
FT                   TLFKDLNTLSKDIISHFKYPEDIFDLQSEVLGKYHVTDPDVFFDGSDLWQVSKDDTDVS
FT                   NNANEAKNTDYQTLKLPKSNKSEMVVINYFNIRNKNNMSSMLVGRMDGENYGDLVAYRF
FT                   PSNESIYSPALFQKQFKQDAVISKELSLLNTQGSNVNYGDTVIVPMENSLLYIMPLYIR
FT                   ATGENSIPEVKKIVLSNGEKTVMGDNMEVALGLLFGDIKNTEKTDGTEGKNDSNTGNLT
FT                   LAKQAKDIYNKMIEAQKSGDWSAYGNYQKQLGEIIEQINK"
FT   gene            19279..20676
FT                   /locus_tag="Clocel_0011"
FT   CDS_pept        19279..20676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0011"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: ckr:CKR_0011
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49802"
FT                   /db_xref="GOA:D9SML7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADL49802.1"
FT                   /translation="MDYDVLILGGGIFGCAIAYELSKYSLNIAVIEKEYDIATDIEIIN
FT                   STIVFDGTIAKNDIMSTLEQRGNVLIKELAEKFNLSYQPKDMLYLAYCDKEAQKLQKTY
FT                   EDAVDRGIENIELINSKKVAEVEPNLKKEVINGILSRNTGIIEPYDLALALAEVAFDNG
FT                   VNFRFNEKVLSIETIAKGSIITTTKNKFKCKMVINTIPQKNYDIEDNLIDEEYKAVRRK
FT                   INYFLMENEGDKKLSNIMLSISENNQISVAVPNPNSTVGAIIHDDIISMREAKDIIKKQ
FT                   VKGIRNNYISAYYSDTYYSDTIIINDSYVDKGYIKISGKNYSEVTMTPAIAKIISETIR
FT                   ENIKCTLKKDYTDKRRDIFKFRDLSNEERQELIDVDKKYGNIVCYCNKVSEGEIVDAIR
FT                   RPLGARTVEGVKRRTGAMQGSCKGATCLHKIVNILARELNRDVLEIVKDTKDSNIIVGR
FT                   MKEFDGI"
FT   gene            20689..20910
FT                   /locus_tag="Clocel_0012"
FT   CDS_pept        20689..20910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0012"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   cac:CAC0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49803"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML8"
FT                   /inference="protein motif:PFAM:PF07892"
FT                   /protein_id="ADL49803.1"
FT                   /translation="MKEIFTTIVRIKGGNAKVCPVKSTEPVEKELFIELSKAISRVYIG
FT                   LPVKRGDIICKNILNTGVDIIATKNILE"
FT   gene            21223..22503
FT                   /locus_tag="Clocel_0013"
FT   CDS_pept        21223..22503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: cbl:CLK_3156
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49804"
FT                   /db_xref="GOA:D9SML9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML9"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADL49804.1"
FT                   /translation="MLDLKRIRSNKDEIKAALSNRGEDFDLTVIDKVVELDESRRAILV
FT                   EVENKKNQRNTESALVPKLKKAGEDASEVLQRMKSLSDEIKELDDKVRAIDEEIEYIML
FT                   RIPNIPNPLVPDGATDEDNLEIKRWGEPRKFENEPKAHWDLGVDLKILDFERAGKVTGS
FT                   RFTFYRGLGARLERALISYFLDTHVDINGYTEIMPPLMANRNSMKGTGQLPKFEEDAFT
FT                   IQNNGYFLIPTAEVPVTNYYRDEILVGEELPIKHVAYSACFRSEAGSAGRDTRGLVRQH
FT                   QFNKVELVKFTKQEQSYEELDKLVKDAESILEGLGLPYRKVRICKGDLGFTAALKYDLE
FT                   VWMPSYNKYVEISSCSNFEDFQARRANIKYREDAKAKPQFVHTLNGSGLAVGRTFAAIL
FT                   ENYQNEDGSVTIPEVLRKYMGGVEVIK"
FT   gene            22746..23243
FT                   /locus_tag="Clocel_0014"
FT   CDS_pept        22746..23243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0014"
FT                   /product="TPR domain protein"
FT                   /note="KEGG: cby:CLM_3324 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49805"
FT                   /db_xref="GOA:D9SMM0"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM0"
FT                   /inference="similar to AA sequence:KEGG:CLM_3324"
FT                   /protein_id="ADL49805.1"
FT                   /translation="MKNHLTEKDKNILITFTLIIAFSIISIMIYSISMIDDRRYLSLQS
FT                   KANNEMIAKNYDDAIVTFTEMLEYDRDKEIINKNIEELKALRKIEVNNINVNGGERSVK
FT                   CAVDARYVKDVVVIEKPSKVEKKEDDNNEKSYSSFKDKLQDGINSLKEGYDNLINGLLG
FT                   RN"
FT   gene            23320..23410
FT                   /locus_tag="Clocel_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            23320..23410
FT                   /locus_tag="Clocel_R0006"
FT                   /product="tRNA-Ser"
FT   gene            23755..23845
FT                   /locus_tag="Clocel_R0007"
FT                   /note="tRNA-Ser2"
FT   tRNA            23755..23845
FT                   /locus_tag="Clocel_R0007"
FT                   /product="tRNA-Ser"
FT   gene            23886..23976
FT                   /locus_tag="Clocel_R0008"
FT                   /note="tRNA-Ser3"
FT   tRNA            23886..23976
FT                   /locus_tag="Clocel_R0008"
FT                   /product="tRNA-Ser"
FT   gene            24072..24148
FT                   /locus_tag="Clocel_R0009"
FT                   /note="tRNA-Arg1"
FT   tRNA            24072..24148
FT                   /locus_tag="Clocel_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(24327..24701)
FT                   /locus_tag="Clocel_0015"
FT   CDS_pept        complement(24327..24701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49806"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM1"
FT                   /inference="similar to AA sequence:KEGG:lin0130"
FT                   /protein_id="ADL49806.1"
FT                   /translation="MRKFFKFIITSIFIIIAIDILSRTATLNWSYLKVNDELYVLCTYN
FT                   IQNLDETDKFTKIGTIESKTNIFIKPIFNYSSNSFRKGSEVYKTDDNQIAVKQNNKFYV
FT                   LSSTQSEGWGNGIMVNPYLD"
FT   gene            24891..27977
FT                   /locus_tag="Clocel_0016"
FT   CDS_pept        24891..27977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0016"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: dhd:Dhaf_0411 signal transduction histidine
FT                   kinase, LytS; PFAM: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; histidine kinase
FT                   internal region; Diverse 7TM receptor transmembrane region;
FT                   glycoside hydrolase family 2 sugar binding; histidine
FT                   kinase A domain protein; SMART: response regulator
FT                   receiver; histidine kinase A domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49807"
FT                   /db_xref="GOA:D9SMM2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL49807.1"
FT                   /translation="MHKNEKQWYRYAFIILSVTIFLLLVYRLTTSAEIRHGINAVNGQI
FT                   DLSNVELDKNNYVDLDGEWEFYWKKQLSYLQQDQFKQKPDAVLKLPSVWRRNIVNGERL
FT                   TSFGYATYRLKVKVKNKDQLLTLKLPAIHTSYSVYINDKLIGSGGIAGQDKATSKADLK
FT                   TVISTFAPPGEEFYIIIHVSNFSGSLSGIWDSIQLGNQESINSLWSDYIKKDLFLFGSS
FT                   LIMAIYHLSIFFMRGKKKPSLYFAILCIIVNIRISVLDSYFIYKIIPSASYGLVNFLNF
FT                   FTIFWGPVIYAFFIFELFPFKKAKVIKNAISYIAILETLIALIMPVHVYTVGTIVYDAI
FT                   DVVTLGICTFISIRAVFKKQEGAVIILTSSIIVVFSMIYDTVFELKLVGGHTEVTPIAF
FT                   FIFIFLQAFTLARNFSKDYNDVIVMTTQLEDMLNKEKTLTEKLTKLDKLKDEFLANTSH
FT                   ELRTPLNGIINMTEAVLSGAEGYVNDMQRRNLSLVVSSGKRLNNLVNDILDMSRLKYKD
FT                   IRLNRKTYDAKKLIFSVVNIFEYIKPNKQVRIELSIEEKLPFILVDEDRFNQILFNIIG
FT                   NAMKFTHKGKIAVSTERIDNFVEIRIEDTGIGISEDKLDQIWNAFEQIDASITRKYGGM
FT                   GLGLSITKNLVELHGGSINVESQINKGTIFRFTVPISEEEIEENSSKSNLEDKKYNYAL
FT                   SVPERIHGDSGKILVVDDEIINLHSIANILKHENYDITCVADGESAIEILKRDKSFSLV
FT                   ILDIMMPDMTGYQVCKAIRETDNLFEMPILMLTASNQPKTVIQAFKEGANDFLYKPFEV
FT                   DELLARTKTLTELKKSVIKAFDMEMAFLQAQIKPHFLFNVINTIVALCDDNPEEASELL
FT                   IEFSSYLRSSFDFRNLEQAIALEKEIEYVNSYLKLEKARFGEKLTIEFDIDDSIKAKIP
FT                   PLVIQPLVENAVKHGVMKKSEGGTVRLSIKETNGEINVSVKDDGVGISKDILQGILKND
FT                   SKRRSVGVKNIDKRLKRISGRGLQINSNEGEGTEIQFSI"
FT   gene            28468..29481
FT                   /locus_tag="Clocel_0017"
FT   CDS_pept        28468..29481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0017"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family"
FT                   /note="KEGG: cpi:Cpin_2864 phytanoyl-CoA dioxygenase (PhyH)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49808"
FT                   /db_xref="GOA:D9SMM3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM3"
FT                   /inference="similar to AA sequence:KEGG:Cpin_2864"
FT                   /protein_id="ADL49808.1"
FT                   /translation="MDNYREKLKKITETLLKDEDDYGEIKKATDDLYDVFVAVSDLKED
FT                   DASCREDVYLSKGKAIGTVWAAMCIKEFMRTKRFIKGVFLAIKEAQKKFKDTQIHILYA
FT                   GTGPFATLILPLTTMFSSEEIKVTLLEINSESIKNLKTVISVLGAASYIEEIVQCDATT
FT                   YKVNKDKNVHMIVTETMQRALKKEPQVSITLNLVPQMIEGGILVPQNVTVSAALIDPKR
FT                   DLDRIMGIEGADEDFCYMLGKVFELTKDTTVVENKEGYKFPEIEIQIPMNIERRFRSLN
FT                   LLTDIQVFGEEKLTYLQCSLNLPQKLMYIEWEIDNLEKFIFEYIVNETPGFMFRKI"
FT   gene            29659..30171
FT                   /locus_tag="Clocel_0018"
FT   CDS_pept        29659..30171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0018"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gur:Gura_0749 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49809"
FT                   /db_xref="GOA:D9SMM4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL49809.1"
FT                   /translation="MKSSIYNYDEGNISLCPVESYHSEFLFRLFIESRSDLSLISGLDE
FT                   EQKLNIIYQQFIMEQQQLEVMYPKADFNVVMLNNEPIGRFYVYYGERKVRVLEIALLEK
FT                   YRRIGIGSKLLITVIEEAGRLGKNLNLQVAWFNAGAYTFYEKLGFKVIDDSYVYKTMEY
FT                   AKGYNRM"
FT   gene            30233..30832
FT                   /locus_tag="Clocel_0019"
FT   CDS_pept        30233..30832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0019"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   mno:Mnod_4880 tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49810"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM5"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ADL49810.1"
FT                   /translation="MDPILAQIILWPGNFVPRGWLACEGQELPINQYTALYSLLGTTYG
FT                   GNGSTTFKLPDLRGRVPVGSGICGGINFQQGNSGGNFNVTLTQQQMPAHTHSTTVTQGA
FT                   VTVNGGIPFNGGEGTTNTPSASSKLAVGITAGGDIPNIYNTSEATGSVTGSFTGQVTGT
FT                   TVTVGSAGGNQGVNVMQPFLALRYIIATEGIYPSRD"
FT   gene            30853..37971
FT                   /locus_tag="Clocel_0020"
FT   CDS_pept        30853..37971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0020"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="SMART: Fibronectin type III domain protein; KEGG:
FT                   pjd:Pjdr2_1410 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49811"
FT                   /db_xref="GOA:D9SMM6"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM6"
FT                   /inference="protein motif:SMART:SM00060"
FT                   /protein_id="ADL49811.1"
FT                   /translation="MVLFKSKNNRCKRIVAILLIFTMLNSIIYGWNFGMLEVHAVGLVN
FT                   GGNNGVITFGTLSTLELKSSTSVAGGQINVIDNLGSGFDIYSENGSSTKLMIRNMTGAG
FT                   SFTTYNATPPAAFVQVIGTAQNASNPTPIQYVDFRANTGIFDLDSLKVTSGDNNFSSYN
FT                   FNVEPLDSSYMPTGQIKTVSNVATYVFSTLDLSGDSNFDGIYGFRITVSQGCQICVDDI
FT                   AVTNPRMPVPPNISPTLNPFMPILPAITEDDTANNGQIINSFIGTSINDADTGAQKGIA
FT                   IISMDNQNGAWEYSSDGVSWNPISSVNLTNALLLREEDKVRFVPDGKNGTILPAKLTYK
FT                   AWDQTVGTTGTRFDASTSGGSSAFSINFDIVTVNVASINDAPVITPPGNNFTQISEVDT
FT                   NNVGNTVADIIGTSITDVDTSATKGIAIIHATNGNGSWQYSTDNGSNWFDVGVVDDESN
FT                   SLLLGNTDKVRFVPNGIKGTTASIFYRAWDKTSGNAGDKVSTISNGGTSAFSFDFSKSN
FT                   ITVSDVNYAPTLTSVATLNGLDKTNTITYADLVAAADEADSDGDTVSFRIEGVNTGNLL
FT                   KNGLPVATGVTTIGPGESLSWTVANNTSGLINAFTVKVFDGTATSSTAVQVKVNVQDTT
FT                   PPVIPGANCPNDGTYLVGNTLNFGVFSNEVLFVTEGATGKPYLEILLGKGTANARTVRA
FT                   EYVSGSGTNTLNFAYTIVSGDSSGQYETELNPMIQLNNCTIMDTSGNNVVSSFSNYDLS
FT                   RVIVDTFAPVWRTGYPKVDTITSNSIKVVMQSIDETGTAYYVCLPNNSGEPSVAQVKAG
FT                   QDATGSPLVSSLSGSSPVNITSDTFFTVSSLAVAADYDIYVVVEDAFGNIVTTNKRIDA
FT                   KTKTIPIADFSISSKTANTASLTWTSAIGTSGIVVEQALVGTVNWIPAVTGPLALNAST
FT                   AKVIGLAANTAYKFRLIVTGGVNEGISNVVTVSTDELPLVISVAGPSNSTYKVGDILDF
FT                   KVTYDKNVTILGGTPSLKLAIGSNAREATYKSGSGSSVLSFRYTIQAGDLDTNGITFAS
FT                   SNISLNGATIRSTANEDANLSLNGVVNLSGVLVDGVSPMVTSLSLPINTTYKTADAIYV
FT                   TANFDESVFILPGPTGVPYIELTIGTKKVKAQYYSGSGSQTIKFAYTVASGEVDSDGID
FT                   IATIINPNTGSIKDNIGNEAVYAYTNVNSSGLFVDAVAPTLTNSVISSDKKTIILSFSK
FT                   NLVSAVADFGSVVNLSTDGGLIYKPVSSLANINGLDINGKDIVITFDTPLTGSKNKVAI
FT                   GANSIKDVLGNLQTNVIETGNLGLAKPIAVKVPTVGVYKAGSQLNFTVVFDENVIVDTS
FT                   LGTPTLQLTVGSTSREAVYFSGNGSNEITFAYTVEAGDNDNDGIKIASTAIELNGGTIK
FT                   NSSNDNADLILNNIQDSSVVKIDTKSPTITSLTLPLNKTYKVGEAIQIIVNFDELILQM
FT                   APTTITIKVGDKSIAVPCITPPPGPVNAMVFIYNVTAGDIDEDGISLGNIIYYIGTVKD
FT                   MAGNDAILSYSSVDTSGILVDAVAPKFVGVELNPDKKIVTLSFDEDIVDVTGSLLEDSV
FT                   YLSTNGGTTYSQFSSLANKGSISINGKDLIVDFITPLDGSKNKIKVVENSIKDVFQNIK
FT                   TDVTETSNLGTTISIAMDEPFTEQNLNGRVLTINIDGETFKDASLDKANFIINNAPKGV
FT                   TVKAVTYTDSTHGLITLSYDGSDMDSFITNVGVTVLGSELTKGKDIKTNGIVIKVMDDP
FT                   EAISIKNLSPIKEREEDKQVITVNITGGQFNDGLNKDNWTVTNLPAGVTVGSVTKVNAN
FT                   TAEIVLVGNSTDDYDSDINNVTVSCGTSEYNDSTGGSSLIADTGVTFTAKTIGVVTTNS
FT                   IASIGKTSATLSGDVISSGDGTIKEKGFIYRISTEATGAKKVVSNENTLGQFIASLTGL
FT                   KANTTYYVKAYVENEEGISYGSEMSFTTMPYSTNAKLKNLESSSGTLTPKFDTDTKNYT
FT                   AVVDYTVDSIIITPTLAEEKVVMPSTMSFASILKDTNIATATIKVNGVLVNSGQPSQSI
FT                   SLKEGDNTITTIVTAEDGVTTETYTLVVTKKPAPTVVKGKVVDSDGKVVDTIEVKVTTE
FT                   LDGTLTAGLKAKEILFINTASGNNSVLEDLLKLSIDTNSDSKGSILQDGTVKFSSLEKG
FT                   KNYEYKVICSIGKFKMELGIIRIKVDNNGNVELTSTLIDPYGVITDAKSGKVIDGVNVV
FT                   VFYADTQRNKDAGIVPNTEVSLPIISGFAPNDNKNPQISDSFGSYAFMVYPNTDYYIVA
FT                   TKDGYEKYTSPIISVEKEIVKWDFKMNPLENNTTFVTNPDTSMPATGSAIDKKVLVEVG
FT                   IVLILVGIVSVFTSVRISRKKKSNNK"
FT   gene            complement(38143..38301)
FT                   /pseudo
FT                   /locus_tag="Clocel_0021"
FT   gene            38696..44623
FT                   /locus_tag="Clocel_0022"
FT   CDS_pept        38696..44623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_1410 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49812"
FT                   /db_xref="GOA:D9SMM7"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM7"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_1410"
FT                   /protein_id="ADL49812.1"
FT                   /translation="MRRRKRKRILAEFLALTLLINMFFTGVTQEIAYAASGTITFNTTD
FT                   GTSMGSLLLDGQWNSTDISGIDLKFFNANNASDATNEVLAGGFIYSVDYSGIVAMDAST
FT                   GTQYQYTVIKAGNGSKFSLNAIYLNDWVGGMGATIECYDGNMFLGSDNINADGGILFHT
FT                   SSVSNPSKYQAITEIRISNSSDVTYGNPVAINNISIGDPIIPNAAPILNPISPTMPNIT
FT                   EDSTISGGQVISSFIGTSITDSDVGAKKGIAIISTDNQNGAWQYSVDGIFWNGISSVSN
FT                   TSALLLRVEDKVRFVPNGKNGSSSPAKITYKAWDQTYGTDGSRADCSLSGGSSAFSVNS
FT                   DTVSLNITNVNDAPVLTTGHNFTSISESDINNPGNSVADIAGTSITDVDINSAKGIAIN
FT                   SSNNGNGVWQYSIDGGSNWTNIDVVNSANSLLLRDIDRVRFVPNGMKGTTASITYRAWD
FT                   TTTGTYGIKQSSAAYGGSTAFSSATNSASISVSNINYPPTLTSVNDLNGVDKTNTITYA
FT                   DLSAAADEVDSDGDTISFRIEALNTGTLRKNGNLSVTAGVTTIGPGESLSWTVPNNTNG
FT                   LLNAFTIKAYDGTVASNTAVQVKVNVQDTTKPVINLVDRPSDGAYVVGNTLVFSIHSTE
FT                   NLYLTQNGVGVPYLDVKLGVNIVRAYYVSGAGTSTLTFVYNVVDGDYSGLNETIITPKV
FT                   QVNDYFIKDIAGNNLVVDFAACDLSQVKVDTLAPTWAASYPKTNIITSSSIEVAMKTAD
FT                   ELGTAYYVCLPSGSMEPTLAQVVAGQDAVGNLLQSNLKGYTAINKISDTFFNVDSLAPV
FT                   TDYDIYIVAVDSLGNAKKTVTSAKTKSIPITDLSPSSKTANTVTLTWTSAIGASGIIIE
FT                   QSLVSLEDWVPATTGPLALSADTAKIIGLVANTDYKFRVVVIGGVNEGISNAVTVATDE
FT                   LPLVTSVTGPSNGTYKEGDILNFIVTYDKNVTILGGTPSLNLIIGSNTREATYKSGSGS
FT                   GVLSFSYTIQAGDLDTDGITLASNNISLNSSVIRNNYDEDASLVLNGVANFSGVLIDGV
FT                   APTVTTVSLPASTTYKAGDQIYVIANFDKCVFIMPGSSGIPYIELTVGAKKIRAYYYSG
FT                   SGSQNIKFACTVASGNFDGDGIDIGTTIASNTGVIKDYAGNEAVYTYSSVDSSGLLVDA
FT                   VAPIFKGAVISTDKKSITLTFDEDITSKVADLGSQISLSSDGGANWIMFNSLANKDAMT
FT                   ISEKDLILTFNSPLIGSKNKISILQNTIKDLFENIKTSNTETGNLGSSIEAKEDAALVE
FT                   DKLDGRVINLAITGDNFKNNDLDKTNFILNNVPKGVTIKTVGYIDSTHCLVILSYDGSD
FT                   FDADINNLSITVDTSELVGSPSIVTNNMIVTAINDDEKISIKNSSTIKEGAEDQTIITV
FT                   TLTGGQFADTLNESNWTVSNLPLGVNKGVVTRVDSHTVEITLVGNTTEDYDNDITNVSV
FT                   TCTSSEYTDSTSGNSLVANTGVVLSAKTAAIVITNPVTELGKTSVRLNGNITSSGNAII
FT                   KEKGFLYIEQKDPVEVKKVVSTEDSIGEYSTTLSNLIPNTVYEARAYVENEEGIWYGDV
FT                   ISFTTMPYSTNAKLKNIETNSGTLSPIFNSETKAYTAIVEYDVDNITVVPTVEDTGLAA
FT                   IKVNDISVDSGKPSQDISLKTDKNTITILVTAEDGITTDTYTLDVYKKLQPILVEGKII
FT                   DKDGNNVDKAKVTVRPELDGTYTVEVKSNEALLIKTASGTKTTIKDYSKLKFISTSGPE
FT                   GSISGDGNIKFSSLEKGKTYEYNAICKVGNSEIVIGKIKVQISDSGNVEVISDLIDPYG
FT                   TITDATSGKVIDGVSVVLFYSDTARNRVAGIEPNTEVLLPIIDGFAPNDNKNPQISDSF
FT                   GSYAFMVYPNTDYYIVATKDGYEKYISPTISIEKEIKKWDFKMNPIVPSKPTKPSTPVS
FT                   TDKETVIPATGSPIDTKVLVIVGIVFVVAGFAISKKKKSNKK"
FT   gene            complement(44716..46443)
FT                   /pseudo
FT                   /locus_tag="Clocel_0023"
FT   gene            46913..47644
FT                   /locus_tag="Clocel_0024"
FT   CDS_pept        46913..47644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0024"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   bcl:ABC0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49813"
FT                   /db_xref="GOA:D9SMM8"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM8"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADL49813.1"
FT                   /translation="MRSKASREEQKQFGDNIFTTIMNYVYWFLAGSGLFIISNILFIAC
FT                   MFFVLTTAALGYQIDIISALILLLSAISLGPSITALMGTMGKLVREQDVKIFSEYIRSY
FT                   KLNFKQSISLWAIQLLVIGILVIDYKIFISTSYGRFLIPAVFIIIFLLVNMYIYMFSLM
FT                   SRFFYKSRDLIKISFFYTISKVKNTAINSVIVIVATILIFQYSNIVLFFIPAVMIYGIM
FT                   FNQKSLFESIENKIDEKKSTF"
FT   gene            complement(47757..49247)
FT                   /locus_tag="Clocel_0025"
FT   CDS_pept        complement(47757..49247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0025"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49814"
FT                   /db_xref="GOA:D9SMM9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL49814.1"
FT                   /translation="MKNETQKGHNVKKAHLVNISVIVFLSILLMMISIVGVGLSFATPI
FT                   IIETISVWIIIGVIYHIKIKDNIKALIFSIIPLIISTLQFIVGKSNPIGNHYLIALSIA
FT                   MIALYFNDKLILIHQVITNVLFIYLFIGYRSNLLPISSGNIWVFWYLILCLNSILTILY
FT                   FLTKWGKETVNEAIKKEKISQDLSAKLNASLKEIKSGTNLLNKTVVDFERSISSSRESI
FT                   SNMNTAMHEMASGINEQAEDLNSINEEMNLAADNLLKNEKISTTVNVEVSKTTEQVTEG
FT                   SSKVKEMNAQMDIIYQAVNTSFNTVSDLETKILEINQYLDSINQIAEQTNLLALNAAIE
FT                   AARAGENGKGFAVVAEEVRKLAEQSSTTVKDINLIINTINEQTKLVVDKVKLGDTAVET
FT                   GKKLISEVSENFSVIEKKFVTANRLFGEGANVSSETSKNFMSTLQKINSIATISEQHAA
FT                   TVQELSATAESTNSDIIKINASVNEIKTLSESLEKMTN"
FT   gene            complement(49594..51084)
FT                   /locus_tag="Clocel_0026"
FT   CDS_pept        complement(49594..51084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0026"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49815"
FT                   /db_xref="GOA:D9SMN0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN0"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL49815.1"
FT                   /translation="MKHEISTGHSIKKAHLVNISIIIVLSLLLLTISIVGVGITFAIPV
FT                   LLQVIAAWIVVATVYFLKINDNIKAVIFSVLPLIISALQFMKGASNPIGNHYLIALSIA
FT                   MIALYFNNKLIVIHQIVTNVLFLYLYIAHRPKLLPHSSGDIWVLLYLIICINSILVLLY
FT                   FLTKWGKGTVNEAINKEKISEELSGKLNTSLEEIKNGSNLLNKTVIDFDRNIASSKEAI
FT                   STMNTAMHEMANGINEQAENLNSVNEEMNIAAENVLKTEKISASVNLESAKMTEQVTEG
FT                   SSKIKEMNTQMDIIYQAVNTSFNTVSDLETRIIEINQYLNSINEIAEQTNLLALNAAIE
FT                   SARAGEHGKGFAVVAEEVRKLAEQSSTTVKDINTIINTINEQTKLVVDKVKLGDNAVAS
FT                   GKKLISEVSKNFSVIEKRFINSNKLLEEGANISSETSKVFMKTLEKINSIAIISEEQAA
FT                   TVEQLSATTENTNGDIIKIINSVNEIKTLSESLEKMTS"
FT   gene            complement(51391..52884)
FT                   /locus_tag="Clocel_0027"
FT   CDS_pept        complement(51391..52884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0027"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49816"
FT                   /db_xref="GOA:D9SMN1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL49816.1"
FT                   /translation="MNTETSISYNIKTVHLVNITVIVILSLLLFGLAYVGLGLSYALFV
FT                   LAQNSVIWAIVAAIYFSKINDNIKAMIFSLIPLLTGAAAFLKATSTPLGNHYFIFLSIA
FT                   MIALYFNNKLIAIHQVLTNLTYILLYIISGPRLLIDPNGTIWSFIYILVCANGVLALLY
FT                   FLTKWGKALVTEAVRKEKVAGELSLKLNASLEEIKKGSTLLNNTIIDFDKNISSSKEAI
FT                   SNMNIAMQEMASGVSEQAENLSSINEKMNIATENVLKTEKISSNVSTESSKMSEQVIEG
FT                   SSKIKEMNTQMDIIYQAVNTSFNTVSDLETRIIEINQYLNSINEIAEQTNLLALNAAIE
FT                   SARAGEHGKGFAVVAEEVRKLAEQSSTTVKDINTIINTINEQTKLVVDKVKLGDTAVES
FT                   GKKLIAEVNDNFTVIADNFIKTNRLLDEGAKVSSETSKEFMAMLEKVNSIAAISEQQAA
FT                   TIEELSATAENTNADIIMISDSVNEIKNLSNSLDMMSIK"
FT   gene            53384..55000
FT                   /locus_tag="Clocel_0028"
FT   CDS_pept        53384..55000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0028"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /note="KEGG: cbk:CLL_A0275 Na/Pi-cotransporter family
FT                   protein/PhoU family protein; TIGRFAM: Na/Pi-cotransporter
FT                   II-related protein; PFAM: Na+/Picotransporter; PhoU family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49817"
FT                   /db_xref="GOA:D9SMN2"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN2"
FT                   /inference="protein motif:TFAM:TIGR00704"
FT                   /protein_id="ADL49817.1"
FT                   /translation="MDIEKLIIQLIGGVGLFLYGMRLMGDGLENSAGDRLKDILEKVTK
FT                   RPIIAVGVGAIITAIIQSSSATIIMVVGFVNVGLISLMQATWIIMGANIGTTITTQLFT
FT                   FRLEYIAPILVGIGAIAVLFTKGRKRRGIEHVVLGFGMLFMGMGLMTNALRPIAHTSEF
FT                   NNIILAVGDKWIIGIFIGFCLTAVVQSSAATTGILIALAGTDQISINIAIPILFGCNIG
FT                   TCVTTLISSIGTSKKARKAAFIHLIYNVMGTIIFIPLMGTLAKIVVNINPDNVGRQIAN
FT                   AHLIFNIVNTVILLPLTKYLIMIVEKLIPGEDELKIIGPKFIDDRLLETPVIAAGQVIK
FT                   ETIRMANTARMNLEIAMEAFINKDEKLVKSVYENEKIINNLEEEITRFLVLLSKCDLSD
FT                   KESAIVSSTFHIVNDIERIGDHAENIVELASKRILKNIQYSEESLGELKNIYNYTLTAL
FT                   KVAIESYAIGDFRKAESVNDLEVRIDESFRIYSKNHIRRLNNDRCTAYAGVVFMDLLSN
FT                   FERIGDHSVNIAGIVIENASV"
FT   gene            complement(55164..56021)
FT                   /locus_tag="Clocel_0029"
FT   CDS_pept        complement(55164..56021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0029"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: gym:GYMC10_3909 transcriptional regulator,
FT                   AraC family; PFAM: Cupin 2 conserved barrel domain protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49818"
FT                   /db_xref="GOA:D9SMN3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN3"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADL49818.1"
FT                   /translation="MAEMKLSYFTNDEGFPFFIQYGYHSNNLSIHTHTDFSELVIVMNG
FT                   TATHIVDNEKFNIKKGDVFVINSNTCHGYENAKDFRICNIMYRSENLLLADYDIKKNAG
FT                   FHALFVIEPYFTKEHSFKSNLTLKPLDFEKIHILLDSLLSEYMTKTDGWKTSTKALFML
FT                   LVVTLARLYDFGNSSEKVDVINIAKSISYIENHYTEDISIDLLAKISHYSPRHFARIFS
FT                   ETYSTTPLNYIISLRIRRACSLLKETTLPISTIAIQCGFSDSNYFSRIFKKNLYLTPKQ
FT                   YRTS"
FT   gene            56147..57478
FT                   /locus_tag="Clocel_0030"
FT   CDS_pept        56147..57478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0030"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: family 43 glycosyl hydrolase; PFAM: glycoside
FT                   hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49819"
FT                   /db_xref="GOA:D9SMN4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN4"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADL49819.1"
FT                   /translation="MPNPYLPLWEYIPDGEPRVFGERIYVYGSHDNAGSDKFCDFKLKV
FT                   WSAPLDDLNNWTCHGHIFHTRDDRDHKSDTPWTDGDLYAPDVVQKDGKYYLYAYIMGAK
FT                   GCVAVSDRPEGPFELLSKYKYEVVEGEGNDSFNGGWFIDPGVLVDDDGRVYVYCGYESS
FT                   FVAEINPDNMYEIIDGTYQKDIIPIEEPFRFFEACSPRKIEDTYYLIYSPRVGSRLVYA
FT                   TSKSPTGPFEYRGVIVDNGVNYPGGNNHGSICNINNQWYIFYHRMTNGTVMSRRACVEK
FT                   IELLSDGTIPEVEMTSLGFENSLSPYKMTPAEIACVLKGGCFITERNLASRPVTAIISG
FT                   CIIGYKYFDFGEDFSTETMKFSAVVKGTGCKAKIKILLDDYENGEEIGVCEIGADDGVY
FT                   TAIVKNVTGRHALYFLVEDSFGGWFTDMFKGRHLFELESFVFMK"
FT   gene            57755..60652
FT                   /locus_tag="Clocel_0031"
FT   CDS_pept        57755..60652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0031"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   Carbohydrate binding family 6; KEGG: bha:BH1908 glucan
FT                   1,4-beta-glucosidase; SMART: cellulose binding type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49820"
FT                   /db_xref="GOA:D9SMN5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN5"
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /protein_id="ADL49820.1"
FT                   /translation="MTTERMENNKILYPFRNPNINIEERLDDLISRLTLEEKIHVLPGY
FT                   QAPIERLGIQAYYVGGEGAHGLVRRQGKLTGPTTVFPQPIGLSSTWNPNLMSEIGKVIS
FT                   DEARAYYKKSDKIAGLNIWAPTVDMERDPRWGRTEEAYGEDPYLTGKLSAALTKAERGE
FT                   DPFYLKMVPTLKHFYANNYEKERISCSSSIDPRNKYEYYLKAFKPSIVEGGAQSIMTSY
FT                   NAINGIPGMVNPEIQTILKDQWGLESFTVSDGGAVCQVVDYHKYFVSHAETIASSIKAG
FT                   LDSFTDNPDMVVAAARDAMERGLMTEDDLDKAVRNIFRTRIRLGQLDPEGYDPYDYISD
FT                   EVICSEENSKVALKAAREAMVLLKNENNILPLNKEKLKKVAVIGPLADELLMDWYSGIH
FT                   PYKVTPLEGIKKKLQEVQVTYSDGADIVTLTSLLNNKLIAQYQDNENILYANKTELCDE
FT                   ALFKHIDWGWGSHTLRSKANNKYMSSKRDKEGILAADQEEAFGWFVKELFNFDRDSDNN
FT                   YYLRTWNWENIGVGEDEKLFINTGKPKVEVDKYKFKKSLISSGIEEATSAAKDADVAIV
FT                   VVGNNPVINGKEEVDRKDIILPPSQQELIKAVYETNKNTIVVIVGTYPFAINWEQENIP
FT                   AIMFTASGGQELGTAIADSIFGDYAPAGRLSMTWYKSIEQLPDITDYDIIKGKRTYMYF
FT                   DQEVIYPFGHGLTYPNFEYKDLLIKSKNYTNNDTIEVSCDIINTGNIDSDEVAQLYVSA
FT                   IKSRIVRPIRELKGFERINIKAGEKKTVNFKVKVEDLAIWDVTRNKYCVEAGEYKFEIG
FT                   TSSKDIKLEGNVYIDGEIIPSRDLSLKTRAENYDDYNKVILKNCIKGGTCVSNIDNNSW
FT                   LCYKDVDFSLSYSTFMAQVANDTTKAIIEVRIDSLEGEVIGTLEVPSTGGLQNWIINSC
FT                   EIKNITGIHDVYFTFNVGDRFNGELRISYFQFITG"
FT   gene            60745..63177
FT                   /locus_tag="Clocel_0032"
FT   CDS_pept        60745..63177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0032"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; glycosyltransferase 36
FT                   associated; carbohydrate binding; KEGG: cth:Cthe_0275
FT                   cellobiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49821"
FT                   /db_xref="GOA:D9SMN6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037825"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN6"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADL49821.1"
FT                   /translation="MKFGFFDDANREYVINTPKTPYPWINYLGSEEFFGIISNTSGGYC
FT                   FYKDAKLRRLTRYRYNNVPIDNGGRYFYVNDGGDVWSHTWKPVKKELSAYECRHGLGYS
FT                   KFTGERNGVKVSQLSFVPLGMNAEVHQIKVKNTSDTDKAVKLFSFIEFCLWDAGADGEN
FT                   FQRNFSTGEVEIQGSVIYHKTEYRERRNHYSFYSVNTEIAGFDTDRDSFIGLYNGFEAP
FT                   DVVMAGESKNSVASGWAPVASHGINVELKAGEEKSYVFVLGYVENKDEEKWESKGVINK
FT                   TKAKEMIEALADDAAVEKALAELKKYWDGLLSNYTLNSDDEKLNRMVNIWNPYQCMITF
FT                   NMSRSASYFESGIGRGMGFRDSNQDLLGFVHQIPERARERIIDIASTQFEDGGCYHQYQ
FT                   PLTKKGNNDIGSGFNDDPLWLILGVTAYIKESGDMGILDEIVPFDNDLNNTATLMGHLK
FT                   VSFDHVINNRGPHGLPLIGRADWNDCLNLNCFSATPGESFQTTENKEGGVAESVLIAGM
FT                   FVFIGKEYVALCKEIGDLEEAARAQKHIDEMTEAVLTHGYDGEWFLRAYDFYGNKIGSN
FT                   ENEEGKIFIESQGFCVMGGIGVENGLAEKAMNSVIERLDTKYGIVLNNPAFTKYHLEMG
FT                   EITSYPEGYKENAGIFCHNNPWIACAETVIGRGDRAFEVYRKIAPAYLEEISDIHKTEP
FT                   YVYSQMVAGKDAVRFGEAKNSWLTGTAAWNFITISQWILGIKPDYQGLRIDPCIPKDWE
FT                   GYSISRKFKGAQYDIVIKNPNKVCKGVASITVDGKAIEGNIVPTFEGGVHSVEVVMG"
FT   gene            63430..64080
FT                   /locus_tag="Clocel_0033"
FT   CDS_pept        63430..64080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0033"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   Ser/Thr and Tyr protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49822"
FT                   /db_xref="GOA:D9SMN7"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN7"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADL49822.1"
FT                   /translation="MEKFKAALKHSWIFFVYAAVGLIYEVVNRPWGEVRNISTALDANI
FT                   PFIKEFIIPYMSWHLFTVGCGIYLLFKDRRNYYKSMYSVIIGLIICYATYIVFQTTVPR
FT                   PTVVGDDILSQFVRKMYSHDKPMNCFPSIHVYTTVLFTYFILITNRLKKYQIAMMVTWA
FT                   VSIVLSTLFVKQHVILDVVGACALVYACVGLVNWFEARNDVKINNTVENEGQV"
FT   gene            64359..66710
FT                   /locus_tag="Clocel_0034"
FT   CDS_pept        64359..66710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0034"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   cbe:Cbei_0772 alpha-xylosidase YicI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49823"
FT                   /db_xref="GOA:D9SMN8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN8"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ADL49823.1"
FT                   /translation="MKFSNGFWLNREGVASFSPEEVYSTSVKGNVITLNTPTHKINHRG
FT                   DTLQGPNITIKISSPIPDVIRVQSFHYMGIVDRGPKFEINNCTDTKFDIVEDETTIKLT
FT                   SGNLNVKIDKKKWKMEFLNKEERLTYSGWRDLSYVKENFRGIAYDKGALEDTYMREQLN
FT                   LSVGELIYGLGERFTPFVKNGQTVETWNEDGGTSGEQSYKSIPFYISNKGYGVFVNSSD
FT                   KVSFEVGTDKVTKVQFAVPGESLDYFIINGPSMKEVLERYTTLTGKPALPPAWSFGLWL
FT                   TTSFTTNYDEETVTSFVDGMAERDLPLHVFHFDCFWMKDFNWTDLEWDSRVFPDPEGML
FT                   KRLKEKGLRICVWINPYIAQESSMFQEGMDNGYLIKRPNGDVWQWDMWQPGMAIVDFTN
FT                   PAACRWFADKLEALLDMGVDCFKTDFGERIPTEVTYFDGSDPVKMHNYYTYLYNKVVFD
FT                   VLEKKRGKDEAVLFARSATVGGQQFPVHWGGDCSANYESMAESLRGGLSLTMSGFGFWS
FT                   HDIGGFESTSTEDVYKRWAAFGLLSSHSRLHGSSSYRVPWLYGEEAVDVVRHFTKLKAS
FT                   LMPYIFNEAYKTSKTGIPSMRSMVLEFQDDPAIGYLDRQYMFGDSILVAPIFNEQGVAN
FT                   YYLPKGTWTNFFTGEKVDGGSWRKETHDYMSIPLMVRPNSIIAVGSENRKSDYDFAQDV
FT                   TLKVYELEEGKGASATVRSMNSEVALEVSAMLSKGEITIDAKGVGKPWSLVLVGVQNVE
FT                   VVEGGSFVIEGSDTKIFPSSNVGKLVIKLK"
FT   gene            66874..68937
FT                   /locus_tag="Clocel_0035"
FT   CDS_pept        66874..68937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0035"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cpy:Cphy_0220 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49824"
FT                   /db_xref="GOA:D9SMN9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN9"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ADL49824.1"
FT                   /translation="MDIGNKIKELIEMMTLEEKVAMIHGNGLFKTGGVPRLGIPPLIMS
FT                   DGPMGVRRDFYDDNWIAINNTDDFVTYLPSNTALAATWNINLAYKAGQVLGNEARGRGK
FT                   DVILAPGVNILRSPVCGRNYEYISEDPYLTARMAVAIIKGIQENDVAACVKHFAVNNQE
FT                   TNRLKIDVDVDDRALREIYFPAFDAAINEADPYTLMGAYNKLRGIHASHSDYLLNRVLK
FT                   GEWNYGGVVISDWGAVHDTYEAVYNGLDIEMNVTTNFTEYFMADPLIKEVNEGKIEEKS
FT                   LDDKISRILKLMFKLKMFDDNRYDGEYNTLEHKQRVLEIARESITLLKNEGKLLPLDRK
FT                   KIKRLVVIGENGDRIHSPGGDSAAIKALYEVTPLSGIRMKFGGNTKIEYFKGYSSEEKD
FT                   NDKILFDEAVIAAKGADAVVFVGGINHDFDTEGFDKPDLVLPYGQDDLIKELLKVNKNT
FT                   VVVMICGTPVEMSQWLDMAPAVIHSSYAGMEGGTALAEVLLGNVNPSGKLPVTFPKTLM
FT                   DSPAHKIGEFPGEQTVHYKEGLYVGYRYFDTYKVEPLFCFGHGLSYTTFEYSDMEVSKE
FT                   EKDNDIKVIATFKVKNTGTVAGAEVIQGYVRDTESQLERPEKELKAFAKVFLQPQEIKS
FT                   VELEFDKKSFAYYNNEEAIWVCEEGNFELLIAASSQDIRLKDNVSIYKTIKY"
FT   gene            69146..70903
FT                   /locus_tag="Clocel_0036"
FT   CDS_pept        69146..70903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0036"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: cce:Ccel_2453 histidine kinase; PFAM:
FT                   histidine kinase internal region; ATP-binding region ATPase
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49825"
FT                   /db_xref="GOA:D9SMP0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL49825.1"
FT                   /translation="MKSLKIFKKVISNMRIRNRLMAIYVIAGLIPLLLVGTYLTISTRN
FT                   IVRERAVSEAEANSDRIVDRIKEITDLASDVSELLYVDKRLQSLVTTQYNEKDRSLILE
FT                   DYEQYTTITEYMNYYASIDDIILYVKNETVLDWSIVKVTDRIAAQPWYQKTIKNGAKIT
FT                   WQYVYDEYLDKYNLALHRVIKNDNGNEIGVLQIKVTEQPLKNIIQDEPFDTFIILNDEV
FT                   IISNDKRTEDVSIANINYKDNGISYIEYGNEKIVAISRNITSNEINSIKVVSMIPLNKI
FT                   YRQSDLKSATGFAIIFISMAISIIIIFKFSNNFSKRVIVFKGEMHKVVSGDFEIIKTLE
FT                   GDDEIAELYDDLYKMIDSIQLLINQVYVEKIQKEQLASKQKDVEFKMLASQINPHFLYN
FT                   TLETIRMKAYCNEQYEIAEIVKILAKIMRRNLEINDNLVSLESEITMIKNYLKIQKFRF
FT                   GDRITYDINIECNIDDYYVLPLLFQPVVENAFVHGFEHKQGIGEIKIIISKDENRLIFS
FT                   IRDNGVGISPETLENLRASISNINYKGKSIGLNNVNHRIKIYYGDEYGVEIFSGLEVGT
FT                   EVKIYLPIN"
FT   gene            70914..72455
FT                   /locus_tag="Clocel_0037"
FT   CDS_pept        70914..72455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0037"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: cce:Ccel_2452 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49826"
FT                   /db_xref="GOA:D9SMP1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL49826.1"
FT                   /translation="MLNVLIVDDEPIVREGLKIIIDWNKYGYTVCGEGLDGKDGFEKIL
FT                   TLKPDLVLVDINMPGMNGIEMIKAAKEQGALSKFIVLTGYSQFEYAQNAIKLGVKSYLL
FT                   KPIDEDELIENLKGLYLEIEQEKNKNKYLNLTKKHLRNELLRKIVTGSYLQDDLIEYRE
FT                   ISGQKSDAERFVVSIIDTCVGDETTKPIKIEERIEECLKDKMDIGLCRVEGKYVITFVD
FT                   KSDASIKMLLSSIYNQLVGNKNVSAFIAIGESVEVVEDISKSYKSAKEIIENKFIYDDE
FT                   KIVKYGSTNQGDKDITFGKDDIQALYTSIEIGDMDKLTNTIKLLEKSLINSNLSTEKMK
FT                   GLLIKYFLEIKSQLVASFPEYKDKFPKDDDIINGIYSYANLKTLLQYIKEEFMSMSEVI
FT                   ENNCSDNIMKRIVNYIDRNYYKDIKLEMLAEIFNYNSAYLGKMFKNHTNESFNSYLDKI
FT                   RIENAKKLLTNDSLKVYQVSEKVGYKNIDYFYSKFKRYVGMSPKEYKKLNKCENL"
FT   gene            72635..74287
FT                   /locus_tag="Clocel_0038"
FT   CDS_pept        72635..74287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0038"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gym:GYMC10_5611 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49827"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL49827.1"
FT                   /translation="MKKTKLLSLLLVSALAVTSLVGCGSKKEEAKTEKDDKAPITFSFY
FT                   SADGVANDFTDPIAKKITEKTGVSLKIDYPVGGNNQKVPLMIASGEYPDLIYAKGDTTK
FT                   LVEAGALVPLDDLIDKYGPNIKKLYGDYLNRLRFSSEDKKIYTLGVYGVNNANWKPDGS
FT                   MQIQNAVLEDAGYPQVKTLDDVYKLIKNYKAKYPTINGQETIGMSLCADDWRWLITVGN
FT                   PSGFVLGQGDNGQWKVDPETYKAEYKFLDPQMKEYYTWLNKLYKEGLLDPESFTQKYDQ
FT                   YIAKLSTGRVLLISDAYWDYKDANISLNANNQANRTFFPLAVTLNDKVKFNMTNAGYSG
FT                   ASGVGITTSCADPERAIKFIDWLCTDEAQILNNWGIEGVNYEIVDGKRVVPQAEKDKKN
FT                   TDKDYGKKTGLGQYGYPFPQYGDGVQDESGQYYTTNSKEDIIADYNEAYKKTLAAYGKK
FT                   MVLDMFPDEKDFPVSDFGAAYNIKIPNDSPITIAQKKADDLSQSKIPQLIMSNNFDADW
FT                   TAYQKDLNTPELQTANEEMTKLIKATVDLWSGK"
FT   sig_peptide     72635..72703
FT                   /locus_tag="Clocel_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.661 at
FT                   residue 23"
FT   gene            74507..75466
FT                   /locus_tag="Clocel_0039"
FT   CDS_pept        74507..75466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0039"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_5613
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49828"
FT                   /db_xref="GOA:D9SMP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL49828.1"
FT                   /translation="MENTTVKDEELKFSKKKKIGLKNLIEQKYLIFMSLPFVIWAIIFK
FT                   YVPLWGWTMAFQDYKPAKAFSEQTWVGFKHFKAFITDPEFPKLMRNTLGMSILGIIFGF
FT                   VVPIIFALLLNELRGNKFKRTVQSVSYLPHFVSWVVTASIVTTLLAAPSGPINQLLMNL
FT                   HIISKPIQFLSEPKLFWGIVTVSDVWKETGWNAIIYLAAMTGIDPELYDAAKVDGAGRF
FT                   RRMWNITLPSIKPTIMVLLVMSIGSLINIGFEKQFLLKTPMVMDYANVLDLYALNYGIG
FT                   MFRYSFGTAIGIFKSVISIILIFSANKIAEKWGEGKIL"
FT   gene            75485..76390
FT                   /locus_tag="Clocel_0040"
FT   CDS_pept        75485..76390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dth:DICTH_0039
FT                   transmembrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49829"
FT                   /db_xref="GOA:D9SMP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL49829.1"
FT                   /translation="MEAVKAKKKRDIGAFDIFLYVLMILVMIATLYPFLNVLAISLNDS
FT                   MDTIKGSNFIIPREFTFDNYKEIFKYNNLVSAFFMSVLRTAVGTFTAVICTAMLAYVFS
FT                   RRDYAFNRPVVVLFVITMYVSGGMIPEYMLIKNIGLVGKFSVYIIPALISVFNVIVMRS
FT                   FIDGIPISLQESARIDGANDFVIFYKIIMPLCIPVLATISLFVAVGQWNSWFDTYLYSA
FT                   GKAWLSTLQFEMIKIMDNTNATTAISQAQVNSNSVTNAVVSPQSIRMALTITATVPILL
FT                   VYPFVQKYFVAGMTLGAVKS"
FT   gene            76532..78565
FT                   /locus_tag="Clocel_0041"
FT   CDS_pept        76532..78565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0041"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="KEGG: gym:GYMC10_5609 beta-galactosidase; PFAM:
FT                   Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49830"
FT                   /db_xref="GOA:D9SMP5"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP5"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ADL49830.1"
FT                   /translation="MKNLSSIFYGGDYNPDQWPDEIYQEDMRLFKLAGINIITIPVFSW
FT                   ALLQPSEDEYKFEWLDKILDLAWENGISVCLATSTAAQPSWMSKKYPEMLPVDFYGRRR
FT                   KHGGRVNFCPNNEKYHEFSTKLTGLMAERYKNHPAIALWHIGNEYGNYCYCDKCEEEFR
FT                   NWAKKRYGTIENLNKKWYLNFWGHTIYDWDEIVIPSGLSEVWMDGWTAKTNFQSIAIDY
FT                   NRFMSESVFNCYKAEYDIIKNITPEIPITTNLMGTFKPLDYFKWAEYMDIISWDNYPSL
FT                   TDPMFKTAMRHDLMRGLKDGKPFLLMEQTPSQQNWQPYNSVKRPGVLRLQSYQTLAHGA
FT                   DAIMFFQLRQSIGACEKYHGAVISHAGHENTRVFKELTQIGDELKALGDKTIDSRMQAK
FT                   VAIVFDWENWWAVEFSSGPSKDLNYVEQVEKYYEAFYNMNIAVDMVKPEADLSQYKIVV
FT                   APVLYMLRPGVAKNFESYVENGGTFVTTFFSGYVDETDIVKVGGYPGELRKLLGLWVEE
FT                   IDAIFPDMSNSIVMKETVGKLEKEYISKMLCDILNVETAKVLAVYGKDFYAGKPALTVN
FT                   NFGKGKAYYIATDPEQSFIAGLMEVLCEDNSITAPFQAKAGVEIAQRFKDDKEITFIMN
FT                   YNDEDVVINLKDENYIDLIKNKGKKGEILIKSKDVLVLERKI"
FT   gene            79044..79808
FT                   /locus_tag="Clocel_0042"
FT   CDS_pept        79044..79808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0042"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   cbk:CLL_A3042 formate/nitrite family of transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49831"
FT                   /db_xref="GOA:D9SMP6"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP6"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ADL49831.1"
FT                   /translation="MAEVIHDVCKTAHKKLALYKKGKGRYFVSSALAGLYIGLGIILIY
FT                   TVGGYMHAANSPMTKVAMGAFFGIALSLVMMCGADLFTGNTLVMPIASLEKEVSWKDTF
FT                   KIWGLSYFGNLIGSIVLAFIYKASGLASGHTGEFISEVVATKMTTPYGELIVRGILCNI
FT                   LVCLAVWCTIKLKEETAKLIMIFWCLFAFITSGFEHSIANMFLLATGLLVANDPAVSIA
FT                   GYIHNISAVTIGNIIGGVVFVALAYWYIGKEK"
FT   gene            complement(79966..80868)
FT                   /locus_tag="Clocel_0043"
FT   CDS_pept        complement(79966..80868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0043"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase; KEGG:
FT                   cac:CAC0031 phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49832"
FT                   /db_xref="GOA:D9SMP7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP7"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ADL49832.1"
FT                   /translation="MIKVYNRTTEKYEIEKVAGEKFLNMLYSSPAGKGPLELFIKKKAF
FT                   SRVYGAYNDSFLSKRSIPKFVNSFDIDMDQSVKQLKEFKSFNDFFTRNLVETARPISKN
FT                   NSDFISLGDGRLIAYTNIDMNNLVQVKGLTYSLKDLIKNDTIANKYAGGICLILRLNPT
FT                   DYHRFHFIDSGVCSETTKIKGHYYSVNPIALEKIQRLFCENKREWSIFKSDNFGELLYV
FT                   EVGATCVGSIIQSYKPNKPVARGDEKGYFKFGGSTVILFIEKDKLKLDDDILAQSSLGI
FT                   ETKVSLGETIGCKIQNYNV"
FT   gene            81432..81653
FT                   /locus_tag="Clocel_0044"
FT   CDS_pept        81432..81653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0044"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: cac:CAC0669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49833"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP8"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADL49833.1"
FT                   /translation="MDQNIKPEILDKLTKICLCKSISRATIKAAIIKGAKTIEEVNKAT
FT                   GAGTGGCQGRRCGPKIQELLEAHENGEF"
FT   gene            81760..81834
FT                   /locus_tag="Clocel_R0010"
FT                   /note="tRNA-Arg2"
FT   tRNA            81760..81834
FT                   /locus_tag="Clocel_R0010"
FT                   /product="tRNA-Arg"
FT   gene            81936..82379
FT                   /locus_tag="Clocel_0045"
FT   CDS_pept        81936..82379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0045"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   cac:CAC0123 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49834"
FT                   /db_xref="GOA:D9SMP9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP9"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADL49834.1"
FT                   /translation="MNNNFLKIAIEEAKKARELGEVPVGAVIIKDDKVIAAAHNLKETK
FT                   KEVTAHAELLAIKMASEILDNWRLNDCEIYVTLEPCAMCASAIVQSRIKKIYIGTFEPT
FT                   TGACGSVINLVQNEALNSFVHVEWLYSDECSDIITEFFKERRS"
FT   gene            83108..84976
FT                   /locus_tag="Clocel_0046"
FT   CDS_pept        83108..84976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0046"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   csc:Csac_0715 amino acid transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49835"
FT                   /db_xref="GOA:D9SMQ0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ0"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADL49835.1"
FT                   /translation="MDIKSIILGKPLKNSEIKHERLSRLWGLPIMASDAVSSVAYAIEE
FT                   ILLILIPAVGLLSFKLVPSVVIPILILLSILVLSYSQIIDTYPNGGGAYAVAKENMGKT
FT                   PSLLTAAALIIDYIMTVAVSISSASAALSSAFTVLQEHKILVSLICVAFITLMNLRGIR
FT                   EASKVFGLPTYIFIGSMAILIICGVFKMVSGTLNPISYAEPILPAETVKGIGILILLRA
FT                   FSSGCSAMTGVEAVSNAVPSFKDPTTRNAKHILYMLGIIIVFIFGGTSILAVHLNVAPL
FT                   EGHTVLSQISSAVFGNNFMYYIIQIFTALILILAANTAYNGLPQLLYILAHDGYVPRQF
FT                   SSRGTKLSFSNGIVFIFIAASILIIGAKSDVHKLIPLYSVGVFISFTVSQFGMFRRWIR
FT                   NKGKNWHYKAFINGLGSLVTLVVSGIVLFTKFFDGAWMLVIAMPALMVGMYFINKYYTF
FT                   IGRQLTLKTFNPYDKDEVTSTQCILLVHDINKPFLKAMNYANSISDNIVALHVCRHPEH
FT                   AEELRNQWKDLKIPVELVIIETPYRDIIKPMDDYLWKRESQLKHGENISVIMIKFLSTH
FT                   WYDRFLHNQTTYFLEHHLSRHKNVSTVILPFHYKFDKSLLRKHKNS"
FT   gene            complement(85197..86177)
FT                   /locus_tag="Clocel_0047"
FT   CDS_pept        complement(85197..86177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0047"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: cbe:Cbei_4326
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49836"
FT                   /db_xref="GOA:D9SMQ1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADL49836.1"
FT                   /translation="MNTIINKIIHNLINNYGFVVEKYGDNVNNSDKLVLLKYLPDGIYS
FT                   VIFSNAYDEASNAMFLRKYLLVKGQKFIINNIIFLESTHNYIPSSPFYNYMLIDSKAKI
FT                   ILYSNIAIDSLRSSVENSLFSRKHIKNNLFSSNQITSIIIFLNIVIFLYSSYINGDIFD
FT                   INTLILVQLGAKVNSYIINGEFYRLLTCTFLHSGLMHIAFNMYALNNIGRLIERVYGWK
FT                   KFILIYIFAGLSGSLASFLFSPYVSVGASGAIFGLFGAALIMGLKLKKYINSNFLGSLA
FT                   SVIVVNVIFGFSSTGIDNYGHIGGLLGGLLMGALLFNKKNALAKL"
FT   gene            complement(86417..86662)
FT                   /locus_tag="Clocel_0048"
FT   CDS_pept        complement(86417..86662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0048"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: cbi:CLJ_B0097 transcriptional regulator, AbrB
FT                   family; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49837"
FT                   /db_xref="GOA:D9SMQ2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ2"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADL49837.1"
FT                   /translation="MRSTGIVRKVDELGRIVIPIELRRTLDIEIKDALEIYVNSEEIIL
FT                   KKYQPSCIFCGEVKDVENYKGKKICHNCLNELKENV"
FT   gene            87086..88021
FT                   /locus_tag="Clocel_0049"
FT   CDS_pept        87086..88021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0049"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ckr:CKR_2696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49838"
FT                   /db_xref="GOA:D9SMQ3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ3"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADL49838.1"
FT                   /translation="MLKRVTMLFVSAIFCVSIAGCDKKATSTEDSEKIQVVASFHAVKE
FT                   ITTLVGGDKVDIVSIVPSGTEAHDFEPKASDIKRIAGADIFIYNGLGMEEWVDDALNSA
FT                   QNSELQIINLSKSSDLIKLSDEEQNHVDMEDTSENKEDHKHGEYDPHIWLSIKEVEKSI
FT                   LTIKDKLVEEDPENKSYYEENYNKNVKRLQDIYEEYKAKFDGLNNKSFIAGHEAFGYLC
FT                   RDFSLKQIGVEDAFASGDPSPAKLKALVDYVKENKVKTIFSEEAASSKISDTLAKEVGA
FT                   TVKPLVTFENSGSYIDDMRKNLDIIYEGIK"
FT   gene            88311..88400
FT                   /locus_tag="Clocel_R0011"
FT                   /note="tRNA-Ser4"
FT   tRNA            88311..88400
FT                   /locus_tag="Clocel_R0011"
FT                   /product="tRNA-Ser"
FT   gene            88510..88610
FT                   /gene="ffs"
FT                   /locus_tag="Clocel_R0012"
FT   ncRNA           88510..88610
FT                   /gene="ffs"
FT                   /locus_tag="Clocel_R0012"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            88933..90552
FT                   /locus_tag="Clocel_0050"
FT   CDS_pept        88933..90552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0050"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   cno:NT01CX_0825 DNA polymerase III subunits gamma and tau;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49839"
FT                   /db_xref="GOA:D9SMQ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ4"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADL49839.1"
FT                   /translation="MAYKALYREWRPRNFGEVVGQSQVTVTLKNQVKNNRIAHAYLLCG
FT                   TRGTGKTSTAKILSKAVNCLNPIDGEPCNECEMCKKINEGIAIDVTEMDAASHNGVDDI
FT                   RNIIEDVQYPPQEAKFKVYIIDEVHMLTMGAVNAFLKTLEEPPKRVLFILATTDPQKLP
FT                   ITILSRCQRYDFKRIRNVDIQARLRSIVDNKNIEADDLALSFIARICDGALRDAVSILD
FT                   QSIAMGNGVVNYDDVINILGIVTNEHLLRLTECIIEKDIGKAIHVVDDVIYSGKDVNLF
FT                   VKELVTHMRNLLMVKVTENPEEVLDMSMENIAHVKEQSSKIRVEEIMRHINILQESEEQ
FT                   MKWSKQSRIYLELAIIKMCKIEYDTSKEMLLSRINKIEEMIQSGDISLEIKPKEEQQKP
FT                   IIKPRAASVPKVQEISHTDEENSALSSDISLEYVKKHWQDILETLKQKRLMSIYAYLKP
FT                   GEPVECVNGVLKVKFGEKYGFSKVNLEKSENGKKVEEIFYQVLKGKIRIVYIVEQNDNR
FT                   YSESPEKILRDSLGVDIEVIDE"
FT   gene            90609..90953
FT                   /locus_tag="Clocel_0051"
FT   CDS_pept        90609..90953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0051"
FT                   /product="uncharacterized protein family UPF0133"
FT                   /note="PFAM: uncharacterized protein family UPF0133; KEGG:
FT                   cac:CAC0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49840"
FT                   /db_xref="GOA:D9SMQ5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ5"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADL49840.1"
FT                   /translation="MARGFGGGGFGGGNMNNLLKQAQKMQQQMEDMKKDIENKHFSASV
FT                   GGGVVTAVVTGKKDIVSLKLNEEVVDPDDIETLEDLIVSALSEAMKKADEETSKEFGKI
FT                   TGGMNIPGMF"
FT   gene            90966..91562
FT                   /locus_tag="Clocel_0052"
FT   CDS_pept        90966..91562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0052"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain-containing protein; Zinc finger C4-type, RecR; KEGG:
FT                   cno:NT01CX_0823 recombination protein RecR; SMART: Toprim
FT                   sub domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49841"
FT                   /db_xref="GOA:D9SMQ6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ6"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADL49841.1"
FT                   /translation="MEFYPVAIEKLIEEFAKLPGIGYKTAQRLTLHVLNLPKEEVSEFA
FT                   EALVKARGTIKYCSICGNYTDTDPCSICSNPNRENSIICVVEEPKDIMAVEKVRDFNGT
FT                   YHVLHGTISPMAGRGPNDINLKQLVSRMKDNIKEIIVATNANVEGEATAMYISKILKPF
FT                   DVKVTRIAHGLPMGGDLEYADEITLAKALEGRKEI"
FT   gene            91693..91959
FT                   /locus_tag="Clocel_0053"
FT   CDS_pept        91693..91959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0053"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: swo:Swol_0034 SigmaK-factor processing
FT                   regulatory BofA; TIGRFAM: pro-sigmaK processing inhibitor
FT                   BofA; PFAM: sigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49842"
FT                   /db_xref="GOA:D9SMQ7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ7"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADL49842.1"
FT                   /translation="MIETIIMAVIVITILYIIIKILAKPIKLFFKLALNSLVGIIVLNL
FT                   YNHFLATTFNFPIPVNTVTALIVGFLGIPGFILVVFLQFFVGL"
FT   gene            91992..92198
FT                   /locus_tag="Clocel_0054"
FT   CDS_pept        91992..92198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_1196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49843"
FT                   /db_xref="GOA:D9SMQ8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ8"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1196"
FT                   /protein_id="ADL49843.1"
FT                   /translation="MELLAGIFLVIIGFKMLIKPKGIWRISESWKNKRNVEPTILYIRA
FT                   LQILGCILVVLGVTEIIDFIEGI"
FT   gene            92821..93204
FT                   /locus_tag="Clocel_0055"
FT   CDS_pept        92821..93204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0055"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ctc:CTC01984 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49844"
FT                   /db_xref="GOA:D9SMQ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ9"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL49844.1"
FT                   /translation="MINIDPRSSTPIYQQIIDGIKENILKGIVEPGDKLPSVRELSAII
FT                   TTNPNTISKAYSELEREKVIETIRGRGTFVSREYKPKIQEDKVIMLKEAIKKIVLEAQY
FT                   MGITKEELEKMLEEFYEELKKKE"
FT   gene            93225..94118
FT                   /locus_tag="Clocel_0056"
FT   CDS_pept        93225..94118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0056"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cno:NT01CX_0243 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49845"
FT                   /db_xref="GOA:D9SMR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49845.1"
FT                   /translation="MISINGVSKAFEDKEVLKNVSLKVERGSIFGLIGPNGAGKSTLIR
FT                   GLTGIYCMDKGTIEIDGQKVFDNAEVKEKIGYVADVNDYFDMQKVKQALKFYTIAHKNF
FT                   DLEKFHRINAFFKIPLNRRVSKLSKGMKTRLAIMLNVCMKPEVLVLDEPTSGLDPIVKR
FT                   SVMNLLIDEVAENGTTIFISSHNLGDLERICDSVAIINEGEIKYTNSIENMKQSIKKLQ
FT                   VVFKEEAPKDIRTWSEVCSVSNIGKVYHIVTKEYNEEFLTRLRSYGLLIEEEIDMNLED
FT                   MFIYSVGGEEIYGEIF"
FT   gene            94102..95244
FT                   /locus_tag="Clocel_0057"
FT   CDS_pept        94102..95244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_1887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49846"
FT                   /db_xref="GOA:D9SMR1"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR1"
FT                   /inference="similar to AA sequence:KEGG:Cbei_1887"
FT                   /protein_id="ADL49846.1"
FT                   /translation="MGKFFSKAIFYEQWSRLWAFIIAIVFIIGIKPINFLGSVKTIESI
FT                   KSFDEIPAMMSLGINLDLADYFLLIVMLITLVAMSTGSNKQKSLSFLNSKNVTRKQILG
FT                   TQFIAVLTISMIAIIISTIVRVIVYFSVKEVFNEYLNIYISDIVIYFFTVSIVTINVLS
FT                   VTFLYQAIFGKTIISVLAIPATLGYLIIGPIILWRINYHFRFIDALGNSIEKVLFKLYD
FT                   VATQQYLRGGDYLVNGTCSKRDSISWMVIVFIITVILIFIMFLLNQYYEVQNLGNIFVF
FT                   SKVKVATNLLITIMSASFISIILYAIYSKIHAEATGEALRIMLAQDSFSPGLVKSSENL
FT                   VRHICNIISFVVSPFIYMLLNKIVNVIDGVEGKKIRKIKI"
FT   gene            95262..96188
FT                   /locus_tag="Clocel_0058"
FT   CDS_pept        95262..96188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0058"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cno:NT01CX_0241 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49847"
FT                   /db_xref="GOA:D9SMR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49847.1"
FT                   /translation="MNVLEVKDLRKGFGKREIIKGISFNVKEGEIFGFLGPNGAGKTTT
FT                   IRMLVGLIKPNSGSITIMGRNLNENTQEALKNVGAVVENPELYRYLSGRENLMQIARVR
FT                   NVSKEEVEDTIKLVGLENRINDKVRKYSLGMKQRLGLAAALLSSPKLLILDEPTNGLDP
FT                   TGILDFRKIVKQAANERNMAVFVSSHILSEVQQLCDTVAFINNGVIKSVESIKDGEMET
FT                   EFEILSLSINSNDEKQIQLVKEVLKSSPNIEKIDEEYGKYIITAKVNTSSRILKELVLK
FT                   DVEVKELFIRQRGLEQRYMELVEGGIR"
FT   gene            96188..97456
FT                   /locus_tag="Clocel_0059"
FT   CDS_pept        96188..97456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0059"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="KEGG: cbk:CLL_A3441 putative ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49848"
FT                   /db_xref="GOA:D9SMR3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR3"
FT                   /inference="similar to AA sequence:KEGG:CLL_A3441"
FT                   /protein_id="ADL49848.1"
FT                   /translation="MLALIKNEYRKLFRRTQTWVLIGLFLAVMCLGTVFAYYTYRIDQR
FT                   NQKPETQKANIEQQISYLEENKKQFANNESKDNQVKEEYESNIDREIANLRNQIDYLNQ
FT                   VIEKGEENIDWKSNLKTEIDNQKKTIEEMEKNAETNEGTENFVYLNNDLNQQKADLEKL
FT                   QYLYDNDIKPIKGSTFDGYSVINKIFTVLGGIILTLGVIIFSSDIVSGEMNPATVKFLL
FT                   VQPTTRRKILLSKFITIVTAAIGLIVGIQILFFLGIGITNGFGNGNYPVIVGAKFEVLK
FT                   TILLSDGSHPIAIIENSMHIISTSQYFIQYIGFEILFILAGSAFGFMLSTICKSATLST
FT                   VIGIIISIASPIFFQVVKGLKKFVHLLFVAYNDPSMILSGMSAQYYNNIHYNGITGIIV
FT                   LIVTAVICYIVSDIIFTRKDFAA"
FT   sig_peptide     96188..96298
FT                   /locus_tag="Clocel_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.809 at
FT                   residue 37"
FT   gene            complement(97628..98569)
FT                   /locus_tag="Clocel_0060"
FT   CDS_pept        complement(97628..98569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0060"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cth:Cthe_2323 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49849"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADL49849.1"
FT                   /translation="MPEFNKDFIITINNLKDFIVVTYVIIDDFYQKVTPAFIMNRRNID
FT                   KSVMSDSEIITLSLVGELLTIDSEKAWFGFCSKNLRDLFPNFCSRTRFHRVRKSLFRVT
FT                   DAIRKEFMKFLNYQYDRIRIVDSMPIPVCKFGRAHFHKSFKPKAAYGRCASKKETYYGF
FT                   KLHALVALDGYITDFSITAANIDDRDAVWELIDNSVVNTLIGDKGYIGQKIASQLKEIM
FT                   DINLLTISRNNSKIKLLKPLRQLIFKARRRIETTFSQLSEQLNIQRVLAKSTWGFATRI
FT                   VNKILAHNLCYFINKILNIGIDTAKIKTLIFG"
FT   gene            99241..100743
FT                   /locus_tag="Clocel_R0013"
FT   rRNA            99241..100743
FT                   /locus_tag="Clocel_R0013"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            101144..104046
FT                   /locus_tag="Clocel_R0014"
FT   rRNA            101144..104046
FT                   /locus_tag="Clocel_R0014"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            104116..104232
FT                   /locus_tag="Clocel_R0015"
FT   rRNA            104116..104232
FT                   /locus_tag="Clocel_R0015"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 87.22"
FT   gene            104243..104317
FT                   /locus_tag="Clocel_R0016"
FT                   /note="tRNA-Glu1"
FT   tRNA            104243..104317
FT                   /locus_tag="Clocel_R0016"
FT                   /product="tRNA-Glu"
FT   gene            104325..104399
FT                   /locus_tag="Clocel_R0017"
FT                   /note="tRNA-Gly1"
FT   tRNA            104325..104399
FT                   /locus_tag="Clocel_R0017"
FT                   /product="tRNA-Gly"
FT   gene            104722..105432
FT                   /locus_tag="Clocel_0061"
FT   CDS_pept        104722..105432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0061"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="KEGG: cac:CAC0144 sugar fermentation stimulation
FT                   protein A; TIGRFAM: sugar fermentation stimulation protein;
FT                   PFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49850"
FT                   /db_xref="GOA:D9SMR5"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR5"
FT                   /inference="protein motif:TFAM:TIGR00230"
FT                   /protein_id="ADL49850.1"
FT                   /translation="MDIHQKVVRGTFIKRPNRFQAYVILDGEELLVAVPNTGRCKEILT
FT                   EGCTVLLREGLNPKRKTKYDLIAGYKGDKLINIDSQAPNKVVEEALKLGKIDILKKYTL
FT                   VEREKFFGKSRFDFRLTNSQNDIYFLEVKGVTLEEDGHTKFPDAPTERGARHLLELVEA
FT                   RKQGWGAGVLFLIQMDGVTSFSPYDKMDKNFGDALRYAAENGVDIYAYQCSIGEKMLTL
FT                   DKRVPIFLEEHLKS"
FT   gene            105481..105654
FT                   /locus_tag="Clocel_0062"
FT   CDS_pept        105481..105654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49851"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR6"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0806"
FT                   /protein_id="ADL49851.1"
FT                   /translation="MLSEISNCDRCYEKEENRCDGSVDDCICKKCPRNLGQCLTTRYCR
FT                   ETESIIFYEDEY"
FT   gene            105751..107247
FT                   /locus_tag="Clocel_0063"
FT   CDS_pept        105751..107247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0063"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="KEGG: dhd:Dhaf_2889 carboxypeptidase Taq; PFAM:
FT                   peptidase M32 carboxypeptidase Taq metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49852"
FT                   /db_xref="GOA:D9SMR7"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR7"
FT                   /inference="protein motif:PRIAM:3.4.17.19"
FT                   /protein_id="ADL49852.1"
FT                   /translation="MNKSLNDFKDHLKKIEYLKSTIALLHWDLVVKAPEKSVDYRSDML
FT                   GYLSSEEYKLTTGEAMKGFLDVFSTSKDNDDIINAMIRTAKKNYDRVRKIPEDMYKAYT
FT                   IDASKSTNAWEEAKEKNDFSIFYPHLVKMVEYKRNFSKYFGYKDNIYDALLDEYEPNAT
FT                   VKDIDKYFSELKEGIIDILRRVEKSKVNINDDFLKTFFAKEDQKKFTEFILDKMGYDYV
FT                   SAGRIDESIHPFTTNFGNKDVRITNHYHENDFVSAVFSAIHEGGHAIYEQNISDDLIGT
FT                   GLAMGVSMGIHESQSRFYENIIGRSKGFWKFFFPEAKKRFPQFKNVSFDDFYRAINKVQ
FT                   CSLIRIEADELTYSLHIIIRYEIEKMLINGEIEVKDLPSVWNDKYEEYLGVRPDNDAVG
FT                   VLQDVHWSDGSFGYFPSYALGNIYGAQLLIKIEKEIDDMYAKIEQGELSEIKSWLKENI
FT                   HKYGAIYEPRILLEKITGERLKPKYFLDYLRKKYEEIYEL"
FT   gene            107781..108707
FT                   /locus_tag="Clocel_0064"
FT   CDS_pept        107781..108707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0064"
FT                   /product="Ribosomal-protein-alanine N-acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="KEGG: cac:CAC0152 ribosomal-protein-alanine
FT                   acetyltransferase (acetylating enzyme for N-terminal of
FT                   ribosomal protein S5); PFAM: GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49853"
FT                   /db_xref="GOA:D9SMR8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR8"
FT                   /inference="protein motif:PRIAM:2.3.1.128"
FT                   /protein_id="ADL49853.1"
FT                   /translation="MNGQYVTIEVVKSLEREYLIKDKLGISLGRFFVLEFNKDNRFSML
FT                   KVTLYKDEIPVAFKEAITLMLQWLFIKNKMLKVTFLIEEDQDIQVFVDLSFDLEGVITN
FT                   SLVEEEYKSLFLFGIDKNQYFKRGITNNLVLKNDDIVLKLLTPEYSKNMLDYYVRNKNH
FT                   LKPFEPMRDEYFYTLAAQRKLLIDGYNQYMNGTAIGFGIFKDDKLIGRLQCSNIVQGVF
FT                   KNGIVGYSIDVEYQGRGYMKQAMKLFSELAFSDLELHRLEATTLIDNIKSQKVLLACGF
FT                   EEVGISKKYLFINGKWRDHKIFALIRE"
FT   gene            108993..109934
FT                   /locus_tag="Clocel_0065"
FT   CDS_pept        108993..109934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0065"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cth:Cthe_2323 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49854"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR9"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADL49854.1"
FT                   /translation="MPEFNKDSTITIDDLKDFIVVTYVIIDDFYQKVTPTFIKNRRNIA
FT                   KSVMTDSEIITISLVGELLTIDSEKAWFGFCSKNLRDLFPNFCSRPRFHRVRKSLFRVI
FT                   DEIRKELTKFLNYQYDRMRIADSMPIPVCKFGRAHFHKAFKPEAAYGRCASKKETYYGF
FT                   KLHALVALDGYITDFTVTAANIDDRDVVWELTANSEIDILIGDKGYIGQKVASQLKETR
FT                   YIRLLTINRNNSKTKLLKPFRQLIFKARRRVETTFSQLSEQLNMQRVLTKSTWGFATRI
FT                   SNKILAHNLCYFINKFFNIGIEISKIKELVFG"
FT   gene            110269..110907
FT                   /locus_tag="Clocel_0066"
FT   CDS_pept        110269..110907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49855"
FT                   /db_xref="GOA:D9SMS0"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS0"
FT                   /inference="similar to AA sequence:KEGG:Strop_3431"
FT                   /protein_id="ADL49855.1"
FT                   /translation="MKSENRRIVVLITTTIIILVSLYLNIELKDKYMQDQELQCFSYES
FT                   QQKNYYCGPATAVMILRYEGIDMEQEEVAIDLETENYEGTPWYDDSYPMKDTLNKYLKE
FT                   DVYQELSGKCDSNVIVDSIVKTLDKGYLVAVNIVETSLTAHLEGHPRDQDIYHWIVICD
FT                   YEDNGKNFKYMDPAASSVVSWHRGVPKIGTVTSEDLCSMVIDRGVIVSP"
FT   gene            111560..113062
FT                   /locus_tag="Clocel_R0018"
FT   rRNA            111560..113062
FT                   /locus_tag="Clocel_R0018"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            113463..116364
FT                   /locus_tag="Clocel_R0019"
FT   rRNA            113463..116364
FT                   /locus_tag="Clocel_R0019"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            116434..116550
FT                   /locus_tag="Clocel_R0020"
FT   rRNA            116434..116550
FT                   /locus_tag="Clocel_R0020"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 86.61"
FT   gene            116561..116636
FT                   /locus_tag="Clocel_R0021"
FT                   /note="tRNA-Lys1"
FT   tRNA            116561..116636
FT                   /locus_tag="Clocel_R0021"
FT                   /product="tRNA-Lys"
FT   gene            116822..117478
FT                   /locus_tag="Clocel_0067"
FT   CDS_pept        116822..117478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0067"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: str:Sterm_0367 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49856"
FT                   /db_xref="GOA:D9SMS1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS1"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL49856.1"
FT                   /translation="MKDDEIVNITMEYVKDKLEGEGSGHDWWHIYRVYNNALKIAKNEG
FT                   VGDLFVIKLASLLHDIADWKFYNGDVTVGYKETKKWLVNFNLDEQLIEHVARIVKDISY
FT                   KGAGEASLMNTIEGKIVQDADRLDAIGAIGIARTFAYGGNKNKEMYNPNIKPVFHENFQ
FT                   QYKNSNGTVINHFYEKLLLLKDLMNTEGGKKYAEERHTFMEAFLEQFYSEWNVNE"
FT   gene            complement(117572..118021)
FT                   /locus_tag="Clocel_0068"
FT   CDS_pept        complement(117572..118021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0068"
FT                   /product="Peptidoglycan-binding lysin domain"
FT                   /note="KEGG: cac:CAC0213 LysM motif-containing protein;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49857"
FT                   /db_xref="GOA:D9SMS2"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS2"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADL49857.1"
FT                   /translation="MTKKKLSIIISFIVILLIGSGVVYYNTYSSISREIQNSTASIKSN
FT                   SSSVINSAINNTNSDLSSEKTKNDSIATTSDATMAVGIENEDFKFITYKVKSGDTLFSI
FT                   ASEHAPSYTWDSVKDAIINKNSIKDPSLIKAGDEIVIPEEIVKAN"
FT   gene            118478..119518
FT                   /locus_tag="Clocel_0069"
FT   CDS_pept        118478..119518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0069"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   cac:CAC0214 aminopeptidase M42 family endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49858"
FT                   /db_xref="GOA:D9SMS3"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS3"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49858.1"
FT                   /translation="MNYQLLLRELCSENAPSGLEFKLHPIMEKNFGYIKDLEISKDENY
FT                   NLYINKKGKRNGTIMIMAHSDEISLVITEVIEGGFLRFKAIGMDANILLGQEVAIHGCE
FT                   VINGVIGGIPKSKTDDNILKKAVVTSDLFIDTGYPKEYLEEVIKIGDRATLIGEYKNLL
FT                   RNTISSKAIDDRAGILSMLICAQELKEHELDVVFVCSCQEELGHRGAKMASYKVKPNLA
FT                   IAIDVTFDNGEFGDRDRENKLGNGPIICIGPNNHPRMIKKLKEVARKYYIPFGVEVEPG
FT                   NTGSDAWDIQVSRGGIPTVLVSIPIKYMHTSVETANLGDIKNTGRLVARFIEEIKLLDL
FT                   EELTCF"
FT   gene            119509..120471
FT                   /locus_tag="Clocel_0070"
FT   CDS_pept        119509..120471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0070"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   ckr:CKR_3367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49859"
FT                   /db_xref="GOA:D9SMS4"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS4"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49859.1"
FT                   /translation="MLLERLSELVAPSGYEDEVRNFIVNELNGKVDSLNSDKMGNVIAN
FT                   KNGKRKKIIISTHMDETGFIITGFNKEGTLRIASLGDENRDMVSKGVLVGTKKLLGVIG
FT                   AKAIHLQTKEERSKSITLDRCCIDIGAETEFESREYIELGDFAVYDTRFQEMGTNRLKG
FT                   KGFNGRVGCSMLIELLQESESNNIQGIFTTQSLVGYRGAYAAAYELEGDLLINLDVVES
FT                   TDLPGVDDVNISIDKGPVLYLKEKNRDIRALAEKIGIPYQLINDKIYNDSNAYKMELMS
FT                   TNVINILVPCRYVDSYASIISKKDYEDTKNLINSFLKEN"
FT   gene            120473..120754
FT                   /locus_tag="Clocel_0071"
FT   CDS_pept        120473..120754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1207 protein of unknown function
FT                   (DUF996)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49860"
FT                   /db_xref="GOA:D9SMS5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS5"
FT                   /inference="similar to AA sequence:KEGG:DKAM_1207"
FT                   /protein_id="ADL49860.1"
FT                   /translation="MSREMIAIIMIVIGAILAATGILINKKGISIPGTGKEYMKVKAFL
FT                   NIFIGVVSIILGAIFLVINVEVIFVQIAIFVVLILIVLLDFLLKKTVK"
FT   sig_peptide     120473..120529
FT                   /locus_tag="Clocel_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.577 at
FT                   residue 19"
FT   gene            120802..121677
FT                   /locus_tag="Clocel_0072"
FT   CDS_pept        120802..121677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0072"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   cno:NT01CX_0791 aminopeptidase M42 family endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49861"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS6"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49861.1"
FT                   /translation="MDKLFYDISKAFGVDREISEVKAVIREYIEKKHICIYEDEVGNLI
FT                   VKLGTGNKKLLMSALMNRCGYMAVKIDNEESGKVEINGTNIEPKLDGKYLRTKGGAIAR
FT                   IHDGDKIDILVGQIQAGEFLMIDEEIRVFDNKVSGVEVSNISLIYSLIKVIEEVNIKDK
FT                   EVYFVFSYKEDSIFKSNFAAKAIRPDRALFFDSSQNSDKLQLIYMNRKYLANESFKQDI
FT                   LNIAKENDIDITLKDCIDETEADSIHKEVGGIATVVLGLPCKYKNTSLQIIERVAIEEM
FT                   RKLLKEIIEG"
FT   gene            121684..122133
FT                   /locus_tag="Clocel_0073"
FT   CDS_pept        121684..122133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0073"
FT                   /product="VanZ family protein"
FT                   /note="KEGG: ckr:CKR_3365 hypothetical protein; manually
FT                   curated; PFAM: VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49862"
FT                   /db_xref="GOA:D9SMS7"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS7"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADL49862.1"
FT                   /translation="MTKRNISWTLMIVWMAFIFYMSSKNGNDSNEMSNVVINTLRYMGI
FT                   DENRTLQSILTFLVRKSAHILEYCILAWFIFNVAKEYNNLIASSVFTLILSVLYATTDE
FT                   IHQLYIPGRSGKMTDVLIDSIGICMGVAISYFVHKRIYSRKKIKD"
FT   gene            123089..124591
FT                   /locus_tag="Clocel_R0022"
FT   rRNA            123089..124591
FT                   /locus_tag="Clocel_R0022"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            124991..127893
FT                   /locus_tag="Clocel_R0023"
FT   rRNA            124991..127893
FT                   /locus_tag="Clocel_R0023"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            127963..128079
FT                   /locus_tag="Clocel_R0024"
FT   rRNA            127963..128079
FT                   /locus_tag="Clocel_R0024"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.83"
FT   gene            128085..128160
FT                   /locus_tag="Clocel_R0025"
FT                   /note="tRNA-Phe1"
FT   tRNA            128085..128160
FT                   /locus_tag="Clocel_R0025"
FT                   /product="tRNA-Phe"
FT   gene            128580..129368
FT                   /locus_tag="Clocel_0074"
FT   CDS_pept        128580..129368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0074"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: cpr:CPR_0552 transcription repressor of
FT                   fructose operon FruR; PFAM: regulatory protein DeoR; SMART:
FT                   regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49863"
FT                   /db_xref="GOA:D9SMS8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS8"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADL49863.1"
FT                   /translation="MNDLGYSCKWGVKMLIEERKSRILNLLKERDVVTIPELIDSLQVS
FT                   EATIRRDLAYLDSINALKRVHGGATAMKKSLIEPTYNEKQNINVDDKKAIAKYAASLVE
FT                   NGDSIYLDAGTTTYEMVPYLEGKDIVVVTNGLKHIELLIESKIEAYIIGGKIKSSTKAV
FT                   VGIEAIRNLERYKFDKSFLGINGIHLIHGYTTPDAEESTLKEMAMKASKESFVLADESK
FT                   FGQQYFMQVASLDKASIITSSSTNFGEYSKLTEIRKVEEE"
FT   gene            129365..130279
FT                   /locus_tag="Clocel_0075"
FT   CDS_pept        129365..130279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0075"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: cpr:CPR_0551 1-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49864"
FT                   /db_xref="GOA:D9SMS9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS9"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADL49864.1"
FT                   /translation="MIYTVTLNPSIDYIVKVDDFSLGEVNRTEVDEKYPGGKGINVSRV
FT                   LKHLGVESKALGFVGGFTGYYIKESLKGFGVETDFIEVEEDTRINIKIKSNMETEINGA
FT                   GPKISEDKFNELKEKIAKLKDNDVLVLAGSVQSSLSKDTYVQLIKALKSQKIKVVVDTT
FT                   RELLLSTLTHKPFLIKPNKSELAELFNTKIDSLEEVIEYASKLREMGAENVIVSMAGDG
FT                   SLLICDQGVFRAKAPKGQVKNSVGAGDSLVAGFIEGYTKTKDIKEALVHGTASGSATAF
FT                   SMDLCTKEEFELILDKVEVNKLY"
FT   gene            130733..132601
FT                   /locus_tag="Clocel_0076"
FT   CDS_pept        130733..132601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0076"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="KEGG: cpf:CPF_0564 PTS system, fructose-specific,
FT                   IIABC component; TIGRFAM: PTS system, fructose subfamily,
FT                   IIC subunit; PTS system, fructose subfamily, IIA subunit;
FT                   PTS system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49865"
FT                   /db_xref="GOA:D9SMT0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT0"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADL49865.1"
FT                   /translation="MRITELIKKETITLNLKARNKEQVIDELVNKLHSAKVLADKELFK
FT                   KEIWKREKEYSTGIGEGIAIPHAKTKAVKKPALAFGVSREGVEYDSLDGEKVNIVFMIA
FT                   ASEGANNEHLDTLSRLSTMLMNPDFKAALLNAKSEEEVVSLIDKTEAEFLSKETKESIG
FT                   TTGKFIVAVTACPTGIAHTYMAADAIKNKGREMGICIKVETNGSTGAKNVLTDEEIARA
FT                   AGVIVAADKQVEMDRFDGKRVIEVPVVQGMKNPEGLINRILKGDAPVYKAKDSGSKGSD
FT                   VKVKKGFYKHLMNGVSNMLPFVVGGGILIAICFMFGIKAFDPEDPSYNSFAKLLMDIGG
FT                   GNAFKLMIPVLAGFIGMSIADRPGFAPAMVGGLIAANSGAGFLGGLIAGFLGGYVVVLL
FT                   KKVFEFMPESLEGLKPVLLYPLFGIFITGAVMLLVVVDPVTAMNKGLENWLNSLGTSNM
FT                   VLLGIVLGGMMAIDMGGPVNKAAYTFGLAMIAAGNNYPHAAIMAGGMVPPLGIALATTL
FT                   FRNKFTKEERDAGKTCYIMGLSFITEGAIPFAAADPIRVLASCIAGSAVAGGLSMAFKV
FT                   ALPAPHGGLFVLPVVSNKIPYLIAILAGTLVTTFLLGALKKNIKSS"
FT   gene            133052..134662
FT                   /locus_tag="Clocel_0077"
FT   CDS_pept        133052..134662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0077"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ctc:CTC00987 stage V sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49866"
FT                   /db_xref="GOA:D9SMT1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT1"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADL49866.1"
FT                   /translation="MEKQSTTKGFAILTVATMLGKIFSLLYLPFLIRVLADEGYGIYQA
FT                   TYTVFLFIYGLTSTGISTAVSKYISELTALENYKAVKRAFKLTMLLMFLLGLFMTLVLA
FT                   FGAKFFANFTEFDEAKISLITLSPTIFLTAVVSVYRGYFQGSHYMTPTAISQVIEQIAN
FT                   VFFSILFAYLWMPKGVEWGVAGATIGTPLGALAALMYLHVVYIKRAKIKMPQSSKIVKA
FT                   IRNKTIVKNIVNIALPIAISQGVINAAFIVDTKIVMSRLMVAGFSKNEATILFGILAKY
FT                   NTLSNVPIAIIIALSTSVLPSIAAVIATNNTKAAVAKINYSIKLCLLVAVPCTVGLSAL
FT                   SEPIYRLLLGQGHELMMYGSFIIIIWSLVQIHITILQSINKMYVATILMVIGLIPKILL
FT                   DYILVVNIHLHIYGVLIANLVYYALPLFLMRNYMRNKLKLRVKILSQFIKPCIASLWMG
FT                   IAGILSYNGFFKALHIVLPYKLSILIAVSIAIIIAAYLYVTILIFSGVITERDINSISP
FT                   KIKKLLPKILRRKLIKQTA"
FT   gene            134700..135791
FT                   /locus_tag="Clocel_0078"
FT   CDS_pept        134700..135791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0078"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: cno:NT01CX_0623
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49867"
FT                   /db_xref="GOA:D9SMT2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT2"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADL49867.1"
FT                   /translation="MSSVWGNIMKVSLFGESQGDIIGVTIHGIPSGVKLDLEFIKKEMK
FT                   RRLSGNYNVATPRQEDDEFIITTGYFNGYTTGAPLTATIKNKDIKQADNDEFKDKMRPS
FT                   FGDYTEHLRYNGFNDYRGGGHHSGRLTAPLLFAGAVAKLILKEKNIVIGAHILKIADIF
FT                   DEVFDKVNVSEELLKSLPEKLFPVIKDDMGLIMQTEILKAKYQKDTIGGIVECAAINIP
FT                   GGVGNPFFDSMESVISHLLFSIPSIKAVEFGEGFNIANLRGSQANDQMYMEGDKVKTYT
FT                   NHSGGIVAGITNGMPIIFRVAVKPPPTIAKPQKTVDISTKENTTVDTVSAHDPSMIHRI
FT                   VPVIEGVTALAILDSILSGNNHI"
FT   gene            135947..136375
FT                   /locus_tag="Clocel_0079"
FT   CDS_pept        135947..136375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0079"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   KEGG: cac:CAC0899 3-dehydroquinate dehydratase; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49868"
FT                   /db_xref="GOA:D9SMT3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT3"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ADL49868.1"
FT                   /translation="MKFLVLNGPNINMLGTREKGIYGQDNYETLCKIIEEKAKEINVEV
FT                   DVRQSNSEGALIDIIHDTLGKYDGIVINPGAYTHYSIAIYDALLAVNLPTIEVHISNIH
FT                   KREEFRHKSVTAAACIGQIVGLGLQGYALAIQALKQRL"
FT   gene            complement(136472..138031)
FT                   /locus_tag="Clocel_0080"
FT   CDS_pept        complement(136472..138031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0080"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; Rieske [2Fe-2S]
FT                   iron-sulphur domain; KEGG: cth:Cthe_1461 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49869"
FT                   /db_xref="GOA:D9SMT4"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT4"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADL49869.1"
FT                   /translation="MDNQEFLKSFPESFWMASTNATDYPSLDQDISVDIAIIGGGITGI
FT                   SCAYSLKDEGFKIAILEADHIAQGASGHTTAKVTSQHGLIYNKTKLQLGEELAKQYAEA
FT                   NEHAIQRIKSIIDTHHIDCDYKTESAFIYTQQDNYVQKIYNEIATASDLGIKASFVDNI
FT                   PFPIDIKAAVRFDDQGQFHPRKYLLALAKEITNSNCTIYEKTRIVGIDESNKYTLTTER
FT                   GNKITADKVIIASHYPFYNKQAMYFARLYCERSYALAVKAKEKYPGGMYLSAEDPKRSL
FT                   RLINSPNGDLIMVGGETHKTGQSKDTFKHYEAIMNFANGIFTVEDIPYKWSAQDCITVD
FT                   DIPYVGKYIANSPNLYVATGFRKWGMTNSMAAAIIIKDLIVVGKSPWQDVYNPSRKTII
FT                   ASAKNFVVENFNVAEELLGGKLSPLPEDIFLEPDEGKLVKINDERIGVYRDEHCKLHKV
FT                   NTTCTHMGCELNWNSAERTWDCPCHGSRFSHKGDIVEGPAVKPLSFDNNVNTIGKLLNE
FT                   DF"
FT   gene            complement(138297..138554)
FT                   /locus_tag="Clocel_0081"
FT   CDS_pept        complement(138297..138554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaO19.9219 similar to S. cerevisiae TOM6
FT                   mitochondrial outer membrane translocase component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49870"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT5"
FT                   /protein_id="ADL49870.1"
FT                   /translation="MRHKITLSIQPSVKEKGQQRADEMFSGNFSMYITYLINKDVKGII
FT                   ETPIYRNDLSSNIPPKQENDAYEKRKDEIACAIDNILGID"
FT   gene            complement(138544..139431)
FT                   /locus_tag="Clocel_0082"
FT   CDS_pept        complement(138544..139431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0082"
FT                   /product="StbA family protein"
FT                   /note="PFAM: StbA family protein; KEGG: cbe:Cbei_5015 StbA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49871"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT6"
FT                   /inference="protein motif:PFAM:PF06406"
FT                   /protein_id="ADL49871.1"
FT                   /translation="MIMGIDVGYSHTKVYTSNGRDIFRSTVTNGIMDINVNAIKVKIAG
FT                   NEYTVGENTGNFSVKLNKIDDAVFRLCLYTAVARNLPIGEDEVQLVIGLPVQYYKDQKL
FT                   ELKKALEGIQVFLSLNDKPIRFKITKCVVFPQSAGVFVLHPDIFEGSNIVIDIGGMTVD
FT                   VSYFNDMTLQDYRTYELGMIKLYDKLVQNIKAEFGVSYDILNAEDIIKNKRIFRDGELI
FT                   DCTDVVNTTLRTHASLIINRVMAGLSQYDTSQRHFIGGGSYILGEYLPVKAIKEDIYAN
FT                   AEAFFKIGVERFAS"
FT   gene            139690..141612
FT                   /locus_tag="Clocel_0083"
FT   CDS_pept        139690..141612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0083"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="KEGG: cpr:CPR_1334 serine protein kinase; PFAM: PrkA
FT                   AAA domain protein; PrkA serine kinase; SMART: PrkA AAA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49872"
FT                   /db_xref="GOA:D9SMT7"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT7"
FT                   /inference="protein motif:PFAM:PF08298"
FT                   /protein_id="ADL49872.1"
FT                   /translation="MDFEELILHDREKRNKSKFEGSFLEYLELVRNKPEVAKLAHERMY
FT                   NLLMEKGFDVLKAEDNPRVKKIYGNDIIKRYNFFKDDFFGIDKVLIKLVNYFYSAAMKG
FT                   EEARQVLYLVGPVGAGKSSLVEALKKALETADPIYSLKGCPMHEEPLHLIPKHLRGEFE
FT                   EYLGVQIEGDLCPACRYRLLHEYDGQYEKFPVVETSFSIRSRKGVGVVPPVDPNNQDTS
FT                   ILTGSVDISKMDMYPEDDPRIFSLNGAFNVGNRGLVEFIEVFKNDVEYLHTIITATQEK
FT                   SIPSPGKGSMIYFDGVILAHSNEAEWEKFKSDHTNEAILDRIVKIEVPYCLELSEEIKI
FT                   YEKILKKSNFNAHIAPHSIEVAAMFAILSRLTPSAKVDPVTKLKIYNGEEIVEKGTTKR
FT                   IDIGELREEAGQKEGMKGISTRFIIKAIDNALSNSEHNCINPLSIMESMIKSVKEVDIA
FT                   EDEKKRLLGFIQDTIRKEYNKILEKEITKAFIHSFREQAESLFNNYLDNAEAFVNKNKL
FT                   KDRSTGEELVPDEKFMRNIEEQIGISEGSSKGFRNDVTSYMFYLVRNGGTIDYTSYEPL
FT                   KEAIEKKLMASVKDLSRIVTKSRVRDKEQDIKYNTMVEEMKSNGYCDHCCDVVLKYAAN
FT                   NLWKD"
FT   gene            141619..142788
FT                   /locus_tag="Clocel_0084"
FT   CDS_pept        141619..142788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0084"
FT                   /product="sporulation protein YhbH"
FT                   /note="TIGRFAM: sporulation protein YhbH; PFAM: protein of
FT                   unknown function DUF444; KEGG: cac:CAC0580 hypothetical
FT                   protein; SMART: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49873"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT8"
FT                   /inference="protein motif:TFAM:TIGR02877"
FT                   /protein_id="ADL49873.1"
FT                   /translation="MAFFKEYNNPVDYDRAIEDRRRHKQLVEKSIKENLGDILSEESIV
FT                   GQSQNKKFKIPIRGLKEYQFIYGKNSSGVGSGTGEEKRGDKIGSDKGNQGSGKGQAGND
FT                   EGEDFYETEITLEEIFDYLIEDLELPDMDKKKFSEILTDSTSKKSGYQRHGINPRLAKK
FT                   KTVMAKIARTQGQKRAYMEEGLEELPERIPFKEEDLRYHRIKHKPKKESNAAIILVMDV
FT                   SGSMDNSKKYLARSFFYVLTRFIKKKYSNVEIAFVAHSTTAKEVSEYEFFHKGQSGGTY
FT                   ISSGLNKALDIIKERFNSQTWNIYTFCVSDGDNWSEDNERTMKSVRELCTICNMLGYAE
FT                   ILPISYATTIRYKFLNEITEKNFSSVAIKQKQDLWTSLKQMLKKELKEA"
FT   gene            142790..144166
FT                   /locus_tag="Clocel_0085"
FT   CDS_pept        142790..144166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0085"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein; KEGG: cbk:CLL_A3090
FT                   stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49874"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT9"
FT                   /inference="protein motif:PFAM:PF04293"
FT                   /protein_id="ADL49874.1"
FT                   /translation="MEYSVKDLETWNAKIEKLVHEFGLKCYDQEFQLISYNDMIALEAY
FT                   TAMPARYPHWSFGKSYEKTKTLYKYNLTGLPYEMVINTDPCIAYLMKDNTLLLQILTIA
FT                   HVYGHNDFFANNRLFVEGTDASTTTEMFKLHGDRVRSYINDPSIGYAEVERILDAAHAL
FT                   KLQTSRVVGEKRVSEQKLRQRLIDDYENKVEGTDFFGKRNDVPVPNIDKIPIEPEEDLL
FT                   YFIIKYGKLAEWEKTLLEIVRQETNYFLPQIETKIMNEGWASYWHYTILNALDLPSGLH
FT                   LEFLKRHNDVIAPALGGVNPYYVGFKIFEYLDKTYGRDKIFEVRTMDRDSAFLRRYLTE
FT                   DLCRELNLFEYKKTGNDYVIKEVSDEEGWKEIRNNLSSSCGLGSVPIIRVVDMSKKDYT
FT                   LTLEHVYDGRELSLAYGEPTLKYVQELWGRKVVLLTVIDDKKVRLVCDDKKIVKEIIQS
FT                   "
FT   gene            complement(144624..146465)
FT                   /locus_tag="Clocel_0086"
FT   CDS_pept        complement(144624..146465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0086"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); KEGG: ckr:CKR_0928 hypothetical
FT                   protein; PFAM: asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49875"
FT                   /db_xref="GOA:D9SNK4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK4"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADL49875.1"
FT                   /translation="MCGLCGWLDFKRSLVGEINTLKNMTNTLSLRGPDSHGYYIDNNIL
FT                   LGHRRLVVVDPEGGSQPMIKLKNNNKYVIAYNGELYNTENLRHQLINYGYTFDAYSDTE
FT                   VLLTSYIHWGINCLDHINGIFAFAIWDNNNQSLLLARDQLGVKPLFYSKKSSSIIFGSE
FT                   IKTLLANPLVDAVLDEKGLTELFSLGPATALGSGVLKDIEEIPPANYCYITKDSFVQKE
FT                   YWKVTAEEFTENLDSATEHLQTLFVDAVTRQLVGDVPLCTFLSGGLDSSAISAIASRDF
FT                   KNRGKKLDTYSIDYEDNNTFFKPNEFQPTADSVYVDMMSKYIDSSHHNVILRNQNLALA
FT                   LTDATIARDLPGMADVDSSLYLFCKEIRHNFVVGLSGECADELFGGYPWYMKPEMINAP
FT                   TFPWSRSVSNRRSILSDALKRIDIEGCVESHYKNTLKEVPHLDNENQIDYRMRELFYLN
FT                   IKWFMVTLLNRKDRMSMSNSLEVRVPFADKRLVQYAFNIPTDIKFADNREKGLLRRALK
FT                   GIVPDEIIDRKKSPYPKTHNPYYTTLVSCALRDIINNPHSPILNLINVDKVTEIVNTGG
FT                   NAYITPWFGQLMNGPQLIAYLVQLNTWLESYNIKLQF"
FT   gene            147148..148650
FT                   /locus_tag="Clocel_R0026"
FT   rRNA            147148..148650
FT                   /locus_tag="Clocel_R0026"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            149050..151952
FT                   /locus_tag="Clocel_R0027"
FT   rRNA            149050..151952
FT                   /locus_tag="Clocel_R0027"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            152022..152138
FT                   /locus_tag="Clocel_R0028"
FT   rRNA            152022..152138
FT                   /locus_tag="Clocel_R0028"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.83"
FT   gene            152144..152219
FT                   /locus_tag="Clocel_R0029"
FT                   /note="tRNA-Lys2"
FT   tRNA            152144..152219
FT                   /locus_tag="Clocel_R0029"
FT                   /product="tRNA-Lys"
FT   gene            152392..152865
FT                   /locus_tag="Clocel_0087"
FT   CDS_pept        152392..152865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0087"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   cac:CAC3531 IS605/IS200-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49876"
FT                   /db_xref="GOA:D9SL34"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D9SL34"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADL49876.1"
FT                   /translation="MDNSSLAHSKWNCKYHIVFAPKYRRQIIYGKIKADIGVILRKLCE
FT                   HKGVEIIEANACKDHIHMLVSIPPKLSVSQFMGYLKGKSSLMIFDRHANLKYKYGNRQF
FT                   WCKGYYVDTVGRNKKIIEEYIKNQIQEDLAYEQMSLKEFIDPFTGESVNKGKK"
FT   gene            complement(153289..154695)
FT                   /locus_tag="Clocel_0088"
FT   CDS_pept        complement(153289..154695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0088"
FT                   /product="Protein of unknown function DUF2334"
FT                   /note="PFAM: Protein of unknown function DUF2334; KEGG:
FT                   cbe:Cbei_2946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49877"
FT                   /db_xref="GOA:D9SNK6"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK6"
FT                   /inference="protein motif:PFAM:PF10096"
FT                   /protein_id="ADL49877.1"
FT                   /translation="MQKIQFIIRYCMSLSIIFVLSSILLAPSINPLNKDLIVSKGDLKV
FT                   SNNVLLGPKLNENYNIIEKTTHISPIAKVEPLNNITFKYEGTRITFNCELYASAQRYYL
FT                   PLDVMLTLLGGSYTERVNSINVFYNSIKYTVFKDSYAVKVDDGSSFILRGGIILKNDKI
FT                   YLSLSDLEYIFNLVDDWNYDANEVSLFKSRTPIITKASEQSGTAALIRLEDVSAGSVML
FT                   CNDSLKKMKALADYFYSEGTKFHVAWIPRYREPSQGIDNDLLEISNIANAQFVNMLDYL
FT                   IYRGAIIGAHGYTHQHDSETSIVSTELDKNNNNDIVSTKKIIQSALETANKLNIPITFF
FT                   ESPHYAATELQQSVIENYFHYIYEPCVGIWNKMPIVSRRNKTTIYVPAPLGYMHDQDVD
FT                   DLIDRINNREKGSLASFFYHPMKEFDYIKFNVETDGYVSYTYSSESPMHKILKTLKDNN
FT                   YSTITIDKIR"
FT   gene            complement(154943..155800)
FT                   /locus_tag="Clocel_0089"
FT   CDS_pept        complement(154943..155800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0089"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   KEGG: cbk:CLL_A2856 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49878"
FT                   /db_xref="GOA:D9SNK7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK7"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ADL49878.1"
FT                   /translation="MKIKDILDNRQSFSVELFPPKKTDSFDNIINTLDNLNGLDIDFVS
FT                   VTYGAGGSSRDNTVKLSKKIKSEYNLEVITHLTCINSKKDEIASLLDEMKENNLENILA
FT                   LRGDIPSEVIYDDYKYASDLIPEIKSLGDFCVGAACYPEKHPEAPSNVYDIKKLKQKTA
FT                   LGCDFLISQLFLDNTMFFNFQERLELADVNTKVLAGIMPVINKAQFERIIQLSGCNVPP
FT                   KFKKILEKYEHNPSALKDAGIAYAIDQIIDLMCHDVDGIHLYIMNKPENAKRILDNITG
FT                   LRNA"
FT   gene            156482..157984
FT                   /locus_tag="Clocel_R0030"
FT   rRNA            156482..157984
FT                   /locus_tag="Clocel_R0030"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            158385..161287
FT                   /locus_tag="Clocel_R0031"
FT   rRNA            158385..161287
FT                   /locus_tag="Clocel_R0031"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            161357..161473
FT                   /locus_tag="Clocel_R0032"
FT   rRNA            161357..161473
FT                   /locus_tag="Clocel_R0032"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.83"
FT   gene            161479..161554
FT                   /locus_tag="Clocel_R0033"
FT                   /note="tRNA-Phe2"
FT   tRNA            161479..161554
FT                   /locus_tag="Clocel_R0033"
FT                   /product="tRNA-Phe"
FT   gene            161560..161634
FT                   /locus_tag="Clocel_R0034"
FT                   /note="tRNA-Cys1"
FT   tRNA            161560..161634
FT                   /locus_tag="Clocel_R0034"
FT                   /product="tRNA-Cys"
FT   gene            161810..162925
FT                   /locus_tag="Clocel_0090"
FT   CDS_pept        161810..162925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0090"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: abm:ABSDF1051
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49879"
FT                   /db_xref="GOA:D9SNK8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK8"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADL49879.1"
FT                   /translation="MTKEQNYIKNRVESLDWLRGLAALSIMLYHLYSWEVAPLYADSLL
FT                   GRFGIYAVSIFFILSGLSMAIVYSDFIKDIKTAIAFLIRRIFRIWPLLWVVTTFNFIIN
FT                   IKSGFSTEQIFVYIANITTIFGFIKPEAYISTGAWSIGNEMVYYVITIIIIMAYRRKKL
FT                   YGNILFVASLIIGYLFAFKFLNPNMELAKQWIIYINPFNNLFFYIGGIAIYYNLKRIDF
FT                   NKYFNNISLCVAMGLFNFIPVCGNQIFITTSIWRVVFSALSFIIVIGFYKLKLDMPKFI
FT                   GKPFELFGIATFGVYLIHPVVYYVIKKLISEKLKLSGYGMMGTIMIIISVSLITILLAL
FT                   VSYYKFELRFMKYGKRYSMISKKEKNRNLSI"
FT   gene            163500..164330
FT                   /locus_tag="Clocel_0091"
FT   CDS_pept        163500..164330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0091"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   ecb:100061213 aldehyde dehydrogenase 18 family, member A1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49880"
FT                   /db_xref="GOA:D9SNK9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK9"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ADL49880.1"
FT                   /translation="MNFDCELVGKVGSMALIRKGEYDIDYNVFSRLGKELYPGCIWVSS
FT                   GAVEIGRIDYMKRNNLNEIENYDIEEVKSNYASQGQAILMENYRKFINPNFSVRQLLVE
FT                   HHHFNDVEKREFIRKLLLNSIKQNAIPIVNYNDSVSNEEIRKMELYNLRLNQDKVVECI
FT                   DNDETASAISVLVKSKYLLILTSEIGLLKDPRDTKTLIREVEGKDTYELIDHISELQQY
FT                   CIGASREGANGMKAKLEYLIEPIKQGTTVIIGHSKYGISDLIKGNVERTIFRVR"
FT   gene            164453..165235
FT                   /locus_tag="Clocel_0092"
FT   CDS_pept        164453..165235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0092"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   cpf:CPF_0978 phosphorylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49881"
FT                   /db_xref="GOA:D9SNL0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL0"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ADL49881.1"
FT                   /translation="MTIYDKLKANMEKFSGCTDFLYNIYGLDENEEYEAIILAPSWKPE
FT                   KIFKNFNVEIDVVKEGADYKGYVIHIDGKKYGYIQTGCGASNIVDCCLTLGCTKCSKVI
FT                   FIGAVGALKDDMMLGDIITPSKSIAGDGASLYLYENISVDNFQQLVYPKAQVVENVRIA
FT                   SKKLGIELKEKVVYCTDSIFCEYFHLNEIMKLGSEAIEMETAAFYRCMEIMNKDGIALL
FT                   CVSDNSATENAFVGRCEEDTKKFHESRETLIPKLILSL"
FT   gene            complement(165562..166488)
FT                   /locus_tag="Clocel_0093"
FT   CDS_pept        complement(165562..166488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0093"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   cbi:CLJ_B0082 LD-carboxypeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49882"
FT                   /db_xref="GOA:D9SNL1"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL1"
FT                   /inference="protein motif:PFAM:PF02016"
FT                   /protein_id="ADL49882.1"
FT                   /translation="MIADKLQLGDTIGIVAPASGERKEIIDNGISCLKKLGFNVKIGNH
FT                   VYDKYGFLAGNDKNRAEDFMAMFLDPEVKMVMCMRGGYGSMRIIDYIDMNIIESNPKIF
FT                   TGFSDITILLNYINKLTGLITFHGPMINSDINDEYTLKSFLSTLTESKATYLLENPDYL
FT                   ALECSVNGIVEGEIVGGNLAMICSSLGTPYEIETTDKILFIEEVGEAPYRIDRMFTQLI
FT                   HSGKLDKCKGFILGQFKDCGLSNYDRSFTLPQVIEDRIFSLNKPTISHFMSGHGNPKIT
FT                   IPIGAKIQLNCNTSEIKVLEPVVKVLS"
FT   gene            complement(167373..168326)
FT                   /locus_tag="Clocel_0094"
FT   CDS_pept        complement(167373..168326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0094"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: cno:NT01CX_0767 magnesium transporter CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49883"
FT                   /db_xref="GOA:D9SNL2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL2"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADL49883.1"
FT                   /translation="MISIYKSDLDLSDNLIKINSVEPGSWINLVAPTDQELILISKKTC
FT                   VPLDFLKAALDDEETSRLDVEDGNTLIIVDIPFTEVEENSLTYDTYPLGIIHTDSYIIT
FT                   ICIKNSRILNDFITDKIKSFYTFKRSRFILQILYRVSSYYLSSLRQINKKSLMLQGKLH
FT                   KSMNNKVLMQLLSLQNSTVYFSTSLKSNEVTLEKISKLEFAQKYEEDKELLEDVIIETK
FT                   QAIEMTQIYGGILQATMDTSANIINNNVNTVMKFLTSVTIAMAIPNIISGIFGMNITGL
FT                   PFSVNESGGGFAIVISIILGSTLLTILFLNRRGLFK"
FT   gene            168828..169328
FT                   /locus_tag="Clocel_0095"
FT   CDS_pept        168828..169328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbi:CLJ_B0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49884"
FT                   /db_xref="GOA:D9SNL3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL3"
FT                   /inference="similar to AA sequence:KEGG:CLJ_B0084"
FT                   /protein_id="ADL49884.1"
FT                   /translation="MYNEMVTHKKLPMVIIWIVLLLSLIVAKEIIASYSSMESTIRIVL
FT                   EVFLLIIGSVGTCYQIRVCKIKYRYSVIANELIVKKIIGRKKKVQEIVKLEDIVFLGKA
FT                   NECRSLTNKFCHKYICLSCSNEKYCCIYNSGKKIKKFFFQPSGAFVEKLNHCVYLNCTT
FT                   KTV"
FT   gene            complement(169449..170621)
FT                   /locus_tag="Clocel_0096"
FT   CDS_pept        complement(169449..170621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0096"
FT                   /product="amidohydrolase-like protein"
FT                   /note="KEGG: cbl:CLK_3228 amidohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49885"
FT                   /db_xref="GOA:D9SNL4"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL4"
FT                   /inference="similar to AA sequence:KEGG:CLK_3228"
FT                   /protein_id="ADL49885.1"
FT                   /translation="MKQEMITYLSTVKDELLKFSHTLHNCCEESYHECNNAKLISKFLA
FT                   MNNFNITENYLDIKTSFFAQKGDGHPKICFLCEYDSDSNVGDILATNLRTTMSVGAAIA
FT                   IGNSIDKIGGSVIVIGCPGELKGGSKSILVKQGAFEDIDTVLTARPHVVTAESGTSLAV
FT                   LPIEINYTTKDKYYNNNGFYSSLDACLYTLNGLNVLINGYGDSCFINGISINSPSTPYF
FT                   SPTLTKITFYIKAKTMKTLKDVDKKIRIFVKNTAEIMNVDSEIHLHELPCEELVSNKVL
FT                   GRLFSHNLKEAGIINIAPPRDTHLGMSLGSVSVVVPTISPFVSVVKDNSIEPYSKAFAE
FT                   LSVSTEVEENLFKTIQALAFTGYDLLAREDLIAEAKKELHDYMKNNDVTY"
FT   gene            171009..171212
FT                   /locus_tag="Clocel_0097"
FT   CDS_pept        171009..171212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0097"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: ckr:CKR_3358
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49886"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL5"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ADL49886.1"
FT                   /translation="MKCIVCGKSIQEGIIVNSRFICLKCEERMVNSNIDTDFYNYFIDV
FT                   LKKSRINKLDTKGESINCQNRL"
FT   gene            171194..172636
FT                   /locus_tag="Clocel_0098"
FT   CDS_pept        171194..172636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0098"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG: cac:CAC0297
FT                   lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49887"
FT                   /db_xref="GOA:D9SNL6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL6"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADL49887.1"
FT                   /translation="MSKSPIVEEVLSYYEEDNILFCMPGHKKGFGFTRDSLGEKLFNCF
FT                   IQSDITEVEPLDNYHNPQGIIKEAENLLTKFYGSYKSKFLVNGSTSGNLAMIFSAFEEN
FT                   DKVIVERNCHRSVLNAIILRKLNPIYIENSFIESLGTPLSINEEDFFHVLNNNPDAKGI
FT                   ILTYPNYYGVCCDLKKIIKICHERNMVVLVDSAHGAHFGIHEDIPQSAVKLGADVVVTS
FT                   AHKTLPALTQGSYIHINNKMLEDKCSFYISAFTTTSPSYLIMCSLDYSRYYLEAYGNED
FT                   YGMLLGLCREYREKISEIPKFSILERKHISGKAYDIDETRFVITLDNGYSGHKLLEYLR
FT                   TNKIQGEMSDDRSVVLLFSTFTRREEFESLYQVIKACDMLELQDEDSIKHISMPKGQQV
FT                   ICPYEAIELKGEYIDYKKCENKVALKAIVPYPPGVPLVAIGERITKAIIEVIEKALKNK
FT                   QQILGVTDNKVYVADLHRFPQP"
FT   gene            173019..173657
FT                   /locus_tag="Clocel_0099"
FT   CDS_pept        173019..173657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0099"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: aoe:Clos_0060
FT                   dTMP kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49888"
FT                   /db_xref="GOA:D9SNL7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL7"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADL49888.1"
FT                   /translation="MEGNNRNNRGYLITIEGPDGSGKSTQIELLKKYFNDRGYEVVTTR
FT                   EPGGTKISEKIRELILDNDNEEMNGICEALLYAASRAQLVEQVLKPAIYEGKIVLCDRF
FT                   VHSSLVYQGYARELGVNQVLNINEFALNGLKADLTIMIDIPYELGIERKRKQKKLDRLE
FT                   NGGDEFHNKVFNGYQQIVKTMKNVVIIDGTKAVEEIHKDIVKTIAELNI"
FT   gene            173897..174226
FT                   /locus_tag="Clocel_0100"
FT   CDS_pept        173897..174226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0100"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   cbe:Cbei_0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49889"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL8"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADL49889.1"
FT                   /translation="MKLVLAIVQDEDVTDVVEELTDANYRVTKLATTGGFLRSGNTTLL
FT                   IGVEEEMVDEVISIIKEECQQRNAVVSAPSSSGGTSSPFLAIPVEIEVGGANIFVVDVD
FT                   KFVRV"
FT   gene            174387..175325
FT                   /locus_tag="Clocel_0101"
FT   CDS_pept        174387..175325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0101"
FT                   /product="DNA polymerase III delta"
FT                   /note="PFAM: DNA polymerase III delta; KEGG:
FT                   cno:NT01CX_0759 DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49890"
FT                   /db_xref="GOA:D9SNL9"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL9"
FT                   /inference="protein motif:PFAM:PF06144"
FT                   /protein_id="ADL49890.1"
FT                   /translation="MEFSNIIGNEEVKKQFVKNLEAKTFAHAHIIAGEDGSGKSLMAKS
FT                   AAIKILSKSIYQNYADIIEFKTSKASIGVDDIRVLIEETNKKPFEGDKKVIIIYNAEKI
FT                   TVQGQNAFLKTIEEPPKGVFIFLLCENLEKILDTIKSRCQIHRLRRLSYEEMKLFLSKN
FT                   YKNIKAEEMKPLIAFSDGIPGRVEKYFTDDAFRNIRNITMEILISITGKEVYELLKYEE
FT                   QLMKYKNYWQDVLSSFISYVRDALIYKETGDEQYIINIDKIDEIKIITDSFSYNKLNKI
FT                   IDTISYVKDNMQSNVNPSVTFDMMLLKFQEV"
FT   gene            175327..176235
FT                   /locus_tag="Clocel_0102"
FT   CDS_pept        175327..176235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0102"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cac:CAC0301 signal
FT                   peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49891"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM0"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADL49891.1"
FT                   /translation="MIEVVGVRFKKAGKVYYFSPGDLDIKEGDDVIVETARGLEFGNCI
FT                   IGHREVSEEDIISPLKSVVRVATPEDVIKYEENKKAEEEAFGICLEKIDKHELVMKLID
FT                   VEYTFDNNKIIFYFTAEGRVDFRELVKDLATIFRTRIELRQIGVRDEAKMLGGVGPCGR
FT                   PLCCTTFLGDFAPVSIKMAKEQNLSLNPSKISGICGRLMCCLNYEQETYEKTRRIMPTV
FT                   GSIVETAEGRGEIISSSIVKEKVTIKVTPPEGEWYLLEAPIVGLKLISGSYEGTVDEKD
FT                   IKLEVEDAADVKVIKELFKTD"
FT   gene            176247..176450
FT                   /locus_tag="Clocel_0103"
FT   CDS_pept        176247..176450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbi:CLJ_B0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49892"
FT                   /db_xref="GOA:D9SNM1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM1"
FT                   /inference="similar to AA sequence:KEGG:CLJ_B0092"
FT                   /protein_id="ADL49892.1"
FT                   /translation="MKAVLKISNLNTSKDINAVKSAIISNEGIMACQISKSTGDVNIVY
FT                   DQYFTSIDEIIESIENAGYIVI"
FT   gene            176538..176708
FT                   /locus_tag="Clocel_0104"
FT   CDS_pept        176538..176708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49893"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM2"
FT                   /inference="similar to AA sequence:KEGG:CLH_0200"
FT                   /protein_id="ADL49893.1"
FT                   /translation="MAYVINDSCISCGACASECPVSAINQGDAQYEINDSSCIDCGNCA
FT                   NVCPVGAPVQG"
FT   misc_binding    177120..177218
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 69.96"
FT   gene            177326..178015
FT                   /locus_tag="Clocel_0105"
FT   CDS_pept        177326..178015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0105"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="KEGG: cac:CAC2928 hypothetical protein; TIGRFAM:
FT                   proton-coupled thiamine transporter YuaJ; PFAM: thiamine
FT                   transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49894"
FT                   /db_xref="GOA:D9SNM3"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM3"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ADL49894.1"
FT                   /translation="MEMLNVLGFFEISKTLQDIIEDPGKIIENLKLIAKSPVVLITLLG
FT                   IIVLIVLLTKVRKVKFDSKVITYVAVAVALSAILSFIKIYKLPMGGSVTLGSMIPILIL
FT                   AFAYGSEVGFIAGLVLGLVNLVIDPYILHPVQVLFDYILPFMILGIAGYFKNKQLGIVA
FT                   AVVGRFIFHFLSGVIFFAEYAGDMNPYIYSILYNGTYLVPEMIISIVIISVVPIERIFH
FT                   KRKSKYA"
FT   gene            178168..178902
FT                   /locus_tag="Clocel_0106"
FT   CDS_pept        178168..178902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0106"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: cno:NT01CX_0753
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49895"
FT                   /db_xref="GOA:D9SNM4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM4"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADL49895.1"
FT                   /translation="MDFLKADETLDDLQLKDIQVIQKKDAFRFGVDAVLLANFANVKRS
FT                   HRVIDLCTGTGIIPFILAGKTESNSIVGIEIQDEFVEMADRTVEYNKLQERVSFHCRDL
FT                   KDLAFLKTLGLVDVVTVNPPYKLQNSGLINPNDKNAIARHEILCTLEDVIIASKAVLKD
FT                   NGRLYMVHRPDRLADIFCLMRKHNIEPKRVRMVHPSVGKAPNIVLVEGQKFGGAFLKWD
FT                   TPLYVHEEDGSYTREIDEIYGR"
FT   gene            179013..179858
FT                   /locus_tag="Clocel_0107"
FT   CDS_pept        179013..179858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0107"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cbe:Cbei_4886
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49896"
FT                   /db_xref="GOA:D9SNM5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM5"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADL49896.1"
FT                   /translation="MSGKLYIVGTPIGNLRDITIRALDTLKECDMVAAEDTRVTLKLLN
FT                   HFEIKKPLISYHKYNEKDKSADILELVKEGKNIALVSDAGMPGISDPGSILIERAVAED
FT                   VPFEVIPGATAVITALVYSALDTTSFTFRGFFPRENKEREALFADIENYKDTLIFYESP
FT                   YRIVQTLQYIKDRLGNRRIAICREITKLYESIFRGTVEEAYEFFNENSPKGEFVLVLEG
FT                   KTLEEIDREERATWEHMTIEDHIVMEMKQGHSKKEAIKLVAKARGMAKNDVYKYSIDID
FT                   "
FT   gene            180088..181260
FT                   /locus_tag="Clocel_0108"
FT   CDS_pept        180088..181260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0108"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: ctc:CTC00227 putative
FT                   cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49897"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM6"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL49897.1"
FT                   /translation="MNKRIAQLLVAVGLVISITLPSVSTYAVPTEAEVQASQAQVDEAR
FT                   AKVEAAEKKVAEITTEIQKYDQKITDLVIKKQETTENIGNTEADIKKTEEDIKAKQQEV
FT                   DENQKRFEERMKALYKRGGQNIIEILFDSKNLGELIGKIEGAKKIADHDKKLLADLEAQ
FT                   KQELKDKSEDLETKKKELVDLQQQQQQSIDQVNAEKAKQQPLLAQAEAQRAEVQALLNS
FT                   SEGAYAIIKAEYDEMEQKLTQGTGNSSTTGAGVSVEPSRGEILYSGDVGALLREAERLR
FT                   EKGIYYADAGTTEEGFDCSGFVQYVYRQCGYNITRTTYTQIKDGQPVEPNIASLRPGDL
FT                   VFFGDPYAPHHVGMYIGDGMYVHSPETGKKLQNAYLSNNSEFSAARRIIG"
FT   sig_peptide     180088..180171
FT                   /locus_tag="Clocel_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.960 at
FT                   residue 28"
FT   gene            complement(181556..181795)
FT                   /locus_tag="Clocel_0109"
FT   CDS_pept        complement(181556..181795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0109"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: cno:NT01CX_0750 transition state regulatory
FT                   protein AbrB; TIGRFAM: transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49898"
FT                   /db_xref="GOA:D9SNM7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM7"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADL49898.1"
FT                   /translation="MKSTGVVRRVDELGRIVIPIELRRTLDIAEKDALEIYVDGEEIIL
FT                   KKYEPACIFCGDARNVENYKGKNICHNCLEELKK"
FT   gene            182205..183707
FT                   /locus_tag="Clocel_0110"
FT   CDS_pept        182205..183707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0110"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: cno:NT01CX_1514 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49899"
FT                   /db_xref="GOA:D9SNM8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL49899.1"
FT                   /translation="MKIATKLFIITSIFFMLFLTFTIVFQKTFLERMYKDVKRDSVTKT
FT                   VSTFKEEFEGIVEGTEVYFKIKKLEQEGNIKLVVLLSNNQFPIRRIPTAMGWENVRSET
FT                   IIPSSDETGDRREQDIDAIIASPILDEDKLNRLYSGETITFLDKNLKCVVSMECNETRK
FT                   AVIIGYTSLQPINDAIDVMSSVYKYFIILSVFVVFLITVFFVRAVTKPLKKINEGAMKM
FT                   ADLDFSEPFEIDREDEIGSVALSLNILSNNLNNALSSLTAANIKLKEDIEKGKRLEEMR
FT                   KDFIAAASHELKTPITLIKGYAEGIKDDVFEGEELEESLDIIIDESEKMAKLVEGMLEL
FT                   SRLENETIELDKVSFNIQEMIELEIRKFQNELEKKNISINRQYEGHNAFGEKFRINEII
FT                   TNLLSNATRHCDDNGTITVYTNNYDDKVYVSIENTGEKIPEEEQSKIWSKFYKVDKARE
FT                   RKLGGTGLGLAIVNNIIKLHKGSYGVENTETGVRFYFILPLK"
FT   gene            complement(183981..185324)
FT                   /locus_tag="Clocel_0111"
FT   CDS_pept        complement(183981..185324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0111"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="KEGG: cpe:CPE2230 serine protease; PFAM: peptidase
FT                   S1 and S6 chymotrypsin/Hap; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49900"
FT                   /db_xref="GOA:D9SNM9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM9"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADL49900.1"
FT                   /translation="MDNNFNKENELNQNNNTVDSNDINTINGQNNESSYTNNTDNTAPI
FT                   NFTMTSSDSETSNDTSDFTSVLPETSPASTENQFNEPIKKKRTGFTGGKFALGVISVIT
FT                   ISVLSGVLGGVITHKYIGTKPITQTATAPINYSNYAPMNEAVTGGMPVPQIVETVKAGV
FT                   VAVSSKTVNQLGQQGESVGSGFIFSKDGYIMTNYHVIEGASEVTILFNDNSQAKGKVVN
FT                   YDANLDLAVIKVTDNKEMPAVLELGDSSKLVTGQPVVAIGNPLGTEFLGTVTTGIISST
FT                   NRDVNGNSFLQTDAAINAGNSGGPLLNDQGQVIGINTLKMSGSSESSSTASVEGMGFSI
FT                   PINVAKEKIDALIKPALVLGISCKNITSDVAEYYSIPEGVAIMSITEFSAAEKAGLLLN
FT                   DIITEMDGKPVKTVADINTIKNSHVSGDTIKFKVYRDKKYLDINVTLS"
FT   gene            complement(185611..186423)
FT                   /locus_tag="Clocel_0112"
FT   CDS_pept        complement(185611..186423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0112"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: cbb:CLD_3176
FT                   manganese/zinc/iron chelate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49901"
FT                   /db_xref="GOA:D9SNN0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN0"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADL49901.1"
FT                   /translation="MLQYEFMRNALLGALFISILCPTVGIFLVLKRYSMMGDTLAHNSF
FT                   AGIALGLMIGANPLLSAFVVTSVAGLLIEFLRKYLNKYADLIMSIVLTLGIGIGITLIS
FT                   TGKASGNINSYLFGSMLTVTKGELKTMAILGIITAITLIFIFNDLVYITFDEEGAKIAG
FT                   IKVKLINYIFILLVSATIAVSVKIVGILVISSMITLPVATALQFKKGFKATMIIGIFTG
FT                   IIDIMLGLISSYYLDAAPGGLIALTSVIVLLSVIVLRRLLSNISALRN"
FT   gene            complement(186433..187086)
FT                   /locus_tag="Clocel_0113"
FT   CDS_pept        complement(186433..187086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0113"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbf:CLI_1460 manganese/zinc/iron chelate ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49902"
FT                   /db_xref="GOA:D9SNN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49902.1"
FT                   /translation="MIEIKSLSFSYNNKAPYIVNDVSLKINKGEYVSIIGENGCGKSTL
FT                   IKLLLGIVKHSKGSVAINSPKIGYVPQRLDSNSSFPITVNEALQSHLKALKLKDKSLVD
FT                   NILDSLGMKKYKHRLIGSLSGGQQQKIFIARALLGEPEVLILDEPSNNIDVKSQEEIYG
FT                   IIKDLNLTKGVTVVSVEHNLKAARDNSTHIFEMTNNTTKLFDVEKYIAFSDLCE"
FT   gene            187454..188662
FT                   /locus_tag="Clocel_0114"
FT   CDS_pept        187454..188662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0114"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: cno:NT01CX_0749 polyA polymerase family
FT                   protein; PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49903"
FT                   /db_xref="GOA:D9SNN2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN2"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ADL49903.1"
FT                   /translation="MKETIQLLKSYMKNKEDKIYIVGEYVRDKLKDSSKEPKTLDIVVD
FT                   GNEACLIKYLEAHEFKFDKLKDKQRGHKKTKESEELYIWTNKGQNIEEYLQGVDFTVNA
FT                   IALDIKDNKMIDPYNGRRDIKSKLVNEVMQESISKAPIRIITAIKLSLENGMHLGGFTE
FT                   EHIRLYKDKIDESDKDELYEALLSLFSKDLYGNAIEFLDRYEILENIFPYIKEAKTIGK
FT                   CKYHVVNAYTHMEMTYRNFKDLISGRLSLNGIKDVLIDKLVQNFSLYDYIAISAFLHDI
FT                   GKFAAYKKENGQVSFTNHNELGARITEEALKKLGFPKEAIEIITTIIEGHMHPLRIFKA
FT                   GGMSQKKAIEDFFNKYKEIAPMIIAVSFCDVYATLSLKDDDNQEDAFKIFMENLIQEYR
FT                   TFI"
FT   gene            189192..189659
FT                   /locus_tag="Clocel_0115"
FT   CDS_pept        189192..189659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN3"
FT                   /inference="similar to AA sequence:KEGG:Clos_2608"
FT                   /protein_id="ADL49904.1"
FT                   /translation="MRCEYIDKLINACAFVPDYKDNIGKVTKIYLKTGGCFVTRYSMRK
FT                   VIDDFCTINLTDINKLRKLSAELIGGKNLKPIYVRKGVVMIPIKTTKPLVDGDKCFAYV
FT                   NLHCIDDLYMDESIIRLNNGEEICYVESANAVKLRLAEGTILQNKVTLKGV"
FT   gene            189923..190516
FT                   /locus_tag="Clocel_0116"
FT   CDS_pept        189923..190516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0116"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   cno:NT01CX_0747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49905"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN4"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ADL49905.1"
FT                   /translation="MENKESILNDLLSISQNVIDSNIIPFSDLPEYDLFLSQVVDYLND
FT                   RFEGEDFTNNIVQNYVKNEVVSKPQDGKKRGYTKVHLTELVLLGHMRPILTSDEIKKVF
FT                   RLAFNDINDRTDDIIPWESAYKSFTEIQKNAFSDLQEKGLVDEVMIKELIKPFQLNEKE
FT                   TERIVVFLTVMTLIAQASAIKKLARKIIDEYSEE"
FT   gene            190570..190728
FT                   /locus_tag="Clocel_0117"
FT   CDS_pept        190570..190728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49906"
FT                   /db_xref="GOA:D9SNN5"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN5"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0746"
FT                   /protein_id="ADL49906.1"
FT                   /translation="MDNIINLIGNVGFPIAISIYLLVRIEGKLESLTNSINVLSSAINR
FT                   IENNKNC"
FT   gene            191325..192695
FT                   /locus_tag="Clocel_0118"
FT   CDS_pept        191325..192695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0118"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; G5 domain protein;
FT                   Putative peptidoglycan binding domain; KEGG: cpe:CPE1313
FT                   VanW-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49907"
FT                   /db_xref="GOA:D9SNN6"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN6"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ADL49907.1"
FT                   /translation="MGKNKNTFIIKLSILSICVISIAGVFFMKVKSTVERWNDKIYPSV
FT                   YVEDINLGGKTKEEAIKVMEEQYTEPFSQSVIKIKLGDVIKNTQLSNFEPKYNLEDTVA
FT                   KAYEYGKSQKMMDKYSKINKPSMNQYDIDYDFDYDKIDRFISSLASEVNRNPRNATVSS
FT                   VNERVSVNEEENGYRVDTKKLKEDLLDSLKNIKSEEVFIEAKVDVIKPTITKENLKIID
FT                   TKISSFSSNYSINAEGRATNIEIATESLNGQVVMPGDEFSFNKIIGETTAEKGYKPATV
FT                   IVENELKEEIGGGICQVSTTLYNSIIQLNIKSTERRNHTLTVAYVPVGTDAAVSYGYMD
FT                   YRFKNTLKYPLYIEGIANEGILTFNIYSNSKAVQTDTSYRLRSEVIETMQPKVETVEDE
FT                   KLEVGEKKELQAGLTGYKSVTYLEKVVNGAVVSKEVISKDIYSPTVTKIAIGKQKVH"
FT   gene            192762..193505
FT                   /locus_tag="Clocel_0119"
FT   CDS_pept        192762..193505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0119"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: cno:NT01CX_0777 peptidil-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49908"
FT                   /db_xref="GOA:D9SNN7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN7"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADL49908.1"
FT                   /translation="MDNKVLAVVKNKEITEQNINELIVRMPDQQRMYYDTEQGRARLLE
FT                   ELVSVEVFYNYALELKLDESPAFLEQLEGAKRQMLFPIAADEVTKDVEIADQDVADFYK
FT                   NNRELFKKPELATASHILVDSEEKAQEIKAEIEAGLSFADAAAKYSTCPSNQRGGDLGQ
FT                   FQKGQMVPEFEEVAFTLPINKLSDPVKTQFGYHLIKVTDFQPEMIQDFDEVQVAIKEKM
FT                   LQDRRQYKFLEKVDELKKLYNVEYK"
FT   gene            complement(193679..194119)
FT                   /locus_tag="Clocel_0120"
FT   CDS_pept        complement(193679..194119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:415947 RNA binding motif protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN8"
FT                   /inference="similar to AA sequence:KEGG:415947"
FT                   /protein_id="ADL49909.1"
FT                   /translation="MGYKKDVDKDCFDYTIEDYDYDEMNDSDYTIKGKKDSRDKDCGCY
FT                   EYKKDKDYEDKDYDCYEYKKSKDYKKDKDYEDYEDNKEYGKYEEYEKCHEKPKKDKCKG
FT                   ETCCYGPYYEPYYVVKKCYRKYYIVKHCTWHRVPCCPKPRCK"
FT   gene            194613..196115
FT                   /locus_tag="Clocel_R0035"
FT   rRNA            194613..196115
FT                   /locus_tag="Clocel_R0035"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            196516..199417
FT                   /locus_tag="Clocel_R0036"
FT   rRNA            196516..199417
FT                   /locus_tag="Clocel_R0036"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            199544..199660
FT                   /locus_tag="Clocel_R0037"
FT   rRNA            199544..199660
FT                   /locus_tag="Clocel_R0037"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.83"
FT   gene            199719..199844
FT                   /locus_tag="Clocel_0121"
FT   CDS_pept        199719..199844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49910"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49910.1"
FT                   /translation="MNIFLDIVRSQGNKFKRIALVISVHMYNNDKEFYNDNEETP"
FT   gene            200647..201429
FT                   /locus_tag="Clocel_0122"
FT   CDS_pept        200647..201429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0122"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   cbt:CLH_3304 chemotaxis protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49911"
FT                   /db_xref="GOA:D9SNP0"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP0"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADL49911.1"
FT                   /translation="MDIFTIVSLIFAFGSLIVGFLLEEGQLSALVQVSAFIIIFGGTFG
FT                   AVAVSFPGRIFKKFPKVLAIAFKKRDSKIGENIRYFKEISIRTRREGLLILEGEVTNDG
FT                   IDPFIKKGFQLAADGTEQSVIQGILETELEQMADRHDEGIEMFSAAGGYSPTMGIIGTV
FT                   MGLLQVVANLDDPLALGVKIAAAFMATLYGIAMANLFWLPIANKLKMLNKEEINEKQMI
FT                   IEAVLLIQQGSNTNSLVSKLEGYMLDDDKKSLLEDKQV"
FT   gene            201434..202204
FT                   /locus_tag="Clocel_0123"
FT   CDS_pept        201434..202204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0123"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: cbk:CLL_A3509
FT                   chemotaxis MotB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49912"
FT                   /db_xref="GOA:D9SNP1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP1"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADL49912.1"
FT                   /translation="MKKREKKQDNHERWLLTYSDLITLLMALFVILYATSRVDPMKFNQ
FT                   LAYSLQVALGTSPSGGAGVLDGGQGLDMATLSQAVKDAASKSAELDYEKLEAEKLTKVK
FT                   EQVDKLIAESELNGSATTAIEERGLVITVKDNLFFDSGKATVKEQYKRQLNALSKILSS
FT                   IDNYVRVEGHTDNVPIKTPYFNSNWQLSSIRASNVVEIFATECGLNPNRLLPVGYGEYR
FT                   PIATNATEEGRAANRRVDIVILNSKFNDSEVKQR"
FT   gene            complement(202676..203320)
FT                   /locus_tag="Clocel_0124"
FT   CDS_pept        complement(202676..203320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0124"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="KEGG: cno:NT01CX_2305 hemolysin III; TIGRFAM:
FT                   channel protein, hemolysin III family; PFAM: Hly-III family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49913"
FT                   /db_xref="GOA:D9SNP2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP2"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADL49913.1"
FT                   /translation="MKHFREPVSGFTHLGGAIVSLIGMLILITKTLSNSSSSSLALIGV
FT                   ILFGVSLILLYSASSIYHLAVARDTIIFYLRKLDHSMIYVLIAGTYSPVCLTVLQGKLR
FT                   WIIFATIWGLALIGVLMKLFYFKGPRWISTLSYIGMGWLAVFLIPKLLGAISVWAVTLL
FT                   IAGGVLYTVGAVFYQLEKGNTRRTFGAHEVFHIFVLLGSLSHYLMVFIYLI"
FT   gene            203567..204139
FT                   /locus_tag="Clocel_0125"
FT   CDS_pept        203567..204139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0125"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   cbt:CLH_0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49914"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP3"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ADL49914.1"
FT                   /translation="MEFDKEQIISLVNELNLKENIDPKDIPALDLYMDQVITLFENGLV
FT                   SSKRNDEEKILTKTMINNYSKANLFMPVKNKKYSREHIILMILIYKLKQSLSITDIKQV
FT                   LEDIVKDQQGDKSLDLIEIYSALIDINNIEVDEQETVLARILDKIEETTANNSEYEKRL
FT                   ITVLALINFANIQKRIVEKLIDTYFKK"
FT   gene            complement(204870..205337)
FT                   /locus_tag="Clocel_0126"
FT   CDS_pept        complement(204870..205337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0126"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: cpf:CPF_2616 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49915"
FT                   /db_xref="GOA:D9SNP4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADL49915.1"
FT                   /translation="MRIGMGYDVHKLVGGRDLIIGGVTIPYAKGLLGHSDADVLLHAIM
FT                   DSLLGAAALGDIGKHFPDTDAKYKGISSIKLLEEVGKLLKDNNFSIGNIDATIVAQAPK
FT                   MAPHITEMRKNISEALDISIDNINVKATTEEGLGFTGLGQGISSQSICLLV"
FT   gene            complement(205794..205976)
FT                   /locus_tag="Clocel_0127"
FT   CDS_pept        complement(205794..205976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dap:Dacet_0900 heat shock protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49916"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP5"
FT                   /inference="similar to AA sequence:KEGG:Dacet_0900"
FT                   /protein_id="ADL49916.1"
FT                   /translation="MKNNVIYVDFSKPSRTTSKKKSPKASKVKFISKIKTFISNKIKKI
FT                   RVSSKHKNSPNVRIK"
FT   gene            206087..206692
FT                   /locus_tag="Clocel_0128"
FT   CDS_pept        206087..206692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0128"
FT                   /product="sortase family protein"
FT                   /note="KEGG: cac:CAC0204 sortase; TIGRFAM: sortase family
FT                   protein; PFAM: peptidase C60 sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49917"
FT                   /db_xref="GOA:D9SNP6"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP6"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADL49917.1"
FT                   /translation="MEKKNKKNIWFIVGIILAVVGVIIILSAIYMNFKGKLENDKMISN
FT                   FEKKLEQVKDNNEKVEIKEQQDVIEEGTIGIMQIPKIGLKVAVGEGTDMETLKYAVGHF
FT                   KDTALPGELGNFAVAGHRSYTYNEFFNRLDEVTTGDKILVKTLKGTFTYEVTGTEVVEP
FT                   TQVEVLNKTDNATVTLVTCTPIRTATHRLIIKGVLVNN"
FT   gene            complement(207153..207746)
FT                   /locus_tag="Clocel_0129"
FT   CDS_pept        complement(207153..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49918"
FT                   /db_xref="GOA:D9SNP7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP7"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0725"
FT                   /protein_id="ADL49918.1"
FT                   /translation="MLVSGLVLKIRRKYVIALDSNGYVIKIKIGSLTPLIGEIYHGTFL
FT                   ETKPSGYYFRKYKTPVLIITFIITISLIICSYLYYTPTTTVYIEASAQVTLSINRYNKV
FT                   VKAIALNSEGDKLLTSVRVKGTTLDESLNILYDGAIKNRIIDQYFAEAKQIYRVNIDSE
FT                   ANIDITSFLNTIKSSPYIIHINNKGNVIYNSQYK"
FT   gene            complement(207736..208410)
FT                   /locus_tag="Clocel_0130"
FT   CDS_pept        complement(207736..208410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2521 putative RNA polymerase sigma
FT                   factor SigI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP8"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2521"
FT                   /protein_id="ADL49919.1"
FT                   /translation="MDDTPITVPNTKIEKLKDSKFFLQKLLGEIFNHEINWNKDPAVDI
FT                   ALIAMNHCFGSFDQEMGAFTMYSRTHVKNTVISYLIGLNNNFEFIEENSPLKATLDTLT
FT                   FEETEKYRELISAEIALFQEELKNYKISFAAFSSGAPQNTEDKNLSLNLAFYCIRNTSA
FT                   QNHIQSKHSLPINHLAKNFHIPASKIRSLKKYILALFLLFSIDDYFYLRAYLDIRIVKN
FT                   VS"
FT   gene            complement(208501..209106)
FT                   /locus_tag="Clocel_0131"
FT   CDS_pept        complement(208501..209106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49920"
FT                   /db_xref="GOA:D9SNP9"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP9"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0646"
FT                   /protein_id="ADL49920.1"
FT                   /translation="MINEKKLSNSTRKLGTRQLTTVGMLSAICIILGITGYGFIPVGPV
FT                   KATIMHIPVIIGAIIEGPIVGALIGLMFGLFSLINNLVNPTAASFVFWNPIVSVLPRVL
FT                   IGIVSYYVYVGAIKLFKNNKISAGVGAFFGSLTNTALVLSLMYFLYADRLFEIYKVSSV
FT                   KQVGSALIAVASTNGIIEAIISVLITIPIVLAIKLVKK"
FT   gene            209413..209988
FT                   /locus_tag="Clocel_0132"
FT   CDS_pept        209413..209988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0132"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   cno:NT01CX_0711 spore maturation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49921"
FT                   /db_xref="GOA:D9SNQ0"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ0"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADL49921.1"
FT                   /translation="MINYIWFGLIAIGIFLGIAKGDGEALSKAIIGSTENTVALIIGLT
FT                   GIMCLWCGVMRIAEKSGLTNKISKALLPVLRIIFKDASKSENAMGAMVMNITSNMMGLS
FT                   NAATPFGIKAIVELDKINPKKGVATNDMALFLVLNSACVQFVPTTIISLRAAEGSKNPA
FT                   LIIIPAFIASLSAAILGIVYCKILQRYF"
FT   gene            209991..210509
FT                   /locus_tag="Clocel_0133"
FT   CDS_pept        209991..210509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0133"
FT                   /product="spore maturation protein B"
FT                   /note="SpmB; KEGG: cac:CAC0470 spore maturation protein B
FT                   (gene SpmB)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49922"
FT                   /db_xref="GOA:D9SNQ1"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ1"
FT                   /inference="similar to AA sequence:KEGG:CAC0470"
FT                   /protein_id="ADL49922.1"
FT                   /translation="MSYIFASIIPILICGIVIYGIVHKVKVYEVFVEGAKDGLSISVKI
FT                   FPYLLAMLLSISIFRSSGAMDYLITFISPIVGLIGLPAEIVPLILIKPLSGSGALGVFA
FT                   EILKNYGPDTFIGLVASIIMGGTETIFYTITVYYGAINIKKIRHTLWAAVMADITAIIV
FT                   ALVIARFIY"
FT   gene            210563..210841
FT                   /locus_tag="Clocel_0134"
FT   CDS_pept        210563..210841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acl:ACL_0824 histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ2"
FT                   /inference="similar to AA sequence:KEGG:ACL_0824"
FT                   /protein_id="ADL49923.1"
FT                   /translation="MRAKEGEFIKITDINGNIEYGKFYYNEDRTEIEVIILKSDDIYRK
FT                   DLPKQTNLKLNELGDAVDKDGFRLLIEELDNRLLKEELRQLYNMFAG"
FT   gene            complement(211012..211407)
FT                   /locus_tag="Clocel_0135"
FT   CDS_pept        complement(211012..211407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmh:P9215_08391 insulinase family protein
FT                   (peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49924"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ3"
FT                   /inference="similar to AA sequence:KEGG:P9215_08391"
FT                   /protein_id="ADL49924.1"
FT                   /translation="MKKFLFLFVTFILIFAAPLTTYGDTRIMDESWSNETYYNSGDTEE
FT                   IIDGGDRVILGVKLTEVSSKETVTVKAYRSGDRQGFPIYTFKIKNPTKGITYSSGYFDI
FT                   PGNDERFLVIIIESSKKCSGTVRAYKE"
FT   sig_peptide     complement(211336..211407)
FT                   /locus_tag="Clocel_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.785 at
FT                   residue 24"
FT   gene            211734..211937
FT                   /locus_tag="Clocel_0136"
FT   CDS_pept        211734..211937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0136"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nth:Nther_0740 transcriptional regulator;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49925"
FT                   /db_xref="GOA:D9SNQ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL49925.1"
FT                   /translation="MRVNKIKTARVEKGITQEELADMIKVTRQTISLIESGKYNPTLKL
FT                   CISICLALGKTLNDLFWEEEIK"
FT   gene            211934..212383
FT                   /locus_tag="Clocel_0137"
FT   CDS_pept        211934..212383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_2065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49926"
FT                   /db_xref="GOA:D9SNQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ5"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_2065"
FT                   /protein_id="ADL49926.1"
FT                   /translation="MKLFKSKYDDERINSLIYKASFNTVVLLQIALLGDFIVRTLILNH
FT                   PLRESISSLIIFIIGAIYMCTCIIINGAYGTMVSENKFNLKRKRVYIYLIGSAFVAIMI
FT                   NITDGDDFYSKKGLLKFGFDFVAFFILTYFSSSALNKLLTNKKGR"
FT   gene            212517..212729
FT                   /locus_tag="Clocel_0138"
FT   CDS_pept        212517..212729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_0702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49927"
FT                   /db_xref="GOA:D9SNQ6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ6"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_0702"
FT                   /protein_id="ADL49927.1"
FT                   /translation="MKAKSNLFGSMIIWFFIGFLTEVFQRVFKIGQAVDIYGNNFMSTS
FT                   IFRGIFTAVVIGIPYYFILRKRNKN"
FT   gene            212785..213543
FT                   /locus_tag="Clocel_0139"
FT   CDS_pept        212785..213543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0139"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   KEGG: HAD-superfamily subfamily IIA hydrolase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49928"
FT                   /db_xref="GOA:D9SNQ7"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ADL49928.1"
FT                   /translation="MKTKAIFFDLDGTLYFKGEAIEGAIETVNQLRDKGYICRFLTNTD
FT                   GSTPKTILDRLRNMGFNIQLEEIYTPITASIKFLERIEGARIYPLMLDEVVDEYKNFNI
FT                   GTEAVDYLVIGDCRDKISYDHLNTVFRMIGENTEIFVTQKGRYFYNADGKNIDTGAFAA
FT                   MFEYATGKVAKVLGKPSKDFFNILLEDLNLEAGQVLIIGDDITTDIVGANTIGAKGALV
FT                   KTGKYNDQRNLKVAEPDMILDSVVDLQKLL"
FT   gene            213959..215893
FT                   /locus_tag="Clocel_0140"
FT   CDS_pept        213959..215893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0140"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; KEGG: ter:Tery_1893
FT                   peptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49929"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ8"
FT                   /inference="protein motif:PFAM:PF04151"
FT                   /protein_id="ADL49929.1"
FT                   /translation="MMKKVLSLIICLLIFTSTNFSKVVYSAELYEIESNNDFSTANIVA
FT                   LGDITQGQILAANDYDFFKLQISYPQETNILLSNIPSGCDFDLYIYDSNGSSMASSTKG
FT                   SNADDSVTQTLNVGTYYIKVLRYSGSSSSFYKLSTLPIGTTPTIPSPDGNIYESEANND
FT                   FSNSNSIIFGSTIKGQILTSTDYDCFKLQLLYPRDTNILLNNIPSGCDFDLSLYDSNGF
FT                   KVDSSINRSNVDESITKTLAAGTYYIRIASATGNSDIYYNLSTSQTPPLAPSADGFVYE
FT                   NEANDDFSAANAIPFGSTVKGNIAASSNVDYFKLQLSSTENIKILLSNISTGCDYDLVL
FT                   FDFNNNYIASSKKGSNVDESITHSLAAGIYYIKISSYSGSSNNYYSLSTTLAGNAPMAP
FT                   YPDGGLYEREPNDSSSTAYPIEVGNSIKGQITSTSDNDLFKFQTYSTESLKIGLSDVPD
FT                   DCNFDLYLYDSNMNRIDSSTNGFGTVESIYKSLPAGTYYIKIISTLRSSTEYYNLSITD
FT                   VIPPTSTFHGGDIYEFDDSFSLATDMGEGSFTISEPNLNVSNDMDYFKFNLIQRSDVRV
FT                   VLTNPNYSSAKYRFDLYNSSYGNISYAYNVSEYTITLEPGTYYIKVHDNTAAPYTGLNY
FT                   QLQMTATGL"
FT   gene            216472..218280
FT                   /locus_tag="Clocel_0141"
FT   CDS_pept        216472..218280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0141"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: cac:CAC2943
FT                   integrin-like repeat-containing cell wall-associated
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49930"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ9"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL49930.1"
FT                   /translation="MKKLRGLICLTTTLGVVSGFLPLITAQDVQAAQTVTTTTPYISTK
FT                   QLSNSKVDVTGDGKADYVTVWNNGGKRNIATYVANGNGTFKELVNTVSSGSFTADVVGR
FT                   DTGIFADVTGDGKADYIVPWNNNGKRSFATYVAKSDGTFNEYVNSSSEGSFITDTMGID
FT                   IGVFADVTGDGKADYIVTWNNNGKRTLTTYVAKGDGTFSTFVNTSSSGSFTADTVGRDT
FT                   GIFTDVNGDGKTDYVVTWNNNGKRSFTTYLAKGDGTFSEFVNTASGGTFMLDTLGRDTG
FT                   IFADVTGDGKADYIVPWNNNGKRSFATYVGKADGTFNELVSSSSVGTFKADSIGRDTGT
FT                   FTDVTGDGKVDYIVSWNNGGKRSFATYVGKADGTFNELVSSSSAGTFTADSMGKDVGIF
FT                   ADVTGDGKADYVVPWNNNGKRSFATYVANANGTFNELVTTSSNGTFLADKIGRDLGGLV
FT                   GDRDYSINDTSMFVVKTVTIVKTDAEILIDYAKQFLGLPYKTNGTTPDGFDCSGFVQYV
FT                   YKNALNIDVSRTTYTQVGKGYDVGTDIAKLQLGDLVFFGDYEAPHHVGIYVGNGKCIHS
FT                   PTEGQSIKYTNLSDFGDFSRARRIIG"
FT   sig_peptide     216472..216567
FT                   /locus_tag="Clocel_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.668) with cleavage site probability 0.453 at
FT                   residue 32"
FT   gene            218435..220438
FT                   /locus_tag="Clocel_0142"
FT   CDS_pept        218435..220438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_27322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49931"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR0"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_27322"
FT                   /protein_id="ADL49931.1"
FT                   /translation="MKNLRIVSYLTTALVLGGAIFPAVTAKNVQAATKTISYISTKPLS
FT                   ASKADVTGDGKADYVAVWNNSGKRNIATYVAKGDGTFNELINTVSSGNFTSDAVGRDTG
FT                   IFADVTGDGKADYIVSWNNNGKRTLATYVAKGDGTFNEYVNTFSAGTFTADTMESDTGT
FT                   FTDVNGDRKADYVVTWNNSGKRSFTTYLAKGDGTFNEFINTASSGSFTADTVGRDTGIF
FT                   TDVTGDGKTDYVVTWNNNGKRSFTTYVAKGDGTFNEFVNTSSGGTFMLDTLGRDTGIFA
FT                   DVTGDGKADYIVPWNNNGKRSFATYVGKADGTFNELVSSSSTGTFTADSIGRDTGTFTD
FT                   VTGDGKVDYVVSWNNSGKRSFATYVGKADGTFNELVSSSSAGTFTADSMGKDVGIFTDV
FT                   TGDGRADYVVPWNNNGKRSFATYVGKADGKFNELVTTSSNGTFLADKVGRDLGVLAGDR
FT                   DSSINDTRVFVEQITLADTISPNSGTGFLYKYEAELISKINFINYNKFGTELDTIKSIY
FT                   INNKSTYDNIASKTNIPSALICALHYRESGCNFGTYLHNGQPLGQITTKVPVGLYFTDF
FT                   ASAAIDALTRKSDIRDDYGLKSSSVDMAAMAGFAEQYNGTGYHDYHSMPSPYVFNGTNV
FT                   YTSGKYTSDGNFNQYVIDVQPGVYIILKKLMG"
FT   sig_peptide     218435..218530
FT                   /locus_tag="Clocel_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.484 at
FT                   residue 32"
FT   gene            220739..222970
FT                   /locus_tag="Clocel_0143"
FT   CDS_pept        220739..222970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0143"
FT                   /product="ABC-type bacteriocin transporter"
FT                   /note="TIGRFAM: ABC-type bacteriocin transporter; PFAM:
FT                   peptidase C39 bacteriocin processing; ABC transporter
FT                   transmembrane region; ABC transporter related; KEGG:
FT                   cac:CA_P0073 ABC ATPase containing transporter; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49932"
FT                   /db_xref="GOA:D9SNR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR1"
FT                   /inference="protein motif:TFAM:TIGR01193"
FT                   /protein_id="ADL49932.1"
FT                   /translation="MSDLLKKYHCVKQHDIKDCGAACIATIAKQYGLKIPISKIRELAG
FT                   TDMKGTSAFGVIKAAEALGFTAKGVKASKPEDIFSEFPKPAIAHVIIDESLLHYVVIHS
FT                   VTKKEILVADPAEGIVKYTPEKFFKIWTGVLIFMTPAVAFKTGDETKGLFQRFWGLIKV
FT                   QKNLLTNIFISSMLITLLGIAGSFYFKFLIDDILPNNLGNSLLVISVAMIGLIIFRIIT
FT                   EFFRSLLLMHMSQNIDIPLLLGYYNHVIDLPMNFFGTRQVGEIISRFNDAGKIRDAISQ
FT                   TTLTIMIDTVMAIAGGIILYMQSPKLFWSCFIPIALYMVLVFAFKSSLEKVNRKVMEDN
FT                   AELTSYLVEGIEGIETVKAYNGERKVNLETEKRFIKLIKSVFKHGYVNNLQATLKNTVK
FT                   GIFGIVVLWIGARLAMKGEITVGALISFNALLAYFIEPIERMIDLQPELQSAMVAADRL
FT                   GEILDLEKERAQNENKKITPTTLLGDIVLKDVDFRYGTRQLVLKNINMHIKKGEKVALV
FT                   GESGSGKTTIAKLLMNFYGIEKGELTINDYNIKDISLDVLRDKVSYISQDSFFFSGTIM
FT                   ENMEFANCDATFEEIIEACKMTQIHDFINDMPTRYETLLEEKGSNLSGGQRQRLAIARA
FT                   LLKKPEILIMDEATSNLDSITEKAIEKTIEECTKNVTTVIIAHRLSTIMKCDKIYVMEK
FT                   GEVIEEGTHKELLSKKGYYYRLWSGQTSDAEAEVASAVDPLSGGDSHEI"
FT   gene            222960..224420
FT                   /locus_tag="Clocel_0144"
FT   CDS_pept        222960..224420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0144"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   cbf:CLI_A0023 putative bacteriocin ABC transporter,
FT                   bacteriocin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49933"
FT                   /db_xref="GOA:D9SNR2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR2"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADL49933.1"
FT                   /translation="MRYKIEYLDELTDSREILQAKPRGFSRYMMYIIIALLAAILTWSC
FT                   FAKKQITVKSQGIVRPQEEIFKVASGTTGIITSMNLKEGMEVKKGDVLVSVNGEEISLE
FT                   KNALEKSLKDKNAELSANNKLKSSVLDGVNHLNAADPVEGEYSKKYDLYAKNLESGNTE
FT                   ANSVEVQKNSLQETINDLNTLLKSVEEEHNYFDQAHYMYYQYEDYEISLKAYREQIQKD
FT                   QNNINTYQGTLNTLISKGTLDEAQQAKKESLEANIQTLKDRIDATNLEITKLKNSQRLT
FT                   IRNRISEAQSKLKETTAISSSNSYKEQYISNLDSTIASLETAISELKLNLDLASAKVAA
FT                   TTIKAEYDGVINLSNAFKVGDVVQPGTELAKIIPKDNSEFVVDTYIENVSFGEISEGKD
FT                   VIIEFMALPQSEYGVVKSKLTNISTDAKVNEQQGSYYTATCSIPTTFMTKKDGTKVDIR
FT                   NGMLVQVRIINREVTYMRYFLESLSILN"
FT   gene            224766..225701
FT                   /locus_tag="Clocel_0145"
FT   CDS_pept        224766..225701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0145"
FT                   /product="Proteinase inhibitor I42, chagasin"
FT                   /note="PFAM: Proteinase inhibitor I42, chagasin; Dockerin
FT                   type 1; KEGG: cbt:CLH_1555 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49934"
FT                   /db_xref="GOA:D9SNR3"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR3"
FT                   /inference="protein motif:PFAM:PF09394"
FT                   /protein_id="ADL49934.1"
FT                   /translation="MLRKKKKFISKVLLVSMCASIVPATVALAEENTATQENVSNGLTP
FT                   TPTTSQLRGTASISLKSNATTGYSWTYSIVQGDSIVQTLKGYRSDDTSGTIDGSGGTDF
FT                   WQFKSVKEGSTTLRFQYSRSGENTVAETREFIVTVDNTMNITVKETGKTAQIKLESNPS
FT                   TGYQWSYIGMQKSVLVEDSKIYVTAAEQEGKIGSGGTDIWIFRGLQEGPVILEFKYRYP
FT                   WTGPAIKTKFFKLTVDKELNVDVTYLGEPTSQTFNDINGDGKVNLIDFALLKKYLLDNT
FT                   VVINKDLADRNCDGKINAIDAALLKKALLA"
FT   sig_peptide     224766..224855
FT                   /locus_tag="Clocel_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            226291..227244
FT                   /locus_tag="Clocel_0146"
FT   CDS_pept        226291..227244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0146"
FT                   /product="Proteinase inhibitor I42, chagasin"
FT                   /note="PFAM: Proteinase inhibitor I42, chagasin; Dockerin
FT                   type 1; KEGG: cbt:CLH_1555 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49935"
FT                   /db_xref="GOA:D9SNR4"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR4"
FT                   /inference="protein motif:PFAM:PF09394"
FT                   /protein_id="ADL49935.1"
FT                   /translation="MLKKKRTFISKILLASMCVSIVPATVALAEENAVIQENVSNDIEV
FT                   IPMFGEPQATTSLALKSNASTGYSWKYTVVQGDSIVESSKSYMPDDTSGTIDGSGGTDI
FT                   WIFKSLKEGSTTLRFEYSRSWEKDEVETKEFVITVDSKMNTTVKETTKGTAQIQLKANP
FT                   TTGCSWRYSVVQGESIEEASTLYVTDAVPADIDGSGGTDIWVFKGLKEGSTLLKFEYLQ
FT                   SWLENAFYTKYFNLAVDKDLNVTITEVAEPPKDGPSSQINYDINGDSKVSLIDLVLLKK
FT                   YLLDNTVVINKDAADINRDGQINAIDVALLRKVLLT"
FT   sig_peptide     226291..226380
FT                   /locus_tag="Clocel_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            227369..228325
FT                   /locus_tag="Clocel_0147"
FT   CDS_pept        227369..228325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0147"
FT                   /product="Proteinase inhibitor I42, chagasin"
FT                   /note="PFAM: Proteinase inhibitor I42, chagasin; Dockerin
FT                   type 1; KEGG: cbt:CLH_1555 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49936"
FT                   /db_xref="GOA:D9SNR5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR5"
FT                   /inference="protein motif:PFAM:PF09394"
FT                   /protein_id="ADL49936.1"
FT                   /translation="MLKKKRTFISKILLVSMCASIVPATVALAGENAVVKKSKSNEIQI
FT                   IPMPGNVKESTSISLKSNATTGYSWKYTVVQGDSIIQTLKSYRPDDTSGTIDGSGGTDT
FT                   WTFKGSKEGSTTLRFEYSRSWEESPVDTREFIITVDGDMNMTVKETTKGTASIQLRSDT
FT                   TTEACSWRYSVVQGDSIVESSKEFIEYPVWTGIYGSGGRNIWVFKGLKEGSTTLKFEYL
FT                   RPTEGDVAEIRDFNLTVDKDLNVSVTELSDQSKAGPSSQRVADINGDGNVNLIDLALLK
FT                   KYLKDNTIGISKYVGDLNRDGQINSTDVNLLKMALLR"
FT   sig_peptide     227369..227458
FT                   /locus_tag="Clocel_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            228708..231575
FT                   /locus_tag="Clocel_0148"
FT   CDS_pept        228708..231575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0148"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /note="KEGG: mac:MA4292 cell surface protein; PFAM: Ig
FT                   domain protein group 2 domain protein; Dockerin type 1;
FT                   SMART: Ig domain protein group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49937"
FT                   /db_xref="GOA:D9SNR6"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR6"
FT                   /inference="protein motif:PFAM:PF02368"
FT                   /protein_id="ADL49937.1"
FT                   /translation="MLRGNKKFISKVLLVSMCTSLTPTTLTFAVDNVNVQNTGTSVVQT
FT                   TDAPNAASDFLFDSATGKITKYTGPDTTVVIPSEINGVTVKGIGAEAFSYNKDLISVEI
FT                   PDTVTIIGSRAFYNCFGLTSVKLPSNLATIENSTFENCTSLSGIDIPSSVTSIGNSAFW
FT                   SCESLTSVSIPNGVKVIGSSAFEHCQKIKTITIPATVTSIGSGAFWSCKALTSLVIPEG
FT                   VTNIESYTFYDCNSLTSVTLPSSLTSIGTNAFKYCNTLPSIDVPAKVASIAPDSFINCT
FT                   SLKSINVNANNSTFTSVDGVLFNKAKTEILRCPEGVTNATYTIPSSVTSIGIHAFENCA
FT                   NLVTINVPSTITNIGEHAFINCKSLANVRIPYGIKIIDDFTFYGCSSLVNIKVPDTVTV
FT                   IGEEAFSNCTSLASMDLPNSVVTIEAIAFSRCKSLTTFRVPYSVVSIEKFAFQECDKLE
FT                   TIYIPDNVKTFQKWVFINTNKAVFHVESEILKQRVINTGVDESRIVVDVPTGPVSARSV
FT                   TLSNTNLTILKGDSTLIATEILPYVSTNKTLSWKSSNPAVATVDQNGKVAAVGLGTATI
FT                   TCTTTDGSNLSTSASVAVSEDPKLFFNFDATTGTITKYIGTDTSIIIPSAINGVPVTKI
FT                   ANNAFENCTTITDVKIPSGVTSIGSYAFQNCTNLISVEVPSTVTTIGQNAFGMCSSLKN
FT                   INLPSSITSIADYTFAYCSSLTSITIPNTVTAINAYAFYGCSSLSNLIIPDKVTTIGEH
FT                   AFRVCSGLTSLTVPNSVTSIATGAFTGCSNAKFYITSDAVKQLLLNNGVYKIRIVLNGQ
FT                   FLAKEVTSVTLNSTSLVINNGATSKLTATILPGDADSTVTWKSSDPYIATVDSNGVVTI
FT                   KSVGKATITCTAADGSGKFATCEVEGKLVGDVNNDGYASALDLVILKSYLLDNTVSIDK
FT                   ERADLNNDSKINVIDAALLKKILLS"
FT   gene            232015..235080
FT                   /locus_tag="Clocel_0149"
FT   CDS_pept        232015..235080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0149"
FT                   /product="peptidase C1A papain"
FT                   /note="KEGG: mac:MA1513 hypothetical protein; PFAM:
FT                   peptidase C1A papain; SMART: peptidase C1A papain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49938"
FT                   /db_xref="GOA:D9SNR7"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR7"
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /protein_id="ADL49938.1"
FT                   /translation="MKKRKLFRTFLVLSIALPMIMASMASTAKATVNLSGESPKLQAFS
FT                   DSPSIFKGSTTLTVPIPEGRKLEATKNFGIVKPPIKLPNIKSRAYGVAGVYPTSYDLRT
FT                   YGKVTSVKDQSSSGSCWAFASYASLESKLLPGENRDFSENNLKNNSGFDFGPNNGGNSF
FT                   MSTAYMARWSGPINEADDPYNPTSITSPTNKSVQKHIQNVDFLPGKTTYLDNNFIKAAI
FT                   MSSGAVYTTFYYESCGYNATYKTYYDSFPWVDYTGNNHAVAIIGWDDNFDKNKFRDSYN
FT                   GAIPAGNGAYIVKNSWGSSWGQNGYFYVSYYDENFAMEENTVFNGPEATANYKSIYQYD
FT                   TLGFVEALGYNNTTAWMANVFSAPTAENLSAVSFYTVSPDCRYEVYVCSDYTGTTNLAS
FT                   NRILKATGTITSAGYHTIKLTSPVLLTGGKKFAVIVKLVTGGFGYPLAIEDAYPGYSGK
FT                   ATAVAGQSYVSSSGSSWMDLTTYDATANVCLKAFTTAVNKAPTVVSTVPTNLSINFNVT
FT                   NNILVRFSEPILAGTNYANITVKNPAGTVIPIAKAISSDTLTINPISNLANNTKYTVTI
FT                   PLGAVKDSTGLQLASQYTFSFTTVANIAPKVVSTTPANLSTNFAVGNNITVKFSEPILA
FT                   GTSYANVVVKNLAGTVIPVQKSISSDTLIINPTSNLIGNTKYTVTIPAGAVKDSTGLQL
FT                   VNPYAFSFTTGANTAPTVVSTTPANLSTNFAVGNNIVVKFSEALFAGSTYNSITVKNPS
FT                   GVVIPIQKALSANILVINPTINLAGNTKYTVTIPAGAFKDNEGLGFATTYTFSFTTGVN
FT                   TAPTVVSTTPANLATNFAVGNNIVVKFSEPVVVGTTYGSIIVKNPSGVVVAVQKAVSFD
FT                   SLIINPNSNLIGNTKYTVTIPAGAIKDSQGLGLATAYTFSFTTGANTAPTVVSTSPANL
FT                   ATKFPVTNNITVKFSEPLAVGTTYGSITVKNSSGVVIPIQKSISSDTLIINPNSNLAGS
FT                   TKYTVTIPAGAFKDNQGLGLAITYTFSFTTGV"
FT   sig_peptide     232015..232101
FT                   /locus_tag="Clocel_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.403 at
FT                   residue 29"
FT   gene            complement(235504..238236)
FT                   /locus_tag="Clocel_0150"
FT   CDS_pept        complement(235504..238236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0150"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   cbf:CLI_1616 hypothetical protein; SMART: cation
FT                   transporting ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49939"
FT                   /db_xref="GOA:D9SNR8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR8"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADL49939.1"
FT                   /translation="MTSQQNQKFYGLTTAKAKELQKQFGKNELTKKEKDSFFLKLLQVL
FT                   KEPMFLLLIIAAIIYFILGEPRDGAIMLVFVIGIIGIDVFQEWKTDKTLNALKDLSAPH
FT                   ITVLRDDKEQVLNSADLVPGDIMYIKEGVKIPADGFVLKASTLCIDESSLTGEAEGVWK
FT                   ISMDKLQQEKKTILSNESISFASSIDKAQQEKDTIAKLQQRKEAILTSENVNLASTINK
FT                   IEQKEDTINPNSVSSEYAADNKDYWRRDYCYAGTLVTQGTGVILVDKIGPATEYGKIGQ
FT                   SIISAPETPTPLQKQVGKLVKTCAAIAALLFVLVGTVTFFNIPDHKLLDRLIESILSGV
FT                   TLAMAMIPEEFPVILTVFLSMGAWRLAKKHSLVRKLPSVETLGAVSVLCVDKTGTITMN
FT                   QMTVKETWCFTKDKRLLNQTMGLGCKYDAYDPMEKAILSYCQTQGLSKDSLFNGELIKE
FT                   YAFTNESKIMGHVWEKGNEIIIAAKGSPERLLNLCCLSTTERKLAEENVIKLSRKGLRV
FT                   IAIAQRILSIDDTIPNSLKNCNLQLCGMVGFTDPPRENINKSIETCTKAGVRVVMITGD
FT                   NGITASSIAKQINMPNNDKIITGDQLNKFNDEELKERIKTVSIFSRVIPEHKMRIVKAF
FT                   KDSGEIVAMTGDGVNDAAALKYADIGIAMGKRGSEVSREAADLILLDDNFSTIVDTIKD
FT                   GRRIYHNIRKAVGYVFSIHIPIAVSSLLAPFLGITPANLLLLPLHVVLLELVIDPTCSI
FT                   ILERQPAEEDIMDHPPRAPKEKILTTKTFIKSILQGLAIFIASFGTYYTSLNINPDNAP
FT                   VARAMGLTVILVANILLVHVNSSETEFAMKSFVHLIKDKIMWVYSLGIITSLGLILYSP
FT                   LSDFLKLTPLTFNQLLISILIAIVSVMWYEIVKLIKKHL"
FT   gene            238618..238773
FT                   /pseudo
FT                   /locus_tag="Clocel_0151"
FT   gene            239343..240200
FT                   /locus_tag="Clocel_0152"
FT   CDS_pept        239343..240200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0152"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cpy:Cphy_3127
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49940"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR9"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADL49940.1"
FT                   /translation="MDIAVLSDIHGNYIALKRCLEYAFSQNISTFFFLGDYIGELAYPE
FT                   RTMKILYDLNERYKCYFIKGNKEDYWLNYRANGEKGWKDKDSTSGSLLYAYKSLTARDL
FT                   DFFAQLQSVQEITVSGMAPITICHGSPDKINEKMLPDDDRTIQIINGVETSIILCGHSH
FT                   VQRKIVHNEKCILNPGSVGVPLFSEGNTQFLILHGNDGVWLEEFISLEYDVLRVIRDMH
FT                   EAKLYEHAPYWSMITETILRGGNTSHSKVLTRAMELCREETGDCVWPNIPEKCWEQAVN
FT                   ELIL"
FT   gene            240226..240666
FT                   /locus_tag="Clocel_0153"
FT   CDS_pept        240226..240666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0153"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cce:Ccel_1539 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49941"
FT                   /db_xref="GOA:D9SNS0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL49941.1"
FT                   /translation="MELKVTKLSEEYLEECVDLFIDTFSREPWNDQYDSRQQVKDFFIN
FT                   HMKNNYFLGYIGLIDKKVIALSIGMKKPWLYGLEYYIDEFCISYDFQGNGIGSLFLKNI
FT                   EELLTDEKVEGMILNTEREYPSYEFYKKNGFKVLGDLIVLGK"
FT   gene            240833..242020
FT                   /locus_tag="Clocel_0154"
FT   CDS_pept        240833..242020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0154"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cpy:Cphy_0029 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49942"
FT                   /db_xref="GOA:D9SNS1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL49942.1"
FT                   /translation="MDWQKCMNQALDYIENNLACDIDYCAAAKIMNCSEWEFRRIFSFL
FT                   AQIPLSEYIRRRRLVMAAIDIKKGEKIIDVAIRYGYESQAAFSRAFSRFHGIAPSLARD
FT                   EGVDLKAFPRLTFKLILMEGNCMKKNPNHRTNIIGAGEVGYAISVEMDENNIHKTNSSF
FT                   WDTKGNEVIGTTALPKYGAFVSEEKCHLFGDVSGKRLLEIGCGTGHSLKYHGDRNASEL
FT                   WGIDISENQIEKAKEYLSLCGFSAKLICSPMEEDCGIPVDYFDYVYSIYGVGWTTDLES
FT                   TFSRIASYIKKDGVFIFSWSHPIHKCVAIENEMLSFKKSYFDESWYSVSLEGGAISLSD
FT                   RKLSTYINALAKAGFIIDEMIEESDDDIIQLDKDSDFAKKAKMLPVTFVIKARKL"
FT   gene            242074..242577
FT                   /locus_tag="Clocel_0155"
FT   CDS_pept        242074..242577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0155"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   tte:TTE0037 cytosine/adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49943"
FT                   /db_xref="GOA:D9SNS2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS2"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADL49943.1"
FT                   /translation="MNIDDKMRIALEIGKKSLEQGELPVGAVIFKGDEIIGRAYSSGES
FT                   KQQFLRHAEMKVLWEVDEQGYSVRDRKNMQLFVTLEPCMMCLGAAMGAFIGEIYYSVPS
FT                   PIDGAVALAESSLNSNNVEIPSYTLPKCFGGVLQEEGKELLKRYVEIKEEGALVNFCKK
FT                   LISL"
FT   gene            242742..243257
FT                   /locus_tag="Clocel_0156"
FT   CDS_pept        242742..243257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0156"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hor:Hore_00330 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49944"
FT                   /db_xref="GOA:D9SNS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL49944.1"
FT                   /translation="MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI
FT                   MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG
FT                   KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD
FT                   LQMVCDVD"
FT   gene            243395..243805
FT                   /locus_tag="Clocel_0157"
FT   CDS_pept        243395..243805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0157"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function DUF1801; KEGG:
FT                   dae:Dtox_0462 domain of unknown function DUF1801"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49945"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS4"
FT                   /inference="protein motif:PFAM:PF08818"
FT                   /protein_id="ADL49945.1"
FT                   /translation="MWQCPKCGREFDNTNQDHSCGEPSKTIDAYIAAQSEEVRPLLNQV
FT                   RDTLREALPYAEERISWRMPTYWYKQNIIHFAAFKKHIGLYPGEKAIEHFSERFTEYKS
FT                   SKGAVQFPYSKPLPLPLIAEIAKWCFDTGNHH"
FT   gene            complement(243885..244796)
FT                   /locus_tag="Clocel_0158"
FT   CDS_pept        complement(243885..244796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0158"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; KEGG: mmx:MmarC6_1787 TPR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49946"
FT                   /db_xref="GOA:D9SNS5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADL49946.1"
FT                   /translation="MSKSKVRRNVIIIISSIIIAVAAISIPGYMLLRVPLLENKINQAI
FT                   NNAEYEKVIELSDKLYGYGKDPLFALTKKAYAQAKLGKNQEVLDTYNELVKIDQNNSEI
FT                   YNQMGILYNDVFKDYEKALGAFDNAINLNSTDATYYSNKGLSLQWLNRDEEAVAAFKKS
FT                   IEIDPSLAYVYHYLGLSYCTLKNFDEAIPALAKATELNPQNSNAFVSLGNSYLEKNLSN
FT                   EAIAAFDKAIELDKKDADAFVGKGLALFNLEKYQDAIGVFDLALALDDKSKAAYTGKGN
FT                   CLSALFKDAEARECYDKAKAIQ"
FT   gene            245507..246133
FT                   /locus_tag="Clocel_0159"
FT   CDS_pept        245507..246133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49947"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS6"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3043"
FT                   /protein_id="ADL49947.1"
FT                   /translation="MKKLKRIFTLILTTVMTTMLLASCGLGKTKATPEESAKYFLDMVL
FT                   KGDKSNIDKIGFKEEDYTELKTNLEDSLIEGFESAGVSSDILTDEIKNTLKNNMVVGFS
FT                   KVEYEVGASSIDKKVATVEVKIKGFDMNKIADQAKTKTEDNYNESMTEQQFYQENYKFV
FT                   GEGFANGVLVEQPKTLTIKLNKVKQYWIPDESSSKLLMESLVVVP"
FT   sig_peptide     245507..245590
FT                   /locus_tag="Clocel_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.592 at
FT                   residue 28"
FT   gene            246619..246717
FT                   /locus_tag="Clocel_0160"
FT   CDS_pept        246619..246717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49948"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49948.1"
FT                   /translation="MRENTIELELIRLLEELKKLHNQTEKGEYETS"
FT   gene            246911..247384
FT                   /locus_tag="Clocel_0161"
FT   CDS_pept        246911..247384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0161"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   cac:CAC3531 IS605/IS200-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49949"
FT                   /db_xref="GOA:D9SL34"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D9SL34"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADL49949.1"
FT                   /translation="MDNSSLAHSKWNCKYHIVFAPKYRRQIIYGKIKADIGVILRKLCE
FT                   HKGVEIIEANACKDHIHMLVSIPPKLSVSQFMGYLKGKSSLMIFDRHANLKYKYGNRQF
FT                   WCKGYYVDTVGRNKKIIEEYIKNQIQEDLAYEQMSLKEFIDPFTGESVNKGKK"
FT   gene            complement(247522..249456)
FT                   /locus_tag="Clocel_0162"
FT   CDS_pept        complement(247522..249456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyc:PCC7424_1250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49950"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS9"
FT                   /inference="similar to AA sequence:KEGG:PCC7424_1250"
FT                   /protein_id="ADL49950.1"
FT                   /translation="MYYALHGLNNFEDKTIPPGSVHVSNGYGEIILRDVYDFPALAFTL
FT                   DKDKIKGVALNDLGKLAIMYGIITVYNVEIHTVEPFYDYIPNPVLSTIPNPSSSPIPGP
FT                   ILNPVPDPVPSPVEDLVFDEKFYADKYPDLKTRFGYDRVKLFKHWKTSGIKEGRTFSCV
FT                   FDPDYYLKHNSDVAKAVGANNYEGAYQHFITSGYNEGRRSSPIYDGIYYKNCYSDLKTY
FT                   DFYKLIYHFLTYGIHEGRSACLNFEPIVYAIRYPDLFKNFGNLDYKPYFTHYLISGIRE
FT                   GRSGLYDYNFIPNPIENLIFDEKFYADKYPDLKANLGYNKAKLFMHWKTTGIKEGRTSS
FT                   YVFDPDYYLKNNSDVAKAVGANNYKGAYEHFITSGYNEGRKSSPIYHGSYYQNCYSDLK
FT                   THDFYKLIYHFITYGIHESRNACLNFEPIVYAIRYPDLFKALGNSDYKPYFTHYLISGI
FT                   REGRSGLYDYNFIPNPIENLIFDEKFYADKYPDLKAKFGYDRARLFMHWKVSGIKEGRT
FT                   SSYVFDPVYYLKNNSDVSNAVGANNYEGAYQHFITSGYNEGRRSSPIYDGSYYQNYNPE
FT                   LRVYDFYKLIEHFLVHGIHEGRRACSNFGAKVYVARYSDLFKNFGTSDYKPYFTHYLIS
FT                   GIKEGRLSY"
FT   gene            complement(249634..250218)
FT                   /locus_tag="Clocel_0163"
FT   CDS_pept        complement(249634..250218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_1698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49951"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT0"
FT                   /inference="similar to AA sequence:KEGG:Fjoh_1698"
FT                   /protein_id="ADL49951.1"
FT                   /translation="MKIKRIIMPIVLIFTYTISAFSNVIVYANPDVSANPDVSYFENAL
FT                   SELTMSDIVSYLEKNISELEIQKNKVMIEEQRNSIEVEISGYREILTTIKSKNITDEVL
FT                   NKSKDLIFNNDPNNSIENLLKDGQAVAKNTFNKNIVTASGLRTPSMLGDPIYMSVYILL
FT                   VAAIAVGDTQYGYHFAARLLAHAMDNNTKLG"
FT   sig_peptide     complement(250132..250218)
FT                   /locus_tag="Clocel_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.619 at
FT                   residue 29"
FT   gene            250456..250839
FT                   /locus_tag="Clocel_0164"
FT   CDS_pept        250456..250839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_3847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49952"
FT                   /db_xref="InterPro:IPR025059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT1"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_3847"
FT                   /protein_id="ADL49952.1"
FT                   /translation="MTKKYILIISIIVLMFSFSGCEFVVGPGSADYSYKLSGNYELYHA
FT                   GYTSIYKGDYEIVVTAEVKKIAWDDLYILARQEDDDKINYFIIDVNQDKVLGPLSEEDF
FT                   NKKRDELKIDKDLKLKDPSKYRK"
FT   sig_peptide     250456..250530
FT                   /locus_tag="Clocel_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.621 at
FT                   residue 25"
FT   gene            complement(251023..251379)
FT                   /locus_tag="Clocel_0165"
FT   CDS_pept        complement(251023..251379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0165"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: cbf:CLI_3306 putative transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49953"
FT                   /db_xref="GOA:D9SNT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL49953.1"
FT                   /translation="MLKDKIKELRKEMGLTQEEFASKLEISRSYYCDIERGRLKGTNVK
FT                   IISKLSDVTGKPMEYFLDKDVEVKQYDILDSALNMLIEKGLINSDGEITDETSRNIVME
FT                   ILKKEIQLKIKSRE"
FT   gene            251573..251773
FT                   /locus_tag="Clocel_0166"
FT   CDS_pept        251573..251773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0166"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: deh:cbdb_B6 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49954"
FT                   /db_xref="GOA:D9SNT3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL49954.1"
FT                   /translation="MLKELRINKGITCTFVAKKLKISRDRLRRIEEGEVMLPAEFVPVL
FT                   AELYGVTYEELINRRAQEWKK"
FT   gene            251933..252145
FT                   /locus_tag="Clocel_0167"
FT   CDS_pept        251933..252145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmh:Mmah_1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49955"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT4"
FT                   /inference="similar to AA sequence:KEGG:Mmah_1264"
FT                   /protein_id="ADL49955.1"
FT                   /translation="MKVLSISSSNCLLSRSPYGVDVNGKSISELINEKLPEELVNYQKY
FT                   SAKINVSIEIWDEDDLNITTTGYEL"
FT   gene            252556..255114
FT                   /locus_tag="Clocel_0168"
FT   CDS_pept        252556..255114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0168"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="KEGG: cbl:CLK_1342 DNA primase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49956"
FT                   /db_xref="GOA:D9SNT5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT5"
FT                   /inference="similar to AA sequence:KEGG:CLK_1342"
FT                   /protein_id="ADL49956.1"
FT                   /translation="MEIQDIDLRQLIETETGERFSNQGYICCPFHKEKTPSLSVKFFPD
FT                   RNKQRFMCWGCTEQGDALDFIMKYRNLDYKAARKYLGMENKKSENQLQEEIIREYITWQ
FT                   IEKTEHKKGYKLLGLFPFTDENNKVIYYKAKLLRSDGTKETPYYHIEGNKVINKRGAEE
FT                   VPYNLSKVISGINQQKTIIFVEGEKDANTVNSVLRGMNFVATSIKGCKDLSILKNRGPM
FT                   SIYVIGDTGRAGEQYKLHIYDEFISEAREFKFINLPGLKSLGDNKDVTDWIEDGHAKEE
FT                   LLMALERSLDLKNQRDLQQDSKGIYRVYWDKKQEDYIRLYITDFQLLEAKRITFVDDET
FT                   EGITMVFKSCTGGIIERTGLATVFDDIKSFKNFLGTLDLSFRSTDIKDLTELKSWVNKY
FT                   WALENDEIYSGSKFIRKDNQLMLITKDGTITANGVNSRVRADKSGYVDLICKELISKEE
FT                   LNELRGKLFKFATFDKTITIIGTVLNNLAVVQNEEAKEKLHHLLLVGESGSGKSTILSN
FT                   VIAAVLNYPAADIKSIGLITTFALIKDLSDGNYPIIFDEFKPSALDKNKVQKLSEAFRN
FT                   LYDRTTVSRGDKTLKTRGFRFTSPIIVAGEESYPNGEKALVERSAIVYLSKGQRTSEHT
FT                   IAMEWIKSNENILNKFGRSIIDVILNLSVDSYKNIRTMVSEFFPELNNRPLATAVNIAT
FT                   GMEILNLLLVKHGFPKILGYEKYIKQNIGEEILDGDNEAKSTVEQMLVLYNNMIEDGRA
FT                   YDYKNVVIDRADGLFIRTSEMLNQIHMFVNQVGAAEVIPLKLRDFKKQAEKSGYFTKTA
FT                   AKQIKIDRKPVRFDEYNKEKMRQLQMYSIVKPTEIEEYDY"
FT   gene            255724..256431
FT                   /locus_tag="Clocel_0169"
FT   CDS_pept        255724..256431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49957"
FT                   /db_xref="InterPro:IPR007927"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT6"
FT                   /inference="similar to AA sequence:KEGG:CLK_1341"
FT                   /protein_id="ADL49957.1"
FT                   /translation="MRENIMRVNNIEIDNNIKRASKITIERNMDIENSIKMENNIRKDR
FT                   SIKIENDIKKEINIKAQNTNKKDSKINIDNNIDIDDNIKIKNTVKKESKIKRTENRLYA
FT                   YKDIDILNQLTEIKIKKLKDDVSIKAMTYEEKFSTNRFNSNVENEVIRREEFVESKIEE
FT                   LRKEKESRLNEKALIDKVLELLDVEEKRLVGLRYFSKPTRSWTSIAQELNQSVDNCIKV
FT                   RRRVIEKLDGFLF"
FT   gene            256516..256857
FT                   /pseudo
FT                   /locus_tag="Clocel_0170"
FT   gene            257171..258388
FT                   /locus_tag="Clocel_0171"
FT   CDS_pept        257171..258388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0171"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   cac:CAC0537 acetylxylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49958"
FT                   /db_xref="GOA:D9SNT7"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037461"
FT                   /db_xref="InterPro:IPR040794"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT7"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADL49958.1"
FT                   /translation="MKKRGTFLLAISIAMLTITPTVDASAAGSVKVNLFDENRIESINN
FT                   SYPSLNEFNCYNVSDIRSDNLTEKKSTSKTLLIGRFDTSDAAGPKFAWSNTTIKANFVG
FT                   TGISVNLKSTGDNWFNVIVDGVVQTPINVTSTTSSPIALVSGLEKGKHTIELVKRTEAF
FT                   VGDVQFLGFSVSDGKLLNPPKPSSKRILFIGDSITCGYGNEGTDPNKSFTTKNENASLA
FT                   YGALTAKLLGADPMTICWSGKGVLRNYGGDPKDVMPEIYNQVLPYNKNLTWNPKNWVPQ
FT                   VIVINLSTNDYSVGIPDKTTFTAVYSKFIDNIRSEYPKADIYCAIGPMLNGENLDSQRD
FT                   YISGIVKSKEASIHNKVHFIEFPQQDFANGLGEDWHPSVKTHELMAKQLAEKIKTDLGW
FT                   KVYSGN"
FT   sig_peptide     257171..257245
FT                   /locus_tag="Clocel_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.505 at
FT                   residue 25"
FT   gene            258517..258861
FT                   /locus_tag="Clocel_0172"
FT   CDS_pept        258517..258861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0337 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49959"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT8"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0337"
FT                   /protein_id="ADL49959.1"
FT                   /translation="MPMFIPESLLQKEKFTGDKATYTIESLMHDGTLLDLLLDSGLSIY
FT                   AMPPDLTTEEIRKTKMFSRVKAVEIILWLKQNQNIDKWIVFHDIHLHNEDLAIRQVRTN
FT                   AEIGLTEKRC"
FT   gene            259408..260373
FT                   /locus_tag="Clocel_0173"
FT   CDS_pept        259408..260373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0173"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cbf:CLI_0804 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49960"
FT                   /db_xref="GOA:D9SNT9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL49960.1"
FT                   /translation="MYEWQKQIQIIVDEIDKCIKNYNDEALTLRFLSRRLGYSEFYTTR
FT                   KFKEISGMQFRDYLRHRKLAFALKEVRDSEKSLLDIAFDYGFSSHEAFTRAFKGTYGVI
FT                   PSEYRKKPKPVILRTKINSFDRYFLGLGEIGMIKSTDGVKIYFVTIPAHKFLHIKNYES
FT                   NGYWDFWQKQSLIPGQDCETICGLLDSIKGKLDDDGGSESNSSSGQIMAYINDPDGRLC
FT                   DWGIPRTECYGTRLPFDYKGQVPPQMLMIDVPEAEYIVFEHGPFDYEQENRSVEEKIEK
FT                   AMATFDFADTGYCFDTSPGRIIYFYHDPERFWKYIRPVRK"
FT   gene            260721..260981
FT                   /locus_tag="Clocel_0174"
FT   CDS_pept        260721..260981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_3270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49961"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU0"
FT                   /inference="similar to AA sequence:KEGG:Cphy_3270"
FT                   /protein_id="ADL49961.1"
FT                   /translation="MEEFFKTIEEKIRKSGYPGEVSGEEIYTEISDEAEDQEEGSYLFM
FT                   KKQHDDITFEYRVDILEDNINLATLTIHTSERKYFIDFDAE"
FT   gene            261069..262112
FT                   /locus_tag="Clocel_0175"
FT   CDS_pept        261069..262112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0175"
FT                   /product="D-galactose-binding protein"
FT                   /note="KEGG: cbe:Cbei_2494 D-galactose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49962"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU1"
FT                   /inference="similar to AA sequence:KEGG:Cbei_2494"
FT                   /protein_id="ADL49962.1"
FT                   /translation="MKVLRQTIKSILVMLLIFLLIITTEIQTFSSPISRRTINVGVILF
FT                   SLDNSIAAQFKKEFDNLQNEYPVKVSVLNPQNNVSVQDEMLDSLLKNNIDLIIAIPAST
FT                   KEDAVRNFIERVRPYNTPLVMFNIPPDVVKNISKDYARAAFAIPASDKTGEMQGEIVRD
FT                   LWNNKSIIDKNDDNILQYVLVRGPKEDVTADKRTQGVTSILESSGIKTELLQSFATNWT
FT                   EAVAKSYIENIFLTYGNKIEAIIANDDDLAVGAVKGLQKYGYNTGSKSKYIPVFGLSGT
FT                   PEAINLIDKGLMSGTIIVDLKKVAQDLYAIGNNLINNANPTENTNLKSEGGVIIIGTNP
FT                   RKYIIKK"
FT   gene            complement(262518..263027)
FT                   /locus_tag="Clocel_0176"
FT   CDS_pept        complement(262518..263027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0176"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: asu:Asuc_0075
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49963"
FT                   /db_xref="GOA:D9SNU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL49963.1"
FT                   /translation="MIERTNASNIFVCECLQAALLRLLKTKPLENISILELVKIAGVSR
FT                   NSFYRNYNNLEEIIGEYLMKESQKWWDSYSKSEDKNLTKCLFEHFITLKDIISALYQSN
FT                   HSHLMMQHIFQCTISGKSCSAQESYQRAIIAGSTWGLFDEWVKRGMKDSPEEMSRFLES
FT                   GWHERT"
FT   gene            263173..264075
FT                   /locus_tag="Clocel_0177"
FT   CDS_pept        263173..264075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0177"
FT                   /product="alpha/beta superfamily hydrolase"
FT                   /note="KEGG: lac:LBA1350 alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49964"
FT                   /db_xref="GOA:D9SNU3"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU3"
FT                   /inference="similar to AA sequence:KEGG:LBA1350"
FT                   /protein_id="ADL49964.1"
FT                   /translation="MGKIIKRGILVLLILIAAITIWILITLGKVGMGPCKFLLYNKKPV
FT                   LLSEQKFAIAEKEFSCVVNGEKISGTIYIPEDERRSREILIISPGFNSTEAMLASKAKS
FT                   FAISGTPAVVFDFRGGSSSGKSEGDSTNMSISTEMSDLNAVIGYVQGLEWVNKEKIYLL
FT                   GESMGGLVSALTAAEHKDIAGLVLCFPALDKAESTRKTFSNMDKIPDTINMFGLLTGKK
FT                   LWQELYEMDVYEKIKKYTGPVIIMHGTKDPAVDLSYSEKANNVYTNSQLFVVEGAGHGF
FT                   NGDDEKSVLKTIYAFIHKQ"
FT   gene            264100..264297
FT                   /pseudo
FT                   /locus_tag="Clocel_0178"
FT   gene            264483..264569
FT                   /pseudo
FT                   /locus_tag="Clocel_0179"
FT   gene            264735..265067
FT                   /locus_tag="Clocel_0180"
FT   CDS_pept        264735..265067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0180"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="KEGG: dhd:Dhaf_1680 transcriptional regulator,
FT                   PadR-like family; manually curated; PFAM: transcriptional
FT                   regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49965"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU4"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADL49965.1"
FT                   /translation="MSDLENITEMLKGVLEGCVLEIISHEEIYGYEITKRLNALGFSDV
FT                   VDGTVYTILVRLEKNKLVDIEKKPSDMGPPRKFFTLNEAGREELRRFWERWEFVSSKIN
FT                   ELKERK"
FT   gene            265067..265414
FT                   /locus_tag="Clocel_0181"
FT   CDS_pept        265067..265414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0181"
FT                   /product="uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: uncharacterized conserved protein UCP029876;
FT                   KEGG: gym:GYMC10_3365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49966"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU5"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADL49966.1"
FT                   /translation="MSFWGKITGSDITKEMKVFESRAKKLPTDYQVAWEKISANLWSYS
FT                   DFTGRNLMPILDGVLGMLEETAADGESVQEVLGDDIKGFCSALVGEEGAKSFRDKWRKQ
FT                   LNDNIAKKLGK"
FT   gene            265424..265774
FT                   /locus_tag="Clocel_0182"
FT   CDS_pept        265424..265774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0182"
FT                   /product="uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: uncharacterized conserved protein UCP029876;
FT                   KEGG: dhd:Dhaf_1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49967"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU6"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADL49967.1"
FT                   /translation="MGIQDIIEGKKEWRAHMARVKALPKDYQIVYKEIQKYLFKIGLVE
FT                   LTDGIGLLSGIVDFFEEGAALGKGVLEVTGSDVATFCDDLIKDSKTYYDIYQESVDQEV
FT                   NKAMKKVIDKKK"
FT   gene            266093..266533
FT                   /locus_tag="Clocel_0183"
FT   CDS_pept        266093..266533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0183"
FT                   /product="transcription activator effector binding"
FT                   /note="KEGG: cac:CAC3493 transcriptional regulator; PFAM:
FT                   transcription activator effector binding; SMART:
FT                   transcription activator effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49968"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU7"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49968.1"
FT                   /translation="MKYEIVNLQEKIVVGVSAITGNNDPNMGKIIGGLWEKLYQGGINE
FT                   MITNKVNEYAIGLYSNYEDDKYLVTVGNEVCKAESEGLTIKKIPVGKYAKFSIEGHMEK
FT                   AVAEAWNKIWQMDLDRSYEADFEEYLNSDFNNCKVDIYISLK"
FT   gene            266550..267446
FT                   /locus_tag="Clocel_0184"
FT   CDS_pept        266550..267446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0184"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: cac:CAC3492
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49969"
FT                   /db_xref="GOA:D9SNU8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL49969.1"
FT                   /translation="MLEGSYDYMHEVIAKGILSSNNGMNIYRGCTHGCIYCDARSLCYG
FT                   MDHIFEDIEIKANVVQLLEDTLKRKRKKCMIGTGAMSDPYIQLEEKLQNTRRCLEIIDK
FT                   YGFGLAIQTKSNRILRDLDLLKSINSKSKCVVQMTLTTYDEELCKLIEPNVSTTKERFE
FT                   VLKIMRDNKIPTVVWLSPLLPYINDTEENIRGILDYCIEAKVKGIIVFGIGLTLRNGNR
FT                   EYYYKNLDKHFKGLKEKYIKQYGNSYEVISKNHGKLMKIIKETCDKNNIICDIREVFNY
FT                   MRTFEEKNNEVQISFEI"
FT   gene            267569..268498
FT                   /locus_tag="Clocel_0185"
FT   CDS_pept        267569..268498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: str:Sterm_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49970"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU9"
FT                   /inference="similar to AA sequence:KEGG:Sterm_0531"
FT                   /protein_id="ADL49970.1"
FT                   /translation="MKMSKKQFEVIRNWMYRNARPLDIARWKYHFENGNKDDVLAALSA
FT                   YQNPNGGFGYALEADSWNPNSSPIQTWCATEILYELGITDKNNEIVRNILSYLDSGKDF
FT                   QDGHWIAQIPTNDDYPHAEWWSYRENVIDQWGYNPTICLVGFILYFADKQSKLYQLALE
FT                   IAKKATKAFLQDETSEDMHEISCFIRYYQYCEKAGLTDIFDADEMINCLRRKVKSSIGE
FT                   DKEGWKDNYMCKPSQFMITPDSIFYLDNKELSDYEIDFIIETMNSDGTWNITWNWNDYP
FT                   EQWAVSKNWWKATQTLVNMRYLKNFQCL"
FT   gene            268639..269508
FT                   /locus_tag="Clocel_0186"
FT   CDS_pept        268639..269508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0186"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: dhd:Dhaf_2323 transcriptional regulator, AraC
FT                   family; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; transcription
FT                   activator effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49971"
FT                   /db_xref="GOA:D9SNV0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV0"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49971.1"
FT                   /translation="MDWVKQLNESINYIEENLAGEISYEAISKIAGCSIYNFQRMFSYI
FT                   ADKPLSEYIRNRRLTMAAFDLLNSTERIIDISLKYGYESQDSFTRAFKNFHGVLPSSVR
FT                   NETVQLKSCPKRSFQITIKGENHMNYQIEQWPAFRVMGISQKMKTSTAFEMVPKVWENA
FT                   WKDGTMNRFIEKFPDYRPAGFLGIAQGGQWGESEEMEYIIAVTNYVDVPSCEHVPALEG
FT                   MKEFAYPEATWAIFEANGELPEAIQKVYKQFYGEWLPNSGYELADLPVIECYMQDNHQE
FT                   VWIAVIKK"
FT   gene            complement(269876..271067)
FT                   /pseudo
FT                   /locus_tag="Clocel_0187"
FT   gene            complement(271210..271587)
FT                   /locus_tag="Clocel_0188"
FT   CDS_pept        complement(271210..271587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0188"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   cbe:Cbei_2210 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49972"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV1"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADL49972.1"
FT                   /translation="MNNGIDCNVEFHNDNKYETKCPLIYALDIIGQKWKLPIMWYLFEN
FT                   NFTRYNELKRKVNGITNMMLTKSLKELEEHNLIVRIQHETIPPKVEYALTERGKALLPA
FT                   LSELSRWGEEQLKLDKSKSNS"
FT   gene            271740..272393
FT                   /locus_tag="Clocel_0189"
FT   CDS_pept        271740..272393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0189"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   cbe:Cbei_4970 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49973"
FT                   /db_xref="GOA:D9SNV2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV2"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADL49973.1"
FT                   /translation="MKVYAINGSPRKNKNTATLLQKALDGVKEAAKDKEVETEIINLYD
FT                   LNYTGCKSCFACKRIGGTSYGKCAVKDDIHEVLEKISQADGVIFGSPIYFGTITGQLQS
FT                   FLERLLFPYLVYDKNYSTISPKKMPIAFIYTMNVAEDFMDNVGYLSTFNKTESTIGRIF
FT                   TKPSVMYSNNTYQFDDYSKYESSAFSEEEKAAHRKVQFPLDCEKAFEIGKSLIK"
FT   gene            272953..273588
FT                   /locus_tag="Clocel_0190"
FT   CDS_pept        272953..273588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0190"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cbl:CLK_0307
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49974"
FT                   /db_xref="GOA:D9SNV3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL49974.1"
FT                   /translation="MTEFWEKSFIEKQTMWGFNPSESAVIAKDLFIENNIKDILIPGIG
FT                   YGRNAKVFIDNGINVTGIEISKTAIDLAKQHGININIYHGSVGDMPFEDKLYEGIFSYA
FT                   LIHLLNERERKKFISDCYEQLKQGGYMIFTAVSKKAPMFGKGQKLDENYYETMPGVRIF
FT                   FYDSESIKKDFEEYGLVEFSEIDEIDSDNKDKPPMKFLLIKCKRTKSR"
FT   gene            complement(273691..274581)
FT                   /locus_tag="Clocel_0191"
FT   CDS_pept        complement(273691..274581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0191"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: cbe:Cbei_3631 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49975"
FT                   /db_xref="GOA:D9SNV4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADL49975.1"
FT                   /translation="MDIRHFKTFKSIVEEGNFSNAAMKLGYTQSTVTSQIQQLEQELSI
FT                   KLFEKIGRNMVLTDLGKEMIPYANELLNTVKKIEGIGKVGDKITGELKIAVAESLMSYK
FT                   LQNVLSMFKEKAPNVKLSMVSLNCYTIKTMLANGELDLGLMYDVGSKNESLSAVKLSDF
FT                   NVTLVCSPQFEQEKLDFCEPNHKINTSLIINPVESVYRKIIENYFLDKNILLNNTIELG
FT                   SIEAIKKCVASNLGISFLPSFTVEEELSNGTLKELKVGCVDAKITAIYGYHKNKWISPA
FT                   LSLFIELVREDFNII"
FT   gene            274820..275998
FT                   /locus_tag="Clocel_0192"
FT   CDS_pept        274820..275998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0192"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   cbe:Cbei_3630 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49976"
FT                   /db_xref="GOA:D9SNV5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADL49976.1"
FT                   /translation="MRDVVIVSAVRTAIGAYGKTLKDVPAVDLGAIVIKEAVKRANIKP
FT                   EEINEVIFGNVLQAGLGQNPARQAAVKAGLPVEIPAFTINKVCGSGLRSISLAAQIIKA
FT                   GDADTIVVGGMENMSSAPFLLDSARWGQRMGHGELVDEMIKDGLWDAFNDYHMGITAEN
FT                   VAEKWNITREEQDEFSLLSQQKAEAAIKNGEFKDEIVPVVIKTKKGEVIFDQDEFPRFG
FT                   NTIEALKKLKPIFKKDGTVTAGNASGLNDGAAALVIMSADKAKALGIKPLAKITSYGSA
FT                   GLDPAIMGYGAFHATKAALDKVNLKAEDLDLIEANEAYASQSIAITKDLNLDMSKVNVN
FT                   GGAIALGHPIGASGARILVTLLHAMEKRDAKRGLATLCIGGGQGTALIVERE"
FT   gene            276763..278787
FT                   /locus_tag="Clocel_0193"
FT   CDS_pept        276763..278787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0193"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbk:CLL_A2984 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49977"
FT                   /db_xref="GOA:D9SNV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49977.1"
FT                   /translation="MFELSLVNVKKYMDETLVLKNISFQVYAGEKVGIVGVNGSGKSTI
FT                   LKLIAGIEQMNYYIGYPQTSSYGYDEGFVCVPREATCAYLEQIPQYEDGMKVIDVLKVA
FT                   FAEVYTIENKMRELEEEMKFLETDNLEKALKQYSKLVELYEVKDGYNTEEKLNKICTGL
FT                   KLDENFLNKEFNLLSGGEKTTVVLGKLLIDNPDILLLDEPTNHLDMDSIEWLEVYLKNY
FT                   NGIVIIVSHDRYFLDNVVTKIVEIEDMESKTYKGNYSDFVEQKEKNMLEQIHQYKEQQK
FT                   EIKTIQNTIKELRDWANRVDNNKFFKRAASLQKRLDKMKNSNTESDKEYRTRGQYVRTK
FT                   KPKLERNNMNLSFKETERSGNETIKAEGLSKSFEDKVILKDVNLLINFGERVALIGPNG
FT                   SGKTTFLKMLLGEEEPDRGIVELGASVRVAYLPQQIIFKDEELTVLECFREDISILEGK
FT                   SREYLSKFMFYGKSVFKKVKHLSGGERIRLKLGKLLYEDVNLLILDEPTNHLDIDSIET
FT                   FEEALEDFKGTIFFISHDRYFINKIGERIIAIEDNAFKSYLGNYDYYKGITEELKLKAI
FT                   EDETSKLKKDNKLKNNDEIKKSKKANKRINVDETKKNEAEKAKVEISVQNLEKEIQETE
FT                   LAMADSNIHYEELSKLYSRKEELSKELDEVMELWLNLNS"
FT   gene            279440..280420
FT                   /locus_tag="Clocel_0194"
FT   CDS_pept        279440..280420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0194"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: lsg:lse_0987 MerR family transcriptional
FT                   regulator, putative; PFAM: regulatory protein MerR; SMART:
FT                   regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49978"
FT                   /db_xref="GOA:D9SNV7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV7"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADL49978.1"
FT                   /translation="MDNLIKIKDVSRKYDVTARTLRYYEDMGLLSSTRSDDYTYRMYDE
FT                   NAVRRLEQILILRKLNISIKDIQRVFNTSGSDVVLEVLGKKVQNIDDEVALLHELKEIV
FT                   LDFIREIEQVNFTDNSDIKLLYNKAKEIETQLVTVDYIGKPSNINRLIEITEKLDKKIP
FT                   DIMVVRIPAFKALTCGDQPWGEMFKEGGYMYQLWQYCHLYKSVIFDCFDFLLSKNDKAE
FT                   WICAVKDGVTDADVSPFKLIDFPGGLYAMAVSIDEDNESLRKVEDKVRRWIESTNFELD
FT                   EGRSVMFNMPYLYEYGRDTAYKDIEKGLGYKQMQRYFPIKLKEGI"
FT   gene            280543..281157
FT                   /locus_tag="Clocel_0195"
FT   CDS_pept        280543..281157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV8"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2164"
FT                   /protein_id="ADL49979.1"
FT                   /translation="MEDIKIGSLLSFGNYNWRVLDIQNNRALIITEEVIEERPYHNAYK
FT                   DITWADCALRKYLNGEFYEKFNETDKARIIPVTNKNLDNQWYGSKGGVDTKDSIFLLSL
FT                   EEVCTYFGDSLSKLHNPGKNQRYWFERKDKNNSKRIARLQGQEWGWWWWLRSPGRVNVK
FT                   AVYIFGTDGNIGIQGNNILKGNIDEGRCRGGVRPALWLKLE"
FT   gene            281269..281745
FT                   /locus_tag="Clocel_0196"
FT   CDS_pept        281269..281745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_2165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49980"
FT                   /db_xref="GOA:D9SNV9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV9"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2165"
FT                   /protein_id="ADL49980.1"
FT                   /translation="MSKYENAMKLMEERCGNGKEEVIALGTIALSLSAAGNPRPAVRMV
FT                   CAYYEDGVFYVSTDAKKNKMLQIEKNNEVSVCGLDWYALQGTAENLGWVKDEKNAEIRS
FT                   KFKKIFNWFDEVGDEDNPNSIVLRISLTEGTIIDNERKYGEYQYEVDFINKTAK"
FT   gene            281980..282744
FT                   /locus_tag="Clocel_0197"
FT   CDS_pept        281980..282744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0197"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: cbi:CLJ_B0776 transcriptional regulator, MerR
FT                   family; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49981"
FT                   /db_xref="GOA:D9SNW0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW0"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADL49981.1"
FT                   /translation="MDKIYKTAEVAKKVGVHSNTVRLYEKLQLIPKANRSPNGYRVFTD
FT                   YHIEQFILARTAFKVEVLQNGLRKKIINVVKLSAKGKLQEAINCTKDYINQIKQERKNA
FT                   EEAIELSKELLLGIDAKENNIFFTRKQTANYLKVTMDTLRNWEMNGLLTVKRKQNGYRV
FT                   YTESDINRLKIIRTLRCANYSLSAILRMINAIEESKEIDIREVINKPKEDEDIVTACDK
FT                   LLTSLNDAEKNANSILKQLEFMKKEFNIDSTL"
FT   gene            282796..283527
FT                   /locus_tag="Clocel_0198"
FT   CDS_pept        282796..283527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0198"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbi:CLJ_B0777 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49982"
FT                   /db_xref="GOA:D9SNW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49982.1"
FT                   /translation="MEVIKVHNLYKSYGDVQVVKGVSLTVKKGEIFGLLGANGAGKSTT
FT                   IECILGTKNFDDGQVSILGMNPKKERKKLFQKVGVQFQESNYQDKITVKELCEITEVLY
FT                   KNPLDYNKLLEQFKLQDKVKNLVSELSGGEKQRLFIILALIPRPEVVFLDELTTGLDAK
FT                   ARRDVWKCLLNLKKQGLTIFLTSHFMDEVEILCDNICILKNGVADFYGTVEEAVTLSPY
FT                   EKFEDAYLWFVDEEELNDESI"
FT   gene            283511..284257
FT                   /locus_tag="Clocel_0199"
FT   CDS_pept        283511..284257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0199"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cbo:CBO0710
FT                   putative drug resistance ABC-2 type transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49983"
FT                   /db_xref="GOA:D9SNW2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL49983.1"
FT                   /translation="MMKVFKAMLKTELKLSLRGMDMFIFAICMPVVATIILGIIYGDKP
FT                   AFPGADFTFLEQSFAAVSTISICAGGVMGLPLVLSEYRHRKILKRFRVTPVSPSVILVV
FT                   QGVIYALYSIVSLILVYLTAKVFFNFQLRGSWTNFLGAYTLVMISIFSIGFMVGGIAKN
FT                   TKIAGVIASILYFPMLIFSGATLPYEVMPTALQKVADILPLTQGIKLLKNASLNLNLDN
FT                   VILPILVVSAITVICIGVSIKFFRWE"
FT   gene            complement(284477..285052)
FT                   /locus_tag="Clocel_0200"
FT   CDS_pept        complement(284477..285052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49984"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW3"
FT                   /inference="similar to AA sequence:KEGG:CAC1508"
FT                   /protein_id="ADL49984.1"
FT                   /translation="MDNNQFTCCPYYMSRAICPSCNGKLGNSSQKFTAFSGTVTRIEDL
FT                   NPGQNDASAGCYKLMSVENKNRGPVNFVISPGTYFVDHEVVELGDEVTGFYDSNAPTIL
FT                   IYPPQYPAIVMAKNTEYQNITVDYFNNDLVSSDGNLKLNISLATEVILTNDQFFSKYPR
FT                   NRNLIVVYGPTTKSIPAQTTPYKIIVLC"
FT   gene            285718..287223
FT                   /locus_tag="Clocel_0201"
FT   CDS_pept        285718..287223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0201"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: lsp:Bsph_3073 hypothetical protein; PFAM:
FT                   chemotaxis sensory transducer; SMART: chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49985"
FT                   /db_xref="GOA:D9SNW4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL49985.1"
FT                   /translation="MTDTYNVKRVHKVSLIMTCLIIFSMIIDATIAGGSKAGITLATRA
FT                   SACVIIGIINYFLPINDYIKGLIFGIVPSISMCLLSALYGFQLSRHYIIICTVGLMALY
FT                   FRKEVTIAHGVITNIALLVTFLVNPDSISGLGTDVEDFIFVLIILDATIAMLYFLSKWG
FT                   RALVNEGAQKTAQSEELLKKLQNTFTKVEDNTDTIDNRISELNSNINCITEASNNITTS
FT                   VQEMAKAIQEEAISVTGVNETMADSLEMVNETWDISKGISNRADVVSEKVSEGWDRMQQ
FT                   MNNQINIISDSISTANTTVSELQSSMETVNNLLQGISEIAVQTNLLALNAAIESARAGE
FT                   HGKGFAVVADEVRKLADQSTIIVNDITQVTTALSNKSQEAFEKVNQGSNAVKEGKELIN
FT                   NISTYFKDIKDTFNDTNTEISKGLSKIEAVADKFLNVQRDMENMAGLAEQNAAATEEIL
FT                   ATIENENTQIIQIGNSLYEIRELSGDLKKMISSNNNRSVMKLN"
FT   gene            287475..287588
FT                   /locus_tag="Clocel_0202"
FT   CDS_pept        287475..287588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49986.1"
FT                   /translation="MRSLVINKIKVRQDGDNESFSENDDYFRWKRVKSQKS"
FT   gene            complement(287535..288218)
FT                   /locus_tag="Clocel_0203"
FT   CDS_pept        complement(287535..288218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0203"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: cbl:CLK_0304
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49987"
FT                   /db_xref="GOA:D9SNW6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW6"
FT                   /inference="protein motif:PRIAM:2.7.8.13"
FT                   /protein_id="ADL49987.1"
FT                   /translation="MINIVYAILLSFLLSSLIGTILVPIFKKLKLGQNIREEGPKSHYK
FT                   KAATPTFGGIIFILSSIIAMLFFIKQYNEEIQFIFYSLIAFGFIGFLDDFLKKVHKKNQ
FT                   GLTSKQKMILLLFASTTFAIYAYYNPEIGSTIILPFAGKMIDLKLLYIPFIIFIYVATT
FT                   NSVNLTDGLDGLATLVTLLVMVFFALVAFNFRYYTLAIFCGCMCGALLGFLRFNSFPAK
FT                   IIIIF"
FT   gene            288580..289122
FT                   /locus_tag="Clocel_0204"
FT   CDS_pept        288580..289122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apr:Apre_1785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49988"
FT                   /db_xref="GOA:D9SNW7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW7"
FT                   /inference="similar to AA sequence:KEGG:Apre_1785"
FT                   /protein_id="ADL49988.1"
FT                   /translation="MNLEDLRDDIAIRQKKGIPFIVASIILWSFIIVVVNLNLPIYYMN
FT                   LLIFCCSCPLVPIAWGIGKILHIDIFDKSNPLGQVGFIFTLNQLIYLLIVMWVFNAVPG
FT                   KMLMVYAMVFGGHLFPYSWLYKSISYKIFAIIVPLLALYIGSTFSPVVLAGTMLFVEII
FT                   FVVALLGEMKKLKHNAN"
FT   gene            289533..289796
FT                   /locus_tag="Clocel_0205"
FT   CDS_pept        289533..289796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0205"
FT                   /product="helix-turn-helix domain of resolvase"
FT                   /note="KEGG: bmq:BMQ_1971 helix-turn-helix domain of
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49989"
FT                   /db_xref="GOA:D9SNW8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW8"
FT                   /inference="similar to AA sequence:KEGG:BMQ_1971"
FT                   /protein_id="ADL49989.1"
FT                   /translation="MKYINATEVLPLDLLSEIQKYIAGEVLYIPQPKGLKNSWGSRSGA
FT                   RQEIINRNKQIKSEKEDGRSIEELMMKYNLSYDTIKKIVYLK"
FT   gene            289934..290047
FT                   /locus_tag="Clocel_0206"
FT   CDS_pept        289934..290047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49990"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49990.1"
FT                   /translation="MINSETIIKKLKEELEPIQYIHAMWLEGADAIGQADE"
FT   gene            290270..290704
FT                   /locus_tag="Clocel_0207"
FT   CDS_pept        290270..290704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nvi:100122270 similar to BRCA1 interacting
FT                   protein C-terminal helicase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49991"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNX0"
FT                   /inference="similar to AA sequence:KEGG:100122270"
FT                   /protein_id="ADL49991.1"
FT                   /translation="MYIKDNQIEAAKVIFDKSEIIQYKDYNECDYKSFNIARLEECKYR
FT                   YSQHCRVKKYVHRGMYLEAYAYYNRYVLEPLIDMLRLIHTPSHAHYYLIHISQHIPKSE
FT                   VKKLEFFAKISSLKDIDEKMHLAETWFLELMLELEKLEIK"
FT   gene            290759..291622
FT                   /locus_tag="Clocel_0208"
FT   CDS_pept        290759..291622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0208"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cbl:CLK_1587
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49992"
FT                   /db_xref="GOA:D9SNX1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNX1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADL49992.1"
FT                   /translation="MSIYKSQDGKIASIKLYDAQLQKLGYLFSDKYVTTSFGKIHLIET
FT                   GNMKGKPLLVFHGGNSTTAYNLLMYKFLLKDFHVYAIDTIGHPGKSDEVCLSSNNYDYG
FT                   KWASEVITAIGYDKISCFGVSFGGGILAKLMCIAPEKIEKAVLVVPAGINNALPISSVK
FT                   MLIPLIKYVVTKKEKYLKETALYMALSEIVLDEDTLDTIKDSFDNVKTKVGMPSNIMRK
FT                   LLRNYKTPTLVMAAEKDCLFPAKRVLSRAKTIIPNCKVHMLKGCGHMHIMPQYEKKMIV
FT                   DFLIDS"
FT   gene            292038..293339
FT                   /locus_tag="Clocel_0209"
FT   CDS_pept        292038..293339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   str:Sterm_0208 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49993"
FT                   /db_xref="GOA:D9SPE4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL49993.1"
FT                   /translation="MNLLKTLIKDLHSFLILWITQSLSALGSSMTNFALIIWSYQQHGS
FT                   ALQTAMLSVCSYLPYVIMSIFAGALSDKWNKKIIMLVSDSFAALCTIVVLLLLKTGSLE
FT                   IWHLYCLNALNGLMNTIQQPASDVAISILTPKNHYQKVSGMRSFSNSLISIMTPIIATT
FT                   LLTLTSMDLIILLDLLTFGVAFVSLLCFIKIPTAHNENVKKESVLQSAKSGLNFLKHNR
FT                   GILNLILFLAAINFTASVFNATFPAMILSRKGGGEVSLGIVNTVTGIAMLVGSVIASIL
FT                   PTPKSRVRMICNSLLLSMSTENFFLAFGSSVPVWCIGSVLGWIAIPIMNSNMDVIFRNY
FT                   IPIEMQGRVYSARNTLQFFTIPIGYFLGGVLVDKVFEPFMIYQQTGEVLATLFGTGKGS
FT                   GAAFLLFILGIVGVLTCVIFRKNTDIWKLDRITE"
FT   gene            293508..294368
FT                   /locus_tag="Clocel_0210"
FT   CDS_pept        293508..294368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cbf:CLI_0865 AraC family transcriptional
FT                   regulator; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: transcription activator effector binding;
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49994"
FT                   /db_xref="GOA:D9SPE5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE5"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49994.1"
FT                   /translation="MEWIEGIGEAIRYIEDNITEEILIENIAKKVLMSPFYFQKGFAML
FT                   CGFTVGEYIRQRRLTLAGREIVSTDEKIIDIALKYGYTSPDSFTKAFTRFHGVTPTAVR
FT                   KDGAMIKSLAPLKIKFSLEGGYIMDYKIVEKDSFTIMGVSKVFKYDSATTEIPQFWAEH
FT                   YQTGKGKFVCGMYGINIDESMGSEEFEYLIADNYNPSVEVPDGFVTKIIPKYTWAVFAS
FT                   KGPMPKSLQDVSGRIFSEWLPNCKDYEIAAGYNIEMYTNTDDYPQGSQDESYYSEIWIP
FT                   VRRKD"
FT   gene            295152..296375
FT                   /locus_tag="Clocel_0211"
FT   CDS_pept        295152..296375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0211"
FT                   /product="Pectinesterase"
FT                   /note="PFAM: Pectinesterase; KEGG: fba:FIC_01878
FT                   pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49995"
FT                   /db_xref="GOA:D9SPE6"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE6"
FT                   /inference="protein motif:PFAM:PF01095"
FT                   /protein_id="ADL49995.1"
FT                   /translation="MIKNSKKTIGKMLALTMLLTASLGSIPSGRTVSAATATNIYVGDS
FT                   SKSNNYKTVKAAIDAAAKINPTSEAQRVTIHIAPGVYRAQLKIATPYITLVNSNPSKQV
FT                   KITWYYGFGYDYYSAGSDGFYNQSNATAKTTKNHVSSGKWGGSVYLTSAAKAFKAENIV
FT                   FENSFNKYVTSEELADGVALSTTFPQSKSSTLTQRTASTNVASKAQTERAAAMIIDADN
FT                   VEFLKCSFIGSQDTLYTGSVGTNNSYFKNCTIEGNTDYIFGDGNAVFDNSTLNFCGYSD
FT                   KAVGGYITAAKDKATYGYLFRNCLVTATSSKKQAPGYFGRPWGAAAKVTFLNTKLQNST
FT                   IINAAGWTSMSSNLPEKANFKEYNTTYNGAKVSTAARKGVVLSSADAAKIDATKYFGDW
FT                   TPKYYTAK"
FT   sig_peptide     295152..295256
FT                   /locus_tag="Clocel_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 35"
FT   gene            296829..299501
FT                   /locus_tag="Clocel_0212"
FT   CDS_pept        296829..299501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0212"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG: diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49996"
FT                   /db_xref="GOA:D9SPE7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL49996.1"
FT                   /translation="MYKEIKNSVPITTVVSSILLLVFALLAVITKVYSFPFILGVTFSL
FT                   SGVFLLIILKLYNINTALVVAIIAQLAEIISSDYPYWGFIFVLEIAFVGLYSIWKPKNN
FT                   LIFGDLLFWIFIGIPVSAVAYYTLFYNGGWDAYIMRISADIICGLSSCAFVDGLLTYVP
FT                   TEKLLKKLGKTDDSIQFLKFLFVFISVILSVSILSTFIISGFNTYSAVNEKNEQIVQDY
FT                   LDDIRREVSVMDKNQQAQLLFYGVLQAGQLEELIEKLQSEKKADIIITDTSNKVVATNI
FT                   DKVKHGQVFDWQKDTLTVKELEGVYAVTPYKKYGRIETEAWAEGNYFYTREIGLLDLKL
FT                   IVSFPIKQIQQEVLNNYASKFRFVMYFIIFSLLVAVVTNRLLVKSIKKLSAATTAVPVR
FT                   IKNAEQIEWPNSGIYEVKQLITNFKDMSDNFKKMFMESQELNKTLALQADELLKSEVKL
FT                   HKLAYYDTLTNLPNRHMFKMYLEEKLQMARKNNNIIGVIFIDLNQFKKINDTMGHSAGD
FT                   DLLAIFSKRFISIKSDNTEVFRLGGDEFVFVVIAEEENQVKLFGEEIAKIFIKPVELLG
FT                   AILSVTGSIGISMYPKDGQDLDTLVKYADLAMYRSKEMGGCNIEYFNKEIHRDFEENMI
FT                   LETGIRKALEDNEFELYYQPKINAQTGAITSCEALIRWKHLDLGYVSPMKFITVAEKSG
FT                   LIFQIDKWVINEACRQNVQWQLEGRKKIPVSVNVSAKHFFEGQLVDVVKEALKNNGIEP
FT                   KYLRVEITEGVLIKDKQFVADIIKRLAGLGVLVSLDDFGTGYSSFSHLFQLPISELKLD
FT                   REFIQGIDKYEKKGAMVKIMIEFAHNLELNVVAEGIETLEEYKFLQEIKCDELQGYLFS
FT                   KPVKNEEFKDLISAVNINV"
FT   gene            299569..300906
FT                   /locus_tag="Clocel_0213"
FT   CDS_pept        299569..300906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0213"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cth:Cthe_1957 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49997"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL49997.1"
FT                   /translation="MGKRSVVLIAILIFISLTVDFGKYRLSTNNQFTQTDVKDESKDDE
FT                   KSDSSNEPINLTILSYYKDFENQANEYHKAHPNVNIKIDVVDYDHIIETAFKSIASGSS
FT                   PDIIVFDSNHTFNLNGNEALQNLLEEPFSAGKYKQGFAEDLWRSVLSYDKNRLIGIPLV
FT                   INDMVTLYRADIMEQYGFPSEPEALAQYMKNPENWLKIAETLKLDNKYIASWATDPLNI
FT                   YGSGTGIFDENLNLLRLDSNFEKAIELSQNIKMNGLSLNGDIYSEDGKQALKDGRLAMV
FT                   YGGSWLIYNFKDLVPEERGKWRVAKLPFGINGFGSSNIMAISSTSKYKEEAWDFIKTFE
FT                   LDDKKSYWGGSIPVYLPAVNNIKNFSNKDAFFGDQDLGLFFKDIRQSTKVPVFTPLDDM
FT                   AMSIWKDKTQYAIANAVNPKDALKQYEEEINSRLADKKKILLDRKQ"
FT   gene            complement(301262..301804)
FT                   /locus_tag="Clocel_0214"
FT   CDS_pept        complement(301262..301804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0214"
FT                   /product="Protein of unknown function DUF2947"
FT                   /note="PFAM: Protein of unknown function DUF2947; KEGG:
FT                   lmh:LMHCC_2381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49998"
FT                   /db_xref="InterPro:IPR021334"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE9"
FT                   /inference="protein motif:PFAM:PF11163"
FT                   /protein_id="ADL49998.1"
FT                   /translation="MVDSPNDSSKYISMESFGINWFFYVEDMEIPEEDIKNIKPLSKDY
FT                   STFIWNMNINNRKHHFALLSKDEKLSLSLTEMDYHWQQDWNNGTYENLSNYLSENIICK
FT                   PSDKVIVFWQKEHSVETSWDIFLRHWANFLFDDEGVILVSRTYENILLFTSDGMIQMGK
FT                   RLWSNSYILDKQEKIMK"
FT   gene            complement(301906..302298)
FT                   /locus_tag="Clocel_0215"
FT   CDS_pept        complement(301906..302298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bre:BRE_1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49999"
FT                   /db_xref="GOA:D9SPF0"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF0"
FT                   /inference="similar to AA sequence:KEGG:BRE_1001"
FT                   /protein_id="ADL49999.1"
FT                   /translation="MKRTIAIIFFTLINLVELLILGFLAAIYSYFLDIFPWKETDPIAL
FT                   LVLFPLSIVFLVIGILLCLFKIKLSILKTNILTPFCTIAYLMLSLFFIPKYPNFFYITD
FT                   SLVIVVSFILVLITTIISIKKIRVLK"
FT   gene            302785..303222
FT                   /locus_tag="Clocel_0216"
FT   CDS_pept        302785..303222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50000"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF1"
FT                   /inference="similar to AA sequence:KEGG:CLK_1328"
FT                   /protein_id="ADL50000.1"
FT                   /translation="MIIKAIKDYISTCSYLQEFEAAICAVVGSGTSNSELYAIEVVKAE
FT                   PILKKYMNGDSLRQCHFTFCSKESYGIDVLRSIESSSFYDDFENWIEEENRKGNLPSLT
FT                   GNYIPVEIKVISSGYAFPVSQDKSRYQIELILNYYKKQGGN"
FT   gene            303225..303707
FT                   /locus_tag="Clocel_0217"
FT   CDS_pept        303225..303707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbb:CLD_2453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50001"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF2"
FT                   /inference="similar to AA sequence:KEGG:CLD_2453"
FT                   /protein_id="ADL50001.1"
FT                   /translation="MGIKQRKSYANYLKVANAFEFMGAGFSDLNEAPTAVSASKRYISE
FT                   SSTTKTITGYEWSTAYVTDMIRSEKAVDFICNIGEMQLTGAEAETEYVIVDLDVPAATA
FT                   NEFKARKVKVAVEVATFDNTDGVMGATGNLLGKGDMVLGTFNTETKTFKEGFTAAV"
FT   gene            303910..304251
FT                   /locus_tag="Clocel_0218"
FT   CDS_pept        303910..304251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50002"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF3"
FT                   /inference="similar to AA sequence:KEGG:CLK_1326"
FT                   /protein_id="ADL50002.1"
FT                   /translation="MIINNVELIDIDIFDVEVAEKYENALKEVETVASKVKDMKLSESV
FT                   RTQCESIFKVFNILFGEGADKKIFGDKMNLLTCIKAFEELVVQVNDQKSAIEEIASKYS
FT                   PNRAQRRKK"
FT   gene            304251..304862
FT                   /locus_tag="Clocel_0219"
FT   CDS_pept        304251..304862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0219"
FT                   /product="putative protein GP15"
FT                   /note="KEGG: cbl:CLK_1325 putative protein GP15"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50003"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF4"
FT                   /inference="similar to AA sequence:KEGG:CLK_1325"
FT                   /protein_id="ADL50003.1"
FT                   /translation="MNLLIDLLPNTVDINGVKYEINSDFRTSILFEIMMQDTSLSDEDK
FT                   IIQALQLYYPRVPEDIDTAIDKMLWLYRCGKDETSLKGTGSNKTNQIYSYEYDEDYIYS
FT                   AFLDQYGVDLQDIEFLHWWKFKAMFKSLKEDNEIVKIMGYRAMDLSKIKDKSQRDFYKK
FT                   AKEIYKIPTMLNKDEKQKISDIEETLMGSGDLASVLKQDK"
FT   gene            304947..305108
FT                   /locus_tag="Clocel_0220"
FT   CDS_pept        304947..305108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0220"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: cbb:CLD_2459 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50004"
FT                   /db_xref="InterPro:IPR019294"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF5"
FT                   /inference="similar to AA sequence:KEGG:CLD_2459"
FT                   /protein_id="ADL50004.1"
FT                   /translation="MEYQTKNEVIIIDEVRCPKCNQLLLKAEYIKGEIKCTRCKKIIEL
FT                   SMESKDRA"
FT   gene            305175..306821
FT                   /locus_tag="Clocel_0221"
FT   CDS_pept        305175..306821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1322 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50005"
FT                   /db_xref="GOA:D9SPF6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF6"
FT                   /inference="similar to AA sequence:KEGG:CLK_1322"
FT                   /protein_id="ADL50005.1"
FT                   /translation="MADEKKCNCGNDASEEQTDLQKYTEEVKALAKGGFDVLSNSAINV
FT                   VSKLKEIGLEGIKLAGNLEKVQGSFPNNIDSFSSQMDIANSNIEGLITDLGQILLPIAT
FT                   EVVKKFNEVADKVKNALANPEVQASIQGLAKDIGDLVNGALSFFADNLDIITEGLTWVM
FT                   DNSEVILAGIVAIGAALATIAIIGAISSIVGLFVALYEEIATGTPIMEAFNIVVGMNPF
FT                   VLIAAAVIGLIAAFIFLWNTSDGFRNFWIGLWDNIKTIFSDVWNGIMTFFTEVIPGWID
FT                   SLIQWLSGIPQWFSELPGKIGYFLGYLLAQLLLFGINAWTWVTTEVPNIINTIINWFAQ
FT                   LPSNIYNWLMNVVSNLEQWASNMISKAEQAAKDIVGGIINFFKNLPGEMENIGKNIVTG
FT                   IYNGIINAKDWILGKIDEFVSGVVQGFKDALGIHSPSRVLRDEVGKFIAKGIAVGFVAE
FT                   VPKMQGDIDSSMSDMVARMQGAVGCEIAATTANVASNNSAITKDNAINDTLMNSNGKVI
FT                   ENHIHVDIEGREVAKAVAPYQGVFDTYQIGR"
FT   gene            306828..307535
FT                   /locus_tag="Clocel_0222"
FT   CDS_pept        306828..307535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0222"
FT                   /product="phage tail component"
FT                   /note="TIGRFAM: phage tail component; KEGG: cac:CAC0062
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50006"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF7"
FT                   /inference="protein motif:TFAM:TIGR01633"
FT                   /protein_id="ADL50006.1"
FT                   /translation="MLKNGEIYFNGNTSIGLNLFLEEYPSVPIANEDFEEITVEGRSGS
FT                   LYINKGTYPDKKIPFNFTILSPQIEIDFDKVYQWLTEIQDKRLIFGREDRCYIVKKVLF
FT                   ENLQKQFKTIGQFKVTFICEPFSSDLNYTTYEITSDNYSFYYQGNAPAESLIKVYGIGN
FT                   IQLTINGETMVIYDVTDYVEIDSKFMQVRNKDKTSKDSAAYGVFPLFSAGANTIKYTGN
FT                   VTKIIVEYTTRYK"
FT   gene            307544..310060
FT                   /locus_tag="Clocel_0223"
FT   CDS_pept        307544..310060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0223"
FT                   /product="phage minor structural protein"
FT                   /note="TIGRFAM: phage minor structural protein; KEGG:
FT                   bcu:BCAH820_0599 phage endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50007"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF8"
FT                   /inference="protein motif:TFAM:TIGR01665"
FT                   /protein_id="ADL50007.1"
FT                   /translation="MKKDIKIAYFSYNTKKEDVLAYNGMALDNYCIKCETEENLNTGGY
FT                   TLDATFLLDVQNTIKNSSGLVDGIREEGILKVKLDYGDEIFRISKVTKGTKHIDVVARQ
FT                   ITISEVLNLYLDNIDIKAANIAQALGYLYDGAYGNKNLELTTNLIGTVSGSYKDMSLYK
FT                   AIQGDQDSIINKVNGEIQRRKYKLSVLDQVGKNGTIVTIREGKNLTGFNGTSDFESVVT
FT                   RARGTGANGIKGNWIESSNISKYAMVYSKTVSYDDVKVRTQEEIQKNQATDGYDTRESA
FT                   IAELDRRVKKLFDQQQIDIPKVSYEINFVQLEKTEEYKNYAIAERVDIGNTVRVYVPKL
FT                   DTDIMVRAVVKKYDVLAQRTKELTLSNEVETKAMGMNISSIVADLKKQYASSGSSSINE
FT                   YMTSVIKSGMKDSYVVVRDNELLIMDKPDIDAATKVCRYNQNGLAFSRDGYYGTYTTGV
FT                   SIDGIINADLIQTGIINADLIRTGKLSSKDGSISIDLNSNVFSIKNPNEDVKDGLSADT
FT                   DGNLTITGAFRQFDDKGKKSIDIYDNKINIYDYKRNEDFIGALMSETTGGDTYGRLVLC
FT                   AHTGNPLDLGIFNNDGTYSKYITLRDNADELATITMQQWCDFKNDITISAGDVAYGFMK
FT                   LDANKDLWLCSNADDSQSLKLGNRRFDGELRNVIEISAAGGGVNSAVTINGALNIAQGK
FT                   NRIVETNGYGVVALGAYETTEPYFGDIGEGIIAEDGLCYISIDPIFMKTVNTSCSYQVF
FT                   LQRYGEGDIYILERAEDYFIVKGTPGLNFGWEIKAKQREYENNRLEVSDKFEPVVENFD
FT                   DQLLDQNIINDKELDGILEGEEIIYE"
FT   gene            310053..310259
FT                   /locus_tag="Clocel_0224"
FT   CDS_pept        310053..310259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0224"
FT                   /product="peptide chain release factor 2"
FT                   /note="KEGG: art:Arth_2666 peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50008"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF9"
FT                   /inference="similar to AA sequence:KEGG:Arth_2666"
FT                   /protein_id="ADL50008.1"
FT                   /translation="MSKKIITSYTNIKTAEGERLSYTVSTIDDNGNLITSNERKNCIVF
FT                   DEEALAHIEAIRKLLQDRELAVL"
FT   gene            310464..312695
FT                   /locus_tag="Clocel_0225"
FT   CDS_pept        310464..312695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mth:MTH716 cell surface glycoprotein (s-layer
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50009"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG0"
FT                   /inference="similar to AA sequence:KEGG:MTH716"
FT                   /protein_id="ADL50009.1"
FT                   /translation="MQNIISMKIDLKKESYQNNVAQQNDDMVLDINIYGDGDIISLEGA
FT                   TAQLSYINANNTIATISGSEVVVSGNNVKITCPRDCTRSAGIAKMKLVIISASKQVSTF
FT                   PIEITVVPDVVQGQEVSGNVATVIEKLINENIICNDTLVRLQNWVATHGDIVDLDSRVD
FT                   TLELDNTQDAKIIQGTDYLDINAEIMLYTSEGYKIKFKRMTYDLTGTILIPSDADIDGN
FT                   GCTWRRKVDDIARGVFDIAQNIDETNGNVNIRIANVTIDGNRQADQLVNTIDNHRFSGL
FT                   KLTKVTGESFISNVTVINTVNGEDLQTTPAGGIFFVDCKDIRCSNLNGWYNLGTAIIIR
FT                   FSSNITIDGSLTYDNEGSGISGRGCPNCKYLNIVTFNNKFSNLSVNGVDSIVDNVISYK
FT                   AGYSGVNIGHPDKDATTKYYANAHGTVLSNIISFDNTYEGLTIGGSDNVSCTNVIVYGN
FT                   AINTTRENIRIHGNSNSSKLINITSRDCATSGIRYYSGTNHVLDNSEFYNCKCGVYCGP
FT                   DTSVTIGGNVKIHNNSLDGIILASAIKCTVACEVYSNGEYGIWISGGSKHRIVGADIHD
FT                   NILKDIYETGSPVDLYYDIGNKGITYLSNGVVQVTCIKSVTDEVNTPVFRVQLPDHGRL
FT                   SVDFAITTFYPASVSAICHMVKGVAVASATGGGVINSQTTVFGTATAVSAGLSQVITPS
FT                   LVKDETNDYIEFIVNQNNETVDAAGTINITATITYAIGSNVVRPTVTLL"
FT   gene            312859..314934
FT                   /locus_tag="Clocel_0226"
FT   CDS_pept        312859..314934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00703530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50010"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG1"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_00703530"
FT                   /protein_id="ADL50010.1"
FT                   /translation="MQNTISMSIDLKRENHQNKIVQQNDDVLLDIDVYEEGKIKNLEGA
FT                   IIDLSYVNANNTISIIAGNSMVVSGNNVKITCPRDCTRSAGVAKMKLTIVSDSKQVSTF
FT                   PISITIVPDVLEGQEVSKNIATIIEGLTAANTTATITYNELMQAIELGNIPQLTNRVVN
FT                   LEKEVNRIEPSQFIEAGDTCDVESINRMIQYASANNLVAFIPKRFSDYIINSPIYVPSN
FT                   ITLLSNGATIKLADKSNCRYCIVNEDRINGNSNIKIIGLRINANQTNQNDSLIIGNIIG
FT                   ICFESLSNTSACHDCMAILNYIYDSSIAIRSWVSDENLTGSRMHCYNMTFSHNTLEKCI
FT                   NKIIELGVTDRSLVSSNVCKQCTDGIQVIFNSNYNMVSNNIIECTATGLNITHNSCYNT
FT                   FTNNYVSGYGYLLIMRADAQNTTSIIKGNKITNNTFQMSQGTGTIFSFSKLGSATGSME
FT                   YYDNDISNNSFLGYSSSATAFLRLYNFSSNDVSCKIDKLFLNNNTFANCAIVAGSVDRV
FT                   NCTVGDIILNNNTYTESYVIPGKVAYLYIQGGFFKFDTLNTAIQYNSSSNPTNIFISDL
FT                   VVKAAKLFIALTNSAHTNTISIKRCNVESASTSESVAVHNCNFFFLDNCDIITPDANLG
FT                   VYFSNITGFSGKNNRIFGNSRGFSQKVGSALGGKMTSNEFYGTTTSYENMNNFTIV"
FT   gene            315083..315532
FT                   /locus_tag="Clocel_0227"
FT   CDS_pept        315083..315532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0227"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="KEGG: acl:ACL_0628 phage-related holin; TIGRFAM:
FT                   toxin secretion/phage lysis holin; PFAM: Holin toxin
FT                   secretion/phage lysis"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50011"
FT                   /db_xref="GOA:D9SPG2"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG2"
FT                   /inference="protein motif:TFAM:TIGR01593"
FT                   /protein_id="ADL50011.1"
FT                   /translation="MRYIEKLINIKTIFFTIVAVLGGFLANVLGGFDDLLIALIICMIA
FT                   DYITGLIVALVFKNSTKTLTGRAQSNVGYIGLVKKIFILILIIVVNQLDIITNTNGFLR
FT                   NATIMGFIVNEVLSLIENAGLMGISLPDPVINAIEILKRKSEEKG"
FT   gene            315737..317017
FT                   /locus_tag="Clocel_0228"
FT   CDS_pept        315737..317017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0228"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="KEGG: cpf:CPF_1568 glycosy hydrolase family protein;
FT                   PFAM: glycoside hydrolase family 25; Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50012"
FT                   /db_xref="GOA:D9SPG3"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG3"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADL50012.1"
FT                   /translation="MQSINEGIFGIDVSRWQGNIDWSRVKVAGVNIAIIKASGADDGFY
FT                   EDSRFQTNYQGAIASGIKVGAYHFFTEYEDAIAQAEYFSSLLSGKTWNIKPAIDVESGL
FT                   GDSQLTDKVITFCERVKALTGMDCVIYCNTNYARNAFDSRVAKYPLWVAHYGVDTPGDN
FT                   PIWGQWAGFQYSSDEYIDGITENTVDKNRFTEAMFLNGSVGLSGIQIGEVTASTIAQRE
FT                   TSPTMSGQDAATYIVQGGDTLSAIAEQFGTSWQVLAEINGISNPDLIQIGQALRISKTQ
FT                   NISQGEVSAAIAQGETSAAVAQGGTPLASSGQGTATYIVQGEDTLSTIAEQFGTSWQAL
FT                   AEINGIANPDLIQIGQVLRISKASAIAQGGTSPDSGGQGNTTYIVQGGDTLSAIAQRFG
FT                   TSWESLAQLNGLANPDLIYEGQVLRIG"
FT   gene            complement(317549..317929)
FT                   /locus_tag="Clocel_0229"
FT   CDS_pept        complement(317549..317929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_1132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50013"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG4"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_1132"
FT                   /protein_id="ADL50013.1"
FT                   /translation="MDIKKRVLQFWEDVANQNPIKLQEYFRPDAIINWHNTNESFTVEE
FT                   YIIANCEYPGQWCGEVERLEIIDDLVISVTRIWLSDNSFSAHATSFIRFYDEKIINLDE
FT                   YWGVDEAAPKWRQDKKIGRPIN"
FT   gene            318371..319723
FT                   /locus_tag="Clocel_0230"
FT   CDS_pept        318371..319723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pbe:PB000445.00.0 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50014"
FT                   /db_xref="GOA:D9SPG5"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG5"
FT                   /inference="similar to AA sequence:KEGG:PB000445.00.0"
FT                   /protein_id="ADL50014.1"
FT                   /translation="MKNKSINKEIIFLIVSVIAFVAMYIFAFVIKPKPVKNAGQEVVIA
FT                   TEKDAPDNSEVKENDQQDNSEATEEEKKTNREIGHYPAVSGEVGVLDEKYSYGDVRRYG
FT                   IIPDKDTIWHNTQYINNAFNNGSKLGFEVFFPKGFYKTQLNISQSNLTLDFEEGSEVTG
FT                   GVYIYTIDNQNKIKNVTIKGTIVTYDRFAATNTDTLIVDTIYVKGDGSKATDYPGIRGR
FT                   GVHIYKGTTNMRCKSIIIDDIDGNGENNCAAVQIDGYVENPSNLSIDKIWVKKSDVHGV
FT                   YLTGNGHKIGEIQVDEFGAGANKQPQPIEDSDDLEQSQELKGVWINRCADTKIGKITVK
FT                   NPDETRKNVKYDVLLDETGKGANTKGVEIGEIISNPMGKSLGVAINDKNYPGKQCIYKI
FT                   GTITIATDRKDKHFVNINSKAQATIETININDSALVQNDSDESTISNIKTN"
FT   gene            complement(319945..320622)
FT                   /locus_tag="Clocel_0231"
FT   CDS_pept        complement(319945..320622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0231"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: cbe:Cbei_1450
FT                   CRP/FNR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50015"
FT                   /db_xref="GOA:D9SPG6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG6"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADL50015.1"
FT                   /translation="MSDYRQINAKSKYIGALYDAYPLLKKIDEENNNVISTEAIFKTVY
FT                   SDEYVASINSVCTGILFVLRGKIKIQKINKDGEETNLYNIEQGEFCHEALSCLSKLESL
FT                   NIIGKAIQDSEVCIIPFGIVEKYLMENNEFLMYIYMDLYKKFSKVIENKEILIHESLES
FT                   RLLKLLIKKNSTIIYATHSQLAFEIDSVREVVSRKLKSIEKEGYIKLERGKITILKDLN
FT                   ELI"
FT   gene            320974..321339
FT                   /locus_tag="Clocel_0232"
FT   CDS_pept        320974..321339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50016"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG7"
FT                   /inference="similar to AA sequence:KEGG:Clos_2735"
FT                   /protein_id="ADL50016.1"
FT                   /translation="MKINTIKENNVEIAVVNSSDILIKDVQSALDFIGTVGFETGCYHI
FT                   VLNKSSICEDFFNLKTKLAGEILQKFVNYHVKIAIVGDFSVYTSNSLKDFIYESNKGRD
FT                   IFFLPDEKQAIEKLSLA"
FT   gene            complement(321501..322439)
FT                   /locus_tag="Clocel_0233"
FT   CDS_pept        complement(321501..322439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50017"
FT                   /db_xref="GOA:D9SPG8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG8"
FT                   /inference="similar to AA sequence:KEGG:CHY_0663"
FT                   /protein_id="ADL50017.1"
FT                   /translation="MKKIKKIKVSYVMVFVIGIFIARGIYTEIANKKYSVDFSPDATGN
FT                   HINIEKIDSSTLSNESGKVAIYEIERPTNITDDKEKALKAFGFTDDYSVDENEERFFIT
FT                   EGSKTLEVFKNTGGFNYFDDLLTRPETKIDINTVDNNKLYEKCEDILKVMDIQDISRNS
FT                   VEPSYITEMGPNNKPLEFGLLGVIFKRVLDGKNVYGADKIMFDINSEGNIASAIITIKN
FT                   YKKIGDKSVISSKKAINKFKSSKKGYIGTDDLAATDSKINESALCYWVESYNKGSQITK
FT                   PIYMMKGETLNSEAKNKNISNKLHIMTNAVD"
FT   gene            complement(322703..323359)
FT                   /locus_tag="Clocel_0234"
FT   CDS_pept        complement(322703..323359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0234"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: cbk:CLL_A2809 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50018"
FT                   /db_xref="GOA:D9SPG9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG9"
FT                   /inference="similar to AA sequence:KEGG:CLL_A2809"
FT                   /protein_id="ADL50018.1"
FT                   /translation="MDKFLKFWKKYSFVGLVAFILLGLLDLRFAIAAIICMVAPIIVSI
FT                   FKGRFWCGNLCPRGNFYDNVVSKFSKKRKVPKFLKSYYFRAVVLILMMTIFTIGIKENW
FT                   GNLYGIGMVFYRMIVVTTIIGVVLSLFYNHRTWCHFCPMGTIASVISKFRKSKNVLHVS
FT                   NSCVSCKLCEKKCPLGIVPYEYKGDVLSHPDCIQCGQCVTSCPRKSIGYEKVTSK"
FT   gene            complement(323823..325235)
FT                   /locus_tag="Clocel_0235"
FT   CDS_pept        complement(323823..325235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC01789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50019"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH0"
FT                   /inference="similar to AA sequence:KEGG:CTC01789"
FT                   /protein_id="ADL50019.1"
FT                   /translation="MSTNIPEDLMNNVEKNLRKHIKDKKRKKHIYKAAAAIISLFIILP
FT                   GSALAVAKYNNSILYSQEIDLARENKNITEVNETFKYKDVEFRIKEIVADATGMEVIYD
FT                   VSDPRYSIDEITFGDKDGTQFTEWGFSLPDPYCDNKEKAFLITLSNAAVDYMRDNPITI
FT                   KINTLTFNDDQNSNKLFDKVTSLINPKDDLKVDWNLKMQIPMQPIKTLSINKEYALDIG
FT                   TLKINSLQVGVLKSVFDYNFIPKDKSITDIFPTFSIRLDNDYNIANVSHSYGLNLGETS
FT                   SNTVGEYTVFGSEDNKGIHGTQEFNSIYYKEVSEIGIRLLNLSVTYDFGNSNIYKIDKN
FT                   NLPLTFNFNGEEFKLTAIEEKENATEYSLEFNKTNRIFTQLRFKFSDTYNYQSSSDSDD
FT                   IQFADQSSRDKLHNILVEKIPNLPAIEDRFKIFNTGVIRSRETIPTRASEFIITEGTKS
FT                   FLYDEEEIIWHK"
FT   sig_peptide     complement(325083..325235)
FT                   /locus_tag="Clocel_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.981 at
FT                   residue 51"
FT   gene            complement(325225..325752)
FT                   /locus_tag="Clocel_0236"
FT   CDS_pept        complement(325225..325752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0236"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ctc:CTC01790 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50020"
FT                   /db_xref="GOA:D9SPH1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADL50020.1"
FT                   /translation="MYNLQDFVQKSKNGDISAFMELLKEKESLIYNIAFSYTKNPYDAE
FT                   DCISEASIKAFDKLKQLRSEEKFYCWFISILINVCRKNVKTSKSPSSEEDLHNIRDEFS
FT                   YQSVDDKLIIEDLLCKLKEDDREIIVLRYLKDYSIKDIAMIMDMPLSTIKTRIYRSLAY
FT                   LREKNGGMKNEY"
FT   gene            326103..326657
FT                   /locus_tag="Clocel_0237"
FT   CDS_pept        326103..326657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0237"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="KEGG: bcr:BCAH187_C0209 phosphoglycerate mutase
FT                   family protein; PFAM: Phosphoglycerate mutase; SMART:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50021"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH2"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADL50021.1"
FT                   /translation="MITNIYFVRHANSSYTPDELNRPLSENGVKDAQRVTELLSHENIS
FT                   KVISSPYKRAIQTVEGVSNHFGLSISIDEGFRERKLAEGAVTNFDEVILKYWENFDFCI
FT                   HGGETAYDAQHRGVESLKNVLNRYCGENIVIGTHGNIMVIIMNYYDKKYNYVFWKDLNM
FT                   PDIYKLIFKDNNLVGVEHIWS"
FT   gene            326932..327699
FT                   /locus_tag="Clocel_0238"
FT   CDS_pept        326932..327699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0238"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: sco:SCO7806
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50022"
FT                   /db_xref="GOA:D9SPH3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50022.1"
FT                   /translation="MNNNNVDKQYNSMSYFYDVLYSGCDIKDWENDFINEHKDLLKNLE
FT                   DNAKVLDSSCGNGIQATALKRYGIDVIGTDISEEMINLTKQYAESNNLLFPTKQLSWAE
FT                   LPDNFGEDFDIVFCYGNSICHSTDKEDMLNNIKSLYKITKNGGKIVIDTRNWDKVIKEN
FT                   IRFNGSGVKKHLDKTYVYTYIWNLNGFDQRGNVEIVFIDITDEKDAKCIPFRLDFTPFK
FT                   HDEFISRLKSCGLRVVKDSFHESSDTYSVILQK"
FT   gene            327729..328382
FT                   /locus_tag="Clocel_0239"
FT   CDS_pept        327729..328382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0239"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cbe:Cbei_0359
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50023"
FT                   /db_xref="GOA:D9SPH4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50023.1"
FT                   /translation="MEFQVENMGAHFDKCASDYDRHFYEDLGMCEFYDEIEKQIKACGE
FT                   PKNILVLGCGTGLEVERIKHSATVTAIDISPGMLQELKKKELHLNVTLNIVCGSYFDVQ
FT                   FEENHFDLVLSTYSLHHFTIEQKTELYKKIYDCLKVEGYFINGDTACRDKETEIKMLSY
FT                   AKDLYEREQAPFGSIHIDIPLALDTELDLLSDTGFNNISLERRWNKAALIKSVK"
FT   gene            complement(328626..329099)
FT                   /locus_tag="Clocel_0240"
FT   CDS_pept        complement(328626..329099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0240"
FT                   /product="dihydrofolate reductase region"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   ssb:SSUBM407_0957 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50024"
FT                   /db_xref="GOA:D9SPH5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH5"
FT                   /inference="protein motif:PFAM:PF00186"
FT                   /protein_id="ADL50024.1"
FT                   /translation="MISLIVAVAKNNVIGNNGIIPWKIKGEQKRFKELTIGKTIIMGRK
FT                   SFEEIGKPLPNRKTILISNTQCIESENCTTVNSLSEAFDLTKDEDEVFVAGGGQVYKES
FT                   FTYADRIYITVIDKIIDGNVYFPEISSDDFIKSYEERIDAEIPYTYYTYERRK"
FT   gene            complement(329800..330150)
FT                   /locus_tag="Clocel_0241"
FT   CDS_pept        complement(329800..330150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tad:TRIADDRAFT_62504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50025"
FT                   /db_xref="GOA:D9SPH6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH6"
FT                   /inference="similar to AA sequence:KEGG:TRIADDRAFT_62504"
FT                   /protein_id="ADL50025.1"
FT                   /translation="MDETAVINALNILGNKFDSLSQIMELDIAQKEAINFNELIIAQLA
FT                   LLASLLMLIGDMLILLSQLKQNEQTLKEEKKLEEYDFAETLSMWVYVLGDYLCLESSLL
FT                   ELKDLKQSSQDE"
FT   gene            330584..331204
FT                   /locus_tag="Clocel_0242"
FT   CDS_pept        330584..331204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50026"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH7"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3043"
FT                   /protein_id="ADL50026.1"
FT                   /translation="MKKLKKFFAVLIVSVMSAVMLTACGSTKASPEESAEIFLDVLLKN
FT                   DKSNMDKIGMEEDDYTKFREAIDYGLMEGFAGSISDPNVLTEDIKNTLKENIITGFSKV
FT                   EYKVVSSEIDGDIAKVNVEIKGFDMNTISANIQARLQEDLKANPAMTQPQMLQTSLKYI
FT                   GESIANGVIVQEPKTITLALAKDGNTWLPGENDIVTLMEALVS"
FT   sig_peptide     330584..330673
FT                   /locus_tag="Clocel_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.548 at
FT                   residue 30"
FT   gene            331539..331922
FT                   /locus_tag="Clocel_0243"
FT   CDS_pept        331539..331922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0243"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: cby:CLM_0905 putative arsenical resistance
FT                   operon repressor ArsR; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50027"
FT                   /db_xref="GOA:D9SPH8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL50027.1"
FT                   /translation="MKPQYEENAKIIKALSDPSRLKIIDILSCGEKCACEILEEFQFTQ
FT                   PTLSHHMKVLSDCGLVNSRKEGLWNYYSLNNSKCNKLILFLMNLVTDTEECICKDKTED
FT                   DCKTEKKGYCETGIKCDCKLLEN"
FT   gene            332113..332520
FT                   /locus_tag="Clocel_0244"
FT   CDS_pept        332113..332520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0244"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="KEGG: cbe:Cbei_2111 protein tyrosine phosphatase;
FT                   PFAM: Protein-tyrosine phosphatase, low molecular weight;
FT                   SMART: Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50028"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH9"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADL50028.1"
FT                   /translation="MKVKVAFICVHNSCRSQMAEALGKLFASEVFEAYSAGTELRPQIN
FT                   QDAVRIIKDLYNVDMNETQKSKLLEDIPTVDIVVTMGCNVVCPALPSKHREDWGLEDPT
FT                   GKNDEEFIKTAKIIEEKVKDLARRIQNNEIF"
FT   gene            complement(332604..333143)
FT                   /locus_tag="Clocel_0245"
FT   CDS_pept        complement(332604..333143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_3212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50029"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI0"
FT                   /inference="similar to AA sequence:KEGG:CKR_3212"
FT                   /protein_id="ADL50029.1"
FT                   /translation="MKSKKFILALTMTIAMGLGITAYASAEPSSTTVVTNTTDSANTSV
FT                   HKKAGIKRVTGMKGSDYVKAVLKNKLGMTDEEITAGLDAGKTMYDLAKEKGMTEEAFKA
FT                   ALLEEKNKSIDNAVAAGTITTEEGASIKETIKNNMDNCTGIPGERGNSSGSGNGCGKKG
FT                   GNGISCDTRHSSGTRK"
FT   sig_peptide     complement(333063..333143)
FT                   /locus_tag="Clocel_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.858 at
FT                   residue 27"
FT   gene            333374..334066
FT                   /locus_tag="Clocel_0246"
FT   CDS_pept        333374..334066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0246"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ckr:CKR_3213 hypothetical protein; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50030"
FT                   /db_xref="GOA:D9SPI1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL50030.1"
FT                   /translation="MDRNILIADDNFEIIKILKPYIEKENFNVIFAFDGEEALLKFDHY
FT                   NPQLVLLDIMMPLIDGIEVCNRIREKSNTPIIMITAKSEDADKILGLNSGADDYIIKPF
FT                   SPGEVVARIKAVLRRITPVENSTLSVVKYPPMEIDINNYSVKIHGENINLTKKEIEVLW
FT                   MLTSSPNKVIKRDDLLDNIWGIDYFGDPRTVDTHIKRIRAKLALNGQYSWDIKTIWGMG
FT                   YKFEVKDV"
FT   gene            334059..336245
FT                   /locus_tag="Clocel_0247"
FT   CDS_pept        334059..336245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0247"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ckl:CKL_3639 signal transduction histidine
FT                   kinase component; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS domain containing protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50031"
FT                   /db_xref="GOA:D9SPI2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50031.1"
FT                   /translation="MFKKSKLSKELGRNRLDRNFLKKGPKLIQRKKGNRINVLELNKNI
FT                   SLKITFGFLAIVIVSTLFIGIIAINIFKNNIYEIKENNMRKHAQAISETLEPYMKNPQS
FT                   SNGLNEIMHLIYHIDNARIWVLNPNKTIVTASDKSNAITYVNDTEVNEVYKDINERVLL
FT                   GEQGYILAYNPYYEEDMMTIAVPIKNDNKVIGAVVVNSPIYDLINSMDKFFIYIILILG
FT                   IEIIIVGFMGYYFSNSISKPIRKINESALKLARGHYGIKTNIYQKDEIGELSSSFDLLS
FT                   LKLEYTIGKLFEEKNKLSNIIKSISEGLLALDTDMKLIDINEAAIKLLGIDDKDAKQLL
FT                   PISNENYEATEKLSEVNNISDEAVEKVSSINNANDDVAKKSPVINNANNDVDKKLSVIN
FT                   NASDEETEKLSAVKNSSATTKIEEPKEDSTKYHIEIMEIFQQLNLIEALGLKDIQEKKS
FT                   VIKNFKNKILDFSIAPIRKSSNEIIGGVILIQDISEKEKLEQLRKDFISNVSHEFRTPL
FT                   TVIKGNLESIVDGITRPEDVMETCINLIKETNRLERMVKDLLNLSKLESGTLELEVSDL
FT                   DVNLLINDTIRSLRPLIRDKNIAIELSLQEDLSILQSDYYKLKQLLIIFIDNSIKFSSK
FT                   GGVVKVDTYSKDKELYIAIKDNGIGIPQEEIQYLGEKFYKADKARNATVEGTGLGLSIA
FT                   KRLVKVLNGTFKVESQVNQGTRIIISFPISKNSD"
FT   gene            336308..336700
FT                   /locus_tag="Clocel_0248"
FT   CDS_pept        336308..336700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0248"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: ckr:CKR_3215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50032"
FT                   /db_xref="GOA:D9SPI3"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI3"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADL50032.1"
FT                   /translation="MRHGYHMGFGLYGSYILIFLLIAFSVLAVLFFKSKPVANPFTIKL
FT                   IDILKEKYAAGIITADEYIERKMIIEELKFVNPYTPVLLERYAQCLIDTKDFLIIRNIL
FT                   ESKNLDSSISEGLAKGLLPYEDFKDI"
FT   gene            336722..337840
FT                   /locus_tag="Clocel_0249"
FT   CDS_pept        336722..337840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0249"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50033"
FT                   /db_xref="GOA:D9SPI4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI4"
FT                   /inference="similar to AA sequence:KEGG:TherJR_0148"
FT                   /protein_id="ADL50033.1"
FT                   /translation="MKNNKILKNLRYVLLGIFLIHITVETYLHQVLGGGEAPSIHALCP
FT                   YGALESLYQVMFSGTFVEKIFSGTLIILVISVAIALIFRRSFCGLICPFGALQEFFGII
FT                   GKKIFKKRFVVPEKIDKPMRYLKYVVLAVTLYFAWKTAGLWVNPYDPWAAYGHISEGIS
FT                   ALFEEYLIGFIILIAILIGSLLYDRFFCKYLCPMGSFYGLISKLSLGKIVRNENSCVNC
FT                   NLCSKSCPMNIKVSKAKEIKSAECISCQSCVLSCPKKGTLEYKVKNKSVKPAIVILLVL
FT                   LIFFGAIGATKVIGMYQVTPSKITSETKLTPEEIKGYMTLEEIATGLKLDLNQVYEKLD
FT                   LPNSVPKDTKLKEIKDIIPDFEVEEAKEKLKK"
FT   gene            338048..338362
FT                   /locus_tag="Clocel_0250"
FT   CDS_pept        338048..338362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0848 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50034"
FT                   /db_xref="GOA:D9SPI5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI5"
FT                   /inference="similar to AA sequence:KEGG:Fjoh_0848"
FT                   /protein_id="ADL50034.1"
FT                   /translation="MKKRKYIYLLITILIISVAILAPRITYRIDSNLVNQDKKPIFVVK
FT                   KDLYKDGGTTDYRGLGYQVIAWNRITANGTESGYEIYKSPNFRDVNDGPTKELKIVTDK
FT                   "
FT   sig_peptide     338048..338113
FT                   /locus_tag="Clocel_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.632) with cleavage site probability 0.555 at
FT                   residue 22"
FT   gene            338542..338901
FT                   /locus_tag="Clocel_0251"
FT   CDS_pept        338542..338901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0251"
FT                   /product="C_GCAxxG_C_C family protein"
FT                   /note="KEGG: ckl:CKL_3647 hypothetical protein; TIGRFAM:
FT                   C_GCAxxG_C_C family protein; PFAM: C_GCAxxG_C_C family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50035"
FT                   /db_xref="GOA:D9SPI6"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI6"
FT                   /inference="protein motif:TFAM:TIGR01909"
FT                   /protein_id="ADL50035.1"
FT                   /translation="MSNAVEFYKQGYNCSESILMAVNEEKNLNLPVAMASAFGGGMGVA
FT                   STCGAITGALMALGAVKGRETAEEKNIARVSAKEFMNKVNEKYGTYECKELKRKGVSCP
FT                   EIIEYAHEVMKEYIK"
FT   gene            339250..340077
FT                   /locus_tag="Clocel_0252"
FT   CDS_pept        339250..340077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0252"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: cbe:Cbei_3257
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50036"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI7"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADL50036.1"
FT                   /translation="MEKNKSKQMMDSKLFKEAIEGIKDAVQGEREDELFYDYLLNEAED
FT                   DEEKDIISDIRDDERRHNRIYKIIYEDLTGREVSKGDEESFKRPKSYLDGIKRALLGEL
FT                   RAVEKYRDIRRKLPRGQYIDVLTDIITDELKHASKYNLLYTINMNKNMNNNMDKNNNKN
FT                   GSMNNNMNGNMNENMSNLYNDLYENASRAMQDTSKFTPDEWVKYIMPVVENAMTNMKED
FT                   TNNEHLYQVLVLSGVLIGLGMKPEDAINKVQDWEKTGESELLVASKMSRYFFQ"
FT   gene            340479..340703
FT                   /locus_tag="Clocel_0253"
FT   CDS_pept        340479..340703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50037"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI8"
FT                   /inference="similar to AA sequence:KEGG:CKL_0611"
FT                   /protein_id="ADL50037.1"
FT                   /translation="MSFFSSSSGRGHYGGMHQGRGYYRREGLFMKLLRLLGVLSSSARG
FT                   HNRIHSHSSYHNNHFNHGYHRRRHKSSWS"
FT   gene            340694..341437
FT                   /locus_tag="Clocel_0254"
FT   CDS_pept        340694..341437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0254"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: ckr:CKR_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50038"
FT                   /db_xref="GOA:D9SPI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADL50038.1"
FT                   /translation="MVMIDFFKKKIYPPGFLLGGYKILSTIGEGRFGICYLAELDDKQY
FT                   VLKVIKPNAIKKSGNKLIFEERILSSIDNPAIPKILEVIKTDEIHVYVLEYKKGRTLEE
FT                   MIFDDGHVFSRCEIYKVGIALINIIKYLHERNIVHRDIRVPNVVIDEDEVYLIDFGLAR
FT                   LVDNDRYIPNIDFRCLGHLLIHLYYSSFDGTNKKSGPWYEELELSQKELIFLKKLLGLK
FT                   RKYMSIDDVEHDFEKIFPREDIVSK"
FT   gene            complement(341687..342895)
FT                   /locus_tag="Clocel_0255"
FT   CDS_pept        complement(341687..342895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0255"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cpy:Cphy_2115 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50039"
FT                   /db_xref="GOA:D9SPJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL50039.1"
FT                   /translation="MVLTILLIIIYLAFISLGLPDSLLGSAWPSMYPNMGVPISYAGIV
FT                   SMVIAGGTIVSSLFSDKVIRKLGTGVVTSISVFMTAAALLGFSVSTEFYQLCLFAIPLG
FT                   LGAGSVDAALNNFVALNYKAKHMSWLHCFWGVGAMTGPIIMSYCLERGAIFQLGYRTVA
FT                   IIQFSLVIILIATLSFWKKAVPTTNLQGDKKNPNEKEVEHKIISKRELLKLPGAKHALL
FT                   AFFCYCAIESTTGLWGSSFAVMSHGLQAETAAKWASLFYFGITFGRFLSGFITLRLNNR
FT                   QMVRLGEALIAVGIIMIMLPLGQVASLIGFIITGIGCAPIYPSLLHETPANFGAEYSQS
FT                   IMGVQMACAYVGTTFMPPLFGILASYTGYSLLPFYTGGILLLMFIMIETLNKRVDAKNK
FT                   IKS"
FT   gene            complement(343042..343911)
FT                   /locus_tag="Clocel_0256"
FT   CDS_pept        complement(343042..343911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0256"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: lmc:Lm4b_02671 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50040"
FT                   /db_xref="GOA:D9SPJ1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ1"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ADL50040.1"
FT                   /translation="MNIFSKLNKLTNLTENEKTLVSYMQDNPEGFVKMSALEISDACFI
FT                   STSTIYRLCQKLDLSGLSELKVQISLSINEYLKEQSSLDYNYPIKQNETQHQIVLKLKE
FT                   LYEQTLVSSLNLIDLEQLRLIANVLKNAQHIDFYTSAGNMYFVENFKFQMQEIGTFINV
FT                   PIEEYHQLLTASTSDENHIAIVVSFEGRGVIIKRIADMLKVNKTPIILISSTNENPLTK
FT                   YANYHLYLSSNENHFNKISSFSTRLSLLYVLDCLYTCYFNLNYDKNVSYKLNAYKKLSG
FT                   NFNKTPET"
FT   gene            complement(343991..344380)
FT                   /locus_tag="Clocel_0257"
FT   CDS_pept        complement(343991..344380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0257"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cbe:Cbei_3437
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50041"
FT                   /db_xref="GOA:D9SPJ2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADL50041.1"
FT                   /translation="MKIEHVAIWSKDIERLKRFYVDYFDGSAGDKYTNLSKNFESYFIN
FT                   FQSGARLEIMQMPSIPFNLNNTIDQYIGLIHIAISVGSIEKVNKLTDTLRNAGCKVVSE
FT                   PRRTGDGYYESCILDPDGNRIEITE"
FT   gene            complement(344409..345248)
FT                   /locus_tag="Clocel_0258"
FT   CDS_pept        complement(344409..345248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0258"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: cac:CA_P0070 HAD phosphatase superfamily
FT                   protein; TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50042"
FT                   /db_xref="GOA:D9SPJ3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ3"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADL50042.1"
FT                   /translation="MNNIKVIIMDVDGTLTNSKKVITEKTKNALIKAQEAGAILILASG
FT                   RPTSGLMDFARELEMDKNHGLLVSFNGSKVVDCETNKVLFNEAMRIDQGQAVLEHLKKF
FT                   DVKPMIDKNDYMFVNNVFNNKINHDGKTINIIEYEARGGKFKLCEKDDLAAFADYPLNK
FT                   ILTAGDPEYLQEHYKEMMEPFKDTLNCVFTAPFYFEFTAQGIDKAKALDTVLIPMGYKK
FT                   EEMIAFGDGHNDISMVNYAGIGVAMGNAVDELKNVADEVTLSNEEDGIAYTLSKHIK"
FT   gene            345602..345922
FT                   /locus_tag="Clocel_0259"
FT   CDS_pept        345602..345922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0259"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: cbe:Cbei_1451 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50043"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ4"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL50043.1"
FT                   /translation="MLGFLKKNDGKAINVNDIDNLIGKVELIDIREEYEYKGGSIKGSK
FT                   NIPMGELLGDPDKYLDKNKEYYIMCQSGGRSSKTCNVLSKQGYDVVNVSGGMGSYAGTK
FT                   RE"
FT   gene            345900..346025
FT                   /locus_tag="Clocel_0260"
FT   CDS_pept        345900..346025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50044"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL50044.1"
FT                   /translation="MQVQSENNYFYGILKLDSVIDTILKGFKNREAIDISNVMSR"
FT   gene            complement(346006..346452)
FT                   /locus_tag="Clocel_0261"
FT   CDS_pept        complement(346006..346452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0261"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: ckr:CKR_3234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50045"
FT                   /db_xref="GOA:D9SPJ6"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ6"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADL50045.1"
FT                   /translation="MKNIEYILEKGGFSFEIIHNDKHIYTAKEGAEYFNVHIAQIAPTL
FT                   ILYTAVGFYVLVISGERGHVNFKELKQLLNCKNVRLANKDEVKSVTGFSVGNVPMLGIE
FT                   LPYIVDEKLLEFPFVYGGLGEENTTLKIDPNALLKLNNVIGTLH"
FT   gene            346822..347331
FT                   /locus_tag="Clocel_0262"
FT   CDS_pept        346822..347331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0262"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   bce:BC3034 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50046"
FT                   /db_xref="GOA:D9SPJ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ7"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADL50046.1"
FT                   /translation="MRLSDYDYLALAFEEANQAFEEGTYPIGAVIVDDDGNIVSKGRNR
FT                   VFTESDCTAHAEVDAIRKAGHKLLDIPNKRFVKNNLTLYTTCEPCPMCTCTILLSGIKR
FT                   VVWAADDDEYGGIRKFKEGPHFINLFDTITYTASPYDDLENKQRDLLARWNIGRGILNT
FT                   EWEKPK"
FT   gene            347483..347989
FT                   /locus_tag="Clocel_0263"
FT   CDS_pept        347483..347989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0263"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ctc:CTC00069 NADH
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50047"
FT                   /db_xref="GOA:D9SPJ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL50047.1"
FT                   /translation="MKFIYCPICGEKLSEKNIGDEGLVRYCFTCNRPYFDSPSSCVEVL
FT                   ILNEHNQILLLKQNYISKTHWGVVSGYVNNGETLEETVIREVLEETGQEVEKMQYVESY
FT                   YFRPNELIMAGFIAFVKAKPFNNSNEVDDIMWCEIDEVNKYIARVNNMSGIHFDNSMKL
FT                   LKSLR"
FT   gene            348099..348341
FT                   /pseudo
FT                   /locus_tag="Clocel_0264"
FT   gene            348354..348521
FT                   /pseudo
FT                   /locus_tag="Clocel_0265"
FT   gene            complement(348699..349301)
FT                   /locus_tag="Clocel_0266"
FT   CDS_pept        complement(348699..349301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0266"
FT                   /product="galactoside O-acetyltransferase"
FT                   /note="manually curated; KEGG: pjd:Pjdr2_4506 galactoside
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50048"
FT                   /db_xref="GOA:D9SPJ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ9"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_4506"
FT                   /protein_id="ADL50048.1"
FT                   /translation="MRTIETYEKMHSGKIYDCTNEELMNLQTKCLDRLYDFNATRPTEY
FT                   EKRIKMLKEMFAEFGDGCYIEPPLHSNWGGKHVHFGNNVYANFNLTLVDDTHIYVGDYT
FT                   MFGPNVIVATAAHPITPEMRMPVTQFNKSVYIGKNCWLGAGTIVLPGVTIGDNTVIGAG
FT                   SVVTKDIPANVVAVGNPCRVLRAINDDDWKHGQELLK"
FT   gene            complement(349382..349885)
FT                   /locus_tag="Clocel_0267"
FT   CDS_pept        complement(349382..349885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0267"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: cpy:Cphy_2576 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50049"
FT                   /db_xref="GOA:D9SPK0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK0"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2576"
FT                   /protein_id="ADL50049.1"
FT                   /translation="MTIELKKVNIEDKEILRNLLEKYDYEFSQWDNRDVNKLGLYGYNY
FT                   LDCYWTEEKRWAFFIVVDGNLAGFVMINDYPEVDEVTDYSLAEFFVMYKYRRSGVGRFA
FT                   AMKVFDMFHGKWQLKRHPKNIASVHFWNKVVSEYTKSNYKLIESYPNSVYNDGTLGDII
FT                   LFTS"
FT   gene            350430..351125
FT                   /locus_tag="Clocel_0268"
FT   CDS_pept        350430..351125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0268"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cbe:Cbei_2622
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50050"
FT                   /db_xref="GOA:D9SPK1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50050.1"
FT                   /translation="MDYKNIAPWELLQKKMTWEHLNYIHNKRILDFGSGSGMTANHFAI
FT                   DNEVIAIEPDEKVLQDRFKENNYTQIKGDMNRLKNFQDESFDMILCHNVFEYVDEREEI
FT                   LEEFSRILKKDGFLSIVKHNKAGRVMQMVVLLNNFEHANELLAGKNGHAQQFGTINYYK
FT                   DKEILEWSNKFEIEKILGMRTFWDLQQNQEIQKDETWQENMLEIELKVSELEEYKAIAF
FT                   FHHIILRKR"
FT   gene            351240..351809
FT                   /locus_tag="Clocel_0269"
FT   CDS_pept        351240..351809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0269"
FT                   /product="cytochrome b5"
FT                   /note="PFAM: cytochrome b5; KEGG: cbk:CLL_A1979 HypQ3"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50051"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK2"
FT                   /inference="protein motif:PFAM:PF00173"
FT                   /protein_id="ADL50051.1"
FT                   /translation="MAFYIDARAVNELMRSKNYREEKNFTLEELAQYDGSNGKSAYVAI
FT                   KGIVYDVTKEPTWEGAEHFNIKAGKDLTKQFDSCHGEIELLHDVPKVGVLIESDNEKGS
FT                   RNIPEPTYAFSPDDWIRYLTPLVNQALEEANVEPNTEHVLQKYIMAGVFVGQGRSIEDA
FT                   IKLVSEWEDTGLSKLLEQSKTKQRLM"
FT   gene            351938..352231
FT                   /locus_tag="Clocel_0270"
FT   CDS_pept        351938..352231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:EHI_165230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50052"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK3"
FT                   /inference="similar to AA sequence:KEGG:EHI_165230"
FT                   /protein_id="ADL50052.1"
FT                   /translation="MDKYEESKRVEEREKEIKEIEDDLKIIKYYCNKLEKMCKCYRCFL
FT                   TDLNNNAMPNYTDRMRKIKKTEEAHGIDNIFKSLFQVLRHNEENVEELKKHL"
FT   gene            352926..354857
FT                   /locus_tag="Clocel_0271"
FT   CDS_pept        352926..354857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0271"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: ctc:CTC00243 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50053"
FT                   /db_xref="GOA:D9SPK4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK4"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADL50053.1"
FT                   /translation="MSNEKTYYITTPIYYPSAKLHIGNTYTTVAADALARYKRLTGYDV
FT                   MFLTGTDEHGQKIQRIAEEKGVTPKDYVDEIVAGIQDLWKLMNISYDKFIRTTDDYHKK
FT                   TVQKIFKQLYDQGDIYKGAYEGWYCTPCESFWTDTQAVDGKCPDCGRPVETAKEEAYFF
FT                   KMSKYADRLIEYIETHPEFIQPESRKNEMLNNFLRPGLQDLCISRTTFTWGIPVEFDPD
FT                   HVVYVWMDALSNYISALGFDSDNDQLYKKYWPCDVHLVGKDIIRFHTIYWPIFLMALGQ
FT                   ELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDAVRYYLLHEIPFGSDGNFNS
FT                   EIFIKKVNSDLANDLGNLLSRTTAMVIKYFDGVIQPPTDKEDIDNELINIALDMPKKVE
FT                   AAINELNLPQALDEIWTLIRRANKYIDETTPWILAKDEDKKARLGTVLYNLIEALRFAS
FT                   VAVSSFLPETGTKIQEQLKVDVATWDSISAFDGTQAGVTLEKGDVIFPRIDVEAKLAEF
FT                   EALKEAEQPKQQMQPLKEEISIEDFEKIDLRVVKVLACEPVKGAKKLLKLKVDLAGEER
FT                   QVISGIAQYYKPEDLIGKYVVLVANLKAAKLRGEISQGMILAASTDDDSKLFTVTIPEE
FT                   LPTGSQVR"
FT   gene            complement(354910..360456)
FT                   /locus_tag="Clocel_0272"
FT   CDS_pept        complement(354910..360456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50054"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK5"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0092"
FT                   /protein_id="ADL50054.1"
FT                   /translation="MSKKVPKSKSKNKASRPYAVFSYAVIASMLAQITYPLAPVYAVEQ
FT                   VATTQDNINLVLSQPKPIDVVLTLGSTNVNAANFQNDLKAKLQAKGVDLNRVQITAIDT
FT                   KQQNLQSSFTWIQNVSSSIGSIAIQNNGTKIQMFGNPTNAGFNKIYTANNNDPELKEQT
FT                   MNFDYTLDFGDSFDGAGVLFNTNVVNGLLSGYAIFFPQSGGGVARIYKLTNWTNTYAED
FT                   ISSNANAQQIGTMNMGTSGSFTLKTTKNALNVYKSGAFLGTIALPQHFGWGLGFFGDHY
FT                   SHGCNRIGEFSLNNISLSQTKSKEFNEIIRQPSWRDDSQRYVVNLADQTINDFDSPTVS
FT                   GEILTRLINENIHFLELGTDANKVQSENFIQRNNGNGAFYYNNNYDVAVTNVADYIVNR
FT                   IQNTDQPQDSPYVLAGTPLNINVSPEQFKTNTANADYPQGRWKLDQDFNYFDNNLGQET
FT                   WSNQWRNDLPTEIDKPGKYELWFGDTHPSPQYIYVHRKPVANFSVGLSKGASSATATVT
FT                   NLSYDPDKQSDADKGIAEVEWKWKETTATTWNEGALPSDLPLGKNYLVQLRVKDYQGTW
FT                   SNETASYIATDTAVVTKPVANFTIPSSTITMYEPLNVQDVSYEPSGRAIVDKTWTITKT
FT                   GTVVYSGATLPANFTGIGSGNFVISLKVKNDAGLWSEAYSRGVTVTVDNLAPEAIITPA
FT                   STPWGTTDVTVTAKFTEPGGSGFSGQRYAISSSPDAPTTGWSDWSTSLDREVTVTDSGK
FT                   IYVHFEAKDNAGNLLKRTVGPIQIDKQTELNAPIIHHDKDSFTIDTNNPNSPSGIKEVL
FT                   YKINDGEWIKAGADNVIPDGTYTISVKVVNNVGLESPVTSEVITFAISYDNSKTALDLA
FT                   MNLLLQLEAKTPQILQTDVYTQATLDQIKSQVVYATDLAPKIVDEAQKLEIEARIKFLN
FT                   NRIAIIQHLITSRDLVATISGDVNSFVIKSQTGTSFDFSLITREKIELINKNIEDAKAS
FT                   LEGLPSCLGKTLLQIQIDVLIDSVTSAGYALDAFEATTKVDGSIVDLSTQEYINIAIAN
FT                   YNAAKDKVSLLPCGQTKLDLLNKLINIRITIEIAQQILDAKNAVANIEGLGLGLNSTQD
FT                   DINLAINLYIEANALVQNLPEGPAKEELKERVTKINIDIDIAKKLLIAKAAISKLEGSL
FT                   PNENSTQIDIDIAVKLYIDAKGLVDLLPEGDAKETLKEKLVSINITIDIAQKILDAKNA
FT                   VVKLEGVLPNENSTQIDIDIAIKLYLETQGLVDALPDGPVKQGLKDKLVSINITIEIAQ
FT                   KILDAKNAIIKVQDVLPNENSTQVDIDIAIKLYLEAQGLVDALPDGPVKQQLSDQLLQI
FT                   KITIDLAQNILNAKNAVAQAEGLILNENTSQADFDIAINIYLQAKGFVDSLPDGDLKEG
FT                   LLSRLVAVKINIDFVQTILNAKNAVIKAEASVPNDYSTQVDIDIAIKLYLEAYDLVDAL
FT                   PDGQVKQDLLNKLIQIKITIDLSQTALNARNQVVKAETAANSISVQVDVELAIKELDTA
FT                   KALVDALPDGNLKIELKLKIEAIQARIYEGQADVYVKIAETASVSLPTYDAITIAQKAK
FT                   DFAEVYIKESVGNATAATALNDRLLQVQIKINIAIATLKTNQASKTLDLADVDIAQKAI
FT                   DILPDGNEKTAIQIRLNLIISIINSTGDVDNLRKMLVDLQNGLKGVDLNLILLFSNRDK
FT                   LNDLYSKSDALINAYLKIAPSIYTLGANDPTLSCAEKIKLGELKSSLSEISGLSRSIRI
FT                   ILDDSTGRSKVDDGNVHSVFKFMLGSRSVDLATNFNNTLLLDLDRTDNIQWVSLHGAVA
FT                   SVNDAGVVTRKSMGIAKIAAYNDHGVYYFNLAL"
FT   gene            complement(361231..361710)
FT                   /locus_tag="Clocel_0273"
FT   CDS_pept        complement(361231..361710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50055"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK6"
FT                   /inference="similar to AA sequence:KEGG:Abu_0624"
FT                   /protein_id="ADL50055.1"
FT                   /translation="MKKRLILLSALIIVIMSTALILSRPKGLTSKESLVKRVMEIQLTI
FT                   GEVTDNEASELRKNIILTSEKLDPSCIPGLEALGITILSPSEIEQKTKEEGNFKFLVFN
FT                   DITIDEKEAIITLNTIYTRQEDKKIVYKDFSGLTIRFHKYFGRWFEDPSREIYCI"
FT   sig_peptide     complement(361651..361710)
FT                   /locus_tag="Clocel_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.456 at
FT                   residue 20"
FT   gene            complement(362081..362407)
FT                   /locus_tag="Clocel_0274"
FT   CDS_pept        complement(362081..362407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_0897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50056"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK7"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0897"
FT                   /protein_id="ADL50056.1"
FT                   /translation="MLKKIIVTFLISLCLMFQNQPISVMAQTSTLREGFYRVSNLNLNP
FT                   GKSYNIENVSFSSRVVVFILDDNQIIQQVLRLIPQSGKFNIIPMEYVYRVVILGDGEVR
FT                   ITEI"
FT   sig_peptide     complement(362327..362407)
FT                   /locus_tag="Clocel_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            complement(362461..362778)
FT                   /locus_tag="Clocel_0275"
FT   CDS_pept        complement(362461..362778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_1965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK8"
FT                   /inference="similar to AA sequence:KEGG:CLH_1965"
FT                   /protein_id="ADL50057.1"
FT                   /translation="MKKFILKFFFVLCLIFSCFSVSTMAQVPDLTEGLHKADNFNLSKD
FT                   KPHYIQNTSPDSSAYVLILDGNENLQQTIRLKPQSAKYKLVPLEPGARIVIFGNGIVSI
FT                   T"
FT   sig_peptide     complement(362701..362778)
FT                   /locus_tag="Clocel_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            363198..364205
FT                   /locus_tag="Clocel_0276"
FT   CDS_pept        363198..364205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0276"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   cpy:Cphy_3200 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50058"
FT                   /db_xref="GOA:D9SPK9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK9"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADL50058.1"
FT                   /translation="MDNLFPVEVSVVSSNELCDYITQEYFPNELIKCRLFYRGVHDIYK
FT                   VIVGNKEFYFKVYRQGIRTMEEIQTEINLLNKLKVSGIEVAFPVGNCDGKSILQFNTVN
FT                   GTRYGVLYTAVGIDEFDSIEETSKLNEKLGSYIASIHNAWDKCDPEICKRNLDQHLFID
FT                   NSMEAIRQFSNVHNFDIDFLEDVAKNLKKKLAALTTERPQYGICHGDIYSGNIRLDANN
FT                   NPILFDFDFCGNGWRAYDISMYAFPFSMGSDVSTLKKREQRKIEFLNGYNKVRAMNESE
FT                   VNSIAIFIPFRRIFNIGTLYISFLQNTWGDCAVIRNVDEDIIMLKKWLELNPIF"
FT   gene            complement(364632..364814)
FT                   /locus_tag="Clocel_0277"
FT   CDS_pept        complement(364632..364814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL0"
FT                   /inference="similar to AA sequence:KEGG:Clos_1998"
FT                   /protein_id="ADL50059.1"
FT                   /translation="MGYVKAETILPNNLIKELQKYIQGEYVYIPAQSDTRKKWGEKSGN
FT                   RTYIQIGIKILSENI"
FT   gene            complement(365108..365557)
FT                   /pseudo
FT                   /locus_tag="Clocel_0278"
FT   gene            365683..366204
FT                   /locus_tag="Clocel_0279"
FT   CDS_pept        365683..366204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0279"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbi:CLJ_B0622 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50060"
FT                   /db_xref="GOA:D9SPL1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50060.1"
FT                   /translation="MRSIELIAPKEEFQEQILQYKKEFEVNGDSMDGTNFLQGYSDLAE
FT                   WFSLVRDNSKEETVREGLVPADTYLAIRVADQKLLGMINIRHRLNDYLFQVGGHIVYSV
FT                   RKSERRKGYAKDMLRLSLERCRELNISKVLVTCDKENIASARTIMANNGVLENEVPEED
FT                   RITQRYWITL"
FT   gene            366350..366880
FT                   /locus_tag="Clocel_0280"
FT   CDS_pept        366350..366880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50061"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL2"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_2708"
FT                   /protein_id="ADL50061.1"
FT                   /translation="MLKRCIMIFPKFENGQVIDKIREKYDPLVTHVRPHITLVFPFDSN
FT                   IKTNELKNHISLVLSEVETFEVILKGITPVSSFGKYLFLNIEKGTEEIIQLHKKLYTGI
FT                   LEEHFPEWLKGNNFLPHMTVGSFQKEEEFQMAAEETKAVVDAFRTIVTAVSVEIIDENE
FT                   DSIIELEIPLKAI"
FT   gene            complement(367073..367834)
FT                   /locus_tag="Clocel_0281"
FT   CDS_pept        complement(367073..367834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0281"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ftw:FTW_1051
FT                   UbiE/COQ5 family methlytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50062"
FT                   /db_xref="GOA:D9SPL3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50062.1"
FT                   /translation="MKNQEKFDMTKSRFENLFEEKLSYERQTRDDDHLSKIINALKFQN
FT                   SDKLMDLGTGTGYIAFTLAKENPNLQIVGLDIVTNALKANTEKAVKEQLDNITFVEYNG
FT                   MNIPFQDNTFDCIVTRYAMHHFTEIEKSFKEIYRVLKPGGQLFISDPTPNERDENRFVD
FT                   DFMKLSKDDGHIQFYKKEELETMASTAGFKIDDYFMTEIRFPSSSRTEGYRKIEHELPI
FT                   SIKESYDIEIINEEVYITEKVLNISFLKPLA"
FT   gene            complement(367871..368401)
FT                   /locus_tag="Clocel_0282"
FT   CDS_pept        complement(367871..368401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0282"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oih:OB0922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50063"
FT                   /db_xref="GOA:D9SPL4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50063.1"
FT                   /translation="MLFKNIETERLLLRNIDIEDRDFIFSMFSDDTVNRYLFDADPLTK
FT                   IKEADEIIEFYMKPEPRLQHRWIIIRKSDGVKMGTCGFHFWQKDSNKVEISCDLKEEFE
FT                   TNGYMQEAFKEIISFAKTDMLIKEITASIYVANERAIKLIESLGFVLSDSRYEVFRKNK
FT                   YLHKIYSLNLEVS"
FT   gene            complement(368444..369298)
FT                   /locus_tag="Clocel_0283"
FT   CDS_pept        complement(368444..369298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0283"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /note="KEGG: aco:Amico_1700 2,3-dimethylmalate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50064"
FT                   /db_xref="GOA:D9SPL5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL5"
FT                   /inference="similar to AA sequence:KEGG:Amico_1700"
FT                   /protein_id="ADL50064.1"
FT                   /translation="MSKDSILKKLLNSKNTLIMPDAFDPISAKIIEYAGFSAIQCSGYS
FT                   YSISKGYKSEEDIDLNTNLKLTKEIVDSVNIPVMADGEDGYGEGDEFENTIRKFIDIGV
FT                   SGINIEDQVHNLVNSPLKIIDEYSMLAKIKAANKTKNSLGKNDFILNARTDALRSMDNR
FT                   KEAQKLAIERANSYLEAGADLCFITYTQTLEEVKLFSKEINGPISIAAGLPYNIQEFSI
FT                   NDCINLGIARVSLPTFMILNSIDSMVKTLIDVKNTGSFDGTIRDNTLLSDGAILNNIIY
FT                   NKF"
FT   gene            complement(369517..370395)
FT                   /locus_tag="Clocel_0284"
FT   CDS_pept        complement(369517..370395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_2294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50065"
FT                   /db_xref="GOA:D9SPL6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL6"
FT                   /inference="similar to AA sequence:KEGG:CKR_2294"
FT                   /protein_id="ADL50065.1"
FT                   /translation="MERKLKRIDMLITCIIILLIIITLVGACSFQIDKSYMVTNQYGDA
FT                   VKIFGSGIYAHDSYFKAPIFIGTDYTMLFVAVPILIVALFKDIKKRSIKSKLFLISIVG
FT                   LVLYYSTSIAFGVTYNALHLLYIALFSTSLFTTILLVKNINTKELRRIQKLTLPSKGLT
FT                   IFLTLSGLALFVAWLPDIITSLLNEKSLSLIEVYTTEITYVVDMGIMSPLIFICLYLLK
FT                   KKDGLGDIILAFVLRICEIMGIMLPVQSLFQALAGIELPIPALITKVGIFIILAIFSIY
FT                   FNIKLYKNIEE"
FT   sig_peptide     complement(370312..370395)
FT                   /locus_tag="Clocel_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.568 at
FT                   residue 28"
FT   gene            complement(370434..370934)
FT                   /locus_tag="Clocel_0285"
FT   CDS_pept        complement(370434..370934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0285"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cac:CAC2561 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50066"
FT                   /db_xref="GOA:D9SPL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50066.1"
FT                   /translation="MLRLRPYKLSDYKYILNWINDEIVFAQWCANKFTYPLTKEQMTNY
FT                   YHNCEKRDDAWMMTALNEDGVPIGHLLMRSANYENETIHLSFVIVDSSIRGQGYGKEMI
FT                   SLVIKYAFDILKVKKVTLGVFDNNPSAHACYKSVGFIDENYHLSAFFYKNQKWGVHDMA
FT                   ICK"
FT   gene            complement(370982..371677)
FT                   /locus_tag="Clocel_0286"
FT   CDS_pept        complement(370982..371677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0286"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: cbe:Cbei_2693 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50067"
FT                   /db_xref="GOA:D9SPL8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADL50067.1"
FT                   /translation="MIFFDLDGTLIDHKQAEILGVHGFLHEYKEYFNFKEDLFYEHWCK
FT                   ISNKHFARFLNRDISFLQQQIERIKDVFILSGIKLSDNEAAKKFKVYLELYEENLMPYD
FT                   DVLPCLNSLKDKRLGIISNGALKQQLLKLSKIGNEICFDPIIVAEEVGVAKPNIDIFRI
FT                   ACIKANVQAKDCIYVGDDFKTDILSCSTADMNGIWLNRYNQESINSTTKMIQDLRMLKN
FT                   YLQINSIEL"
FT   gene            complement(371698..372378)
FT                   /locus_tag="Clocel_0287"
FT   CDS_pept        complement(371698..372378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0287"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; KEGG: mba:Mbar_A3426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50068"
FT                   /db_xref="GOA:D9SPL9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL9"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADL50068.1"
FT                   /translation="MKYLLWDFDNTLAYRDGMWSSTIHNLLLDYGYTNFKLEDVRPYLK
FT                   TGFPWNFPELSHEEFFNGKQWWEHMSSHFCNILREIGIEADVAKSISDNIREKYLTPDK
FT                   WYLYDDTISCLKISLERGYSNIVISNHVPELQELINALGISDYFIKVYSSAHVGFEKPN
FT                   KKIYETAIMSLEDPESITMIGDNYFADVQGAKKAGIDAILVRKPNDYNYDKYFTTLKEL
FT                   ADFI"
FT   gene            372608..372943
FT                   /locus_tag="Clocel_0288"
FT   CDS_pept        372608..372943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50069"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM0"
FT                   /inference="similar to AA sequence:KEGG:CLL_A2701"
FT                   /protein_id="ADL50069.1"
FT                   /translation="MSGIKAKKFIIFIIICMLAFTEMTKAIPVSNVFKQGLYIVSEDDQ
FT                   FTGNASLVKADNTTVLTIIDPNGVLKFYKKFDFLNETVNLGIIGYQDAIILVGKGEVYI
FT                   DFEYVNY"
FT   sig_peptide     372608..372688
FT                   /locus_tag="Clocel_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.364 at
FT                   residue 27"
FT   gene            373135..373617
FT                   /locus_tag="Clocel_0289"
FT   CDS_pept        373135..373617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0289"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50070"
FT                   /db_xref="GOA:D9SPM1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL50070.1"
FT                   /translation="MLEMIIGVRVFILDESERILLVKHSYESEEFWVIPGGGVEAGELT
FT                   RDSGIREVKEETGLDVEIVRLLWTVEEISDKGMSYVNYFLGKIVGGKLALGGDPELSID
FT                   KQVLSDIDFFSREEVKELPVVYPEVLLGGFWDLLEEGTFNQNVWRQRPSVGFGIKE"
FT   gene            complement(373658..374479)
FT                   /locus_tag="Clocel_0290"
FT   CDS_pept        complement(373658..374479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_2520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50071"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM2"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_2520"
FT                   /protein_id="ADL50071.1"
FT                   /translation="MTYIPEEAKEIINNNIESLEAVLPDFLESYHIYGSISLGAFNTKE
FT                   SDIDFIAITKRKAMEKDIDILKNLHINIKKKFPKKSLDGMYLFKDDIEALNKKDSPCLR
FT                   FNDGNFEGIVPFLRDSIDAFQLKKYGINIKGQSAKSLDYSVNFNILINNMYENLNTYWL
FT                   NWMNKCKKFPSMDYINLLVNLKEIEWGVLGVSRLYYTFLEKDMTSKVGAGEYALKVFPQ
FT                   RWHKIINESMRLRKGVKTSYYSSLLQRRNDAIAYMDFVIGESNKGLSQNRK"
FT   gene            complement(374520..375920)
FT                   /locus_tag="Clocel_0291"
FT   CDS_pept        complement(374520..375920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eel:EUBELI_01889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50072"
FT                   /db_xref="GOA:D9SPM3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM3"
FT                   /inference="similar to AA sequence:KEGG:EUBELI_01889"
FT                   /protein_id="ADL50072.1"
FT                   /translation="MDGSMIFISIFSIVIFSIFYAIGSYINALSNKGIFFGVRMPLGYE
FT                   KHENLLALKKDYTKRFNISFLIFVLVYAITIFLFKDYVFSTFFIAIFALLLLIHNNFYT
FT                   IHKKVRQIKKEEVWKFESRKVVVVDLKGRKNTSENKTLSKGLYFILAAIVLVSFIIAFR
FT                   EDIIFLAIAQIVTTLVMLLAIYAINNTKQQLNGGEANELIEKNKRYKYYISLLMYIASL
FT                   AVTLSFFFVILASADFISSPVIFISIIATTFIPMIIIVIGALLIGQGGKNLSVNSVNDE
FT                   DKLIIDRDDDENYVLGCFYYNKNDPAVFVPKRIGIGTDLNYAKPGSKIFIGIVLAILIG
FT                   SLISTFSLSHLVSTGVKEKSITIEANELSIEGMYGIKIPYESIYSIEMMETFPQDMTRK
FT                   NGLAINHTLIGKFKSKAYDNCNLYIMDSRKPNLFIYTKEEKRIFINYENPDRTRELYDK
FT                   IIEKIHNN"
FT   gene            complement(375922..376305)
FT                   /locus_tag="Clocel_0292"
FT   CDS_pept        complement(375922..376305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0292"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cac:CAC0599 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50073"
FT                   /db_xref="GOA:D9SPM4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM4"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL50073.1"
FT                   /translation="MLIEINFESDIPIYTQLRNEILRGIASGKLAEGEILPSVRQLASD
FT                   IGINMHTVNKAYNILKQEGFLTIDRRKGAVINTKNLRYKKETLINMEKELNPIIAEGIC
FT                   CDISKNDFIEMINKIYDDYKVEE"
FT   gene            complement(376576..377187)
FT                   /locus_tag="Clocel_0293"
FT   CDS_pept        complement(376576..377187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0293"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: cac:CAC2827
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50074"
FT                   /db_xref="GOA:D9SPM5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM5"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADL50074.1"
FT                   /translation="MSFDQRAKTWDNDRRIKLAKIIATEIGNSLATNKELSAMEFGCGT
FT                   GLISFNLYDKFKKITLIDSSKGMIDVLNAKIDEYKVSNMESLHLDITDENSLDIKFDVI
FT                   YTSMVLHHIENTSSIINTFYKLLNEDGYLCIVDLDEEDGSFHKGHDDFHGHNGFNQEKL
FT                   KDILIDAGFKAVESKTFYHGEKIVEDEKIDYSLFLMKSRK"
FT   gene            377502..378578
FT                   /locus_tag="Clocel_0294"
FT   CDS_pept        377502..378578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0294"
FT                   /product="D-galactose-binding periplasmic protein
FT                   precursor"
FT                   /note="KEGG: cbe:Cbei_0939 D-galactose-binding periplasmic
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50075"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM6"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0939"
FT                   /protein_id="ADL50075.1"
FT                   /translation="MKILRRIVAIVMVLIMATFISSGSIYATVNINLQKPVRVAALFFE
FT                   FNDPNLALVRKNLEDIQDKNKDKVEFTFYNAENNEAIQDATISKVIRERTADLLMVNLV
FT                   NKSAESVKKLIDEAKRYGIPVVLFNYLQPETVDIIKSYNKAFAIGLDERQAGILQGQII
FT                   VDMWNSNKAKIDKNKDNTLQYIMLQASNEAVPLIRTNSAIETINNAGIKTKQLALVNAK
FT                   WDKELAREAISALFLRYANLIEAIISNNDAMAIGAIEALQKYGYNTGNSSRNILVVGID
FT                   AIPEARELVNKGVMTGTIIQEPRNTAEALYDIGMNLVTKGSHINNTNYKLAENGVEVLL
FT                   PFEIYKKKQGTLNEPNKQ"
FT   sig_peptide     377502..377585
FT                   /locus_tag="Clocel_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.970 at
FT                   residue 28"
FT   gene            378689..379567
FT                   /locus_tag="Clocel_0295"
FT   CDS_pept        378689..379567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0295"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cbe:Cbei_2362 helix-turn-helix
FT                   domain-containing protein; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50076"
FT                   /db_xref="GOA:D9SPM7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM7"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50076.1"
FT                   /translation="MRFFLSNASSTLSNLSCGNLISKQAFLHHRRNFDMYVLIMVIEGT
FT                   LYMSQNGERFELGPKQYIFLKAGEEHYGYKPSDGKLSYLWVHFKMNNHVTVVSKETFFN
FT                   GMLENIISDKNNSFYIMPESGEISLTQRAPLLFNQLLDITRQEMIYSNQIIDYALSLLV
FT                   MEISQEFIEVYYKIKQNIPPNIARIMEWIKANYYKPITISDIAYEFGYNADYLSSLFRK
FT                   TSGSTLINFINKTRIDISKSLITNYDISIKEAAYSCGFTDEKYFLKTFKKFEAMTPSQY
FT                   KKAFTRKMINL"
FT   gene            379725..381548
FT                   /locus_tag="Clocel_0296"
FT   CDS_pept        379725..381548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0296"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   pjd:Pjdr2_1987 protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50077"
FT                   /db_xref="GOA:D9SPM8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM8"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ADL50077.1"
FT                   /translation="MLKPINTKNIKLLPSIFKERYDLNRNYLINVKNQGLLQNFYLEAG
FT                   IILPGLQVLHNPDTDEIHWGWDAPTCQLRGHFLGHWLSAAASIFVSEQDHELKAKLDKI
FT                   IDELIKCQELNGGEWIGPIPEKYFQKLENSHHVWSPQYVMHKVLMGLMNSYIDTNSDKA
FT                   LAILDKLSNWYIKWTDDMLIKNPRAIYGGEEAGMLEVWITMYEITAEEKYLELAKKYSN
FT                   PRIFRDLEAGRDTLTNCHANASIPWSHGAAKLYEVTGDEKWRKITEAFWKNAVTDRGYY
FT                   CSGGQGAGEYWTPPFKLGLFLSDSNQEFCTVYNMIRTASYLYKWTGDTSFADYIELNLY
FT                   NGFLAQQNKYTGMPTYFLPLGAGSKKKWGTETRDFWCCHGTMVQAQTLYNSLIYFEDKE
FT                   RLVVSQYIPSELKWNYNNTDITIQQRVNMKYYNDLAFFDERDESQMSRWSLKFQVAAEK
FT                   NESFTLSFRVPKWVKELPSVTINNEKIDDLTVDEGYINIKREWSQDEVLIYFPCRLEIS
FT                   PLPDMPDTFAFMEGPIVLAGICDEERRLYGDADKPSEILMPQYQHTYGVFPWKQGIYKT
FT                   INQPENITFMPLYEITEERYTVYFNRDKSLL"
FT   gene            complement(381877..382308)
FT                   /locus_tag="Clocel_0297"
FT   CDS_pept        complement(381877..382308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0297"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ere:EUBREC_1609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50078"
FT                   /db_xref="GOA:D9SPM9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50078.1"
FT                   /translation="MEIKLMSIEDYHKVHELWTNTQGMGMRSLDDSFEGIKKFLKRNPN
FT                   TNFIAKEGDKIVGVLLCGHDGRRAYIYHTAVNVDYRNKGIGKSLVNAVLDALRKEEITK
FT                   VALVAFAENTVGNKFWESVGFINRYDLIYRNFSINTNNT"
FT   gene            382639..383175
FT                   /locus_tag="Clocel_0298"
FT   CDS_pept        382639..383175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0298"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cpy:Cphy_3192 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50079"
FT                   /db_xref="GOA:D9SPN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50079.1"
FT                   /translation="MENIVSDRLIIRRFTENDWQDLYEYLSDEEVVRFEPYDTYSEEQA
FT                   KEEVINRARNEIFYAVTLKDSGKVIGNLTFIKGDFDTYELGYVFNRKYHGKGYATEGAK
FT                   TLIEYGFSSLGARRIIAMCSSMNKPSWKLLERLNMRREGVLLQNVYFKVDSDGQPIWFD
FT                   TYEYAILKSEWHKLK"
FT   gene            383352..384113
FT                   /locus_tag="Clocel_0299"
FT   CDS_pept        383352..384113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0299"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cac:CAC0373 ABC transporter, ATP binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50080"
FT                   /db_xref="GOA:D9SPN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50080.1"
FT                   /translation="MLVLSVDNLKKVYTSKNNENSTNALNGVDFKIEEGEFVGIMGPSG
FT                   SGKTTLLNLLSGIDRLSSGKIEILGKDVKKMSKNNMTLFRREHLGFVFQDFNLLDSLTI
FT                   EENIMLPLSLDYHEPEEMKGKIDGVMAMLDIATIKDKYPYSVSGGQQQRAAIGRAIINN
FT                   PDIIFADEPTGNLDWKSSNTVMGYFEKLNMMNNNTILVVTHDPFTASYCNRIIFIKDGL
FT                   IHSEVTRDSKERTQFLNVILEKLNSIGDEKK"
FT   gene            384110..386026
FT                   /locus_tag="Clocel_0300"
FT   CDS_pept        384110..386026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0300"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cdf:CD1540 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50081"
FT                   /db_xref="GOA:D9SPN2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL50081.1"
FT                   /translation="MNFRELSLKMAKVNIRRYAIYFLCSGFITMLVFLYLTMYTNKDFN
FT                   DSSKVNSMISSNLFAPTLALGIFSVVFIVHFHNYFIKSRKKDFSLFMTLGLTNNDIRKI
FT                   IVLENILITAGSILVGLAMGTLFSKIFYCIVLKITDLNIDFSMNLKSYLYTIVFLGSIN
FT                   LIMILKSCVFVPVYQIIELLKAEHRADYNFMDKKIFRILGISLIISSIIIQWVGIINKK
FT                   SFIPIYVNMVISLIGIYLFVANLHFFIDKFLKLFKQKTANNLVWVSNLKYSIGSSKNII
FT                   FLSTLFLTTIVYFMSFSSTGTEILQKNIFISNPYDLAYGEVYNKNKLSEDKLKSILQDN
FT                   NVKIDSIDNLEFITQGAMTIISDERLKESLGIDLTVEKGQYTYLHQINKNDGYLHNNQE
FT                   VKSYKINEITYTCQDKIDKILFNNIPILKNTNYLIFSDEDYLKIKSTSPLKNIGNIKFI
FT                   NFNDWSKTEKVVQALIKELQDYNKKNTKQFFQNEKDDIKVFKPVSKIEDLTLLKESSRF
FT                   LMFILCFVFSLFFMASNLMIHFKLLLEEQREKVKYQKLYKIGFTERDLSSNISKELMVL
FT                   FLVPCFLGIYLGGYYICFKLSSIGFNNSYGIKYSMFTGCIYILLELLFYLAYRRYYIKK
FT                   ILS"
FT   gene            complement(386145..386611)
FT                   /pseudo
FT                   /locus_tag="Clocel_0301"
FT   gene            complement(386811..389618)
FT                   /locus_tag="Clocel_0302"
FT   CDS_pept        complement(386811..389618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50082"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN3"
FT                   /inference="similar to AA sequence:KEGG:CLM_0764"
FT                   /protein_id="ADL50082.1"
FT                   /translation="MLRKIETSLAILIFPLRSLSLYKKDLFLDIALSSNKNNPSNKTVV
FT                   DHLWDNLNLDFKPHNIDEVKLTLQKHYPFIFEHKEFDKSYVMCKYFDTINKLSTSLISH
FT                   RDGKITFKYWNNKNDKEIFGPYDTSQKIIILNSLSRMMPLDIVAINYLLENDMDDIDQL
FT                   DGFYSSIMLADMQLEDTLVSGVAENHLHAGACFNFAISWNIIMNIFFRGDVSYISHMGI
FT                   PSSLVEYVLSAIILRLTLCIFLFGKYSSSCECNKRFEDWISEFNHKTCFPQEDSDGVNN
FT                   ESLKESYFNNSSDEKLIYDFITLLSYGEDISKWIKNKSIISSDETDFSTYKNLWDILIK
FT                   RYSIDMEENSEDFVFDIFHRAQCVKTYGENVFIFYALKYIKEEKSDTMFSQLFLNYLRI
FT                   RTNFFNHIVQNGATVKGLDYFKKYYHKASKSIAYTDTKYYYKTLFRTMFQDNFLKKLEL
FT                   RTSINTKSFRKDLINILSAYKEVIDEDFLHKTNEILDKEYSKIGENAFPLFGLVIHLLK
FT                   EEDIRSEEKCWHLHNKDTQSTAGELYFGILQEKYMSQIQTLVNLRNEIPHLSQFILGLD
FT                   AASGENDTPISVFAPVFDKARGSNGQTLKSKNKDGKLIKNKSLAFTFHAGEDFRHLLSG
FT                   LRRIDEVIEFCKFHAGDRIGHGIALGVDAEYWKRANPVVILPRGEYLDNLLWVWGIYAN
FT                   EKDYDPKINIYLENQIYTYASEVYENMNGITTPMLFKAYENRFRKFEVNERYKTDNYLD
FT                   KPEIFCIRAADADTKIWNADKLNHVYHCKCYLKKLYEPIQVAVTDIDCGMIVKIQEIIR
FT                   KKVATKGIVVEVNPTSNAVIGEMDSLFDHHAYIINSILEDKNTKIMLNVNSDDPTVFNT
FT                   NVSNELAYLYYGLLHKNVCKEVALAWIDKLRDYGIKTSFINHQIRHKEYYQCLVEVLKN
FT                   LGADI"
FT   gene            complement(389634..392543)
FT                   /locus_tag="Clocel_0303"
FT   CDS_pept        complement(389634..392543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN4"
FT                   /inference="similar to AA sequence:KEGG:CLM_0763"
FT                   /protein_id="ADL50083.1"
FT                   /translation="MREDDDKSIFIGARPLSKEEVKSIVPTYDALCDRIEDIRREAKNV
FT                   DKKYITTNKKYNNTLALFGNRGTGKTSTMYTLIEKLKKDKENIILDILEPDNIGPEGKI
FT                   IGCILGLFKQELDNLKREIEENPCILPFEIKNQFFSDCRFKESNPLQKIYNDLIEAYCY
FT                   TEKDYRTLLTNSYTDMNSYVKKTSYIFNADMEFSKKFAQFINEFVKVKKSLINGCLNEK
FT                   NEKEPLIFIFIDDVDLNTSKCHEIIEAILKYAAHPNIVCFVSGDYDTFTEAFTVSLLKK
FT                   ENLSVANINLTEHIIEKRPILQSKQVLAYEYMKKVFPNAYRHYVNYWDLALKPTYKFSN
FT                   KNKIEEKQKTLYGLLKSLLEISSKLYNPNSDVCKIENIFGFEKESDEENPEYFYPAYNM
FT                   FDITSRGLVNVYLILDRLHRTDYVKISSYNNEEPTSLFFVDVKNLIDVIIDSSNLLSPH
FT                   KNDILQNYILWSSTEEQSKIDFYQLNLLIQPMADNSSMLYNKRTKYSLFYLCYFITLLL
FT                   PNIQHIKEERKNSLKFSLYILINDQDLSEVYPYNPNISQVCPAVLYIPNISYKHFIFAL
FT                   LSENNLGVSQNIYKFFFDSEFLLSTFSNINIYNNEFGLNSSYIKFYEFLKVRKKKKNIN
FT                   LNSIKDFILSKTYETDDTTYVSIIFYSIFDNFISNSFGNSYNTLHTGIYNFFRIMKLAF
FT                   KNACTENSKPILISSENLTFYLGELLKNYKDNLHINSPSDLSTTSNLLYNIHNKHLENE
FT                   NTYLNIDTTIQSSIYSSFSRHFINQILTRYNNYSNLMIDISSSTEKLQTLFAVDTSDST
FT                   IKIHIENLKTKLFSRFNSFTEMGTSSHEDNEMPIKIINLDLYFNVVDDLKKLLYAHKIQ
FT                   SIDIKDILNNLITSLENDFKIEFTSSPLKEEKFFTDDEKWAIRAYSLFIQQSRPEILDL
FT                   TKLQEAKIYIKQLIESNREKQNKSENAIYERLKIDSDEE"
FT   gene            393002..393748
FT                   /locus_tag="Clocel_0304"
FT   CDS_pept        393002..393748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0304"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50084"
FT                   /db_xref="GOA:D9SPN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50084.1"
FT                   /translation="MLETETEVITISKVEVKLGDNVILKDIDLNIRKGEIVGFLGPSGS
FT                   GKTTLVKAIIGMNKASGGNIEVLGVRMPSLEIATKIGYMAQSDALYEDLNAMGNLIFFA
FT                   ELYGVKRKEAKIRAEEVLALVGLSEYAKKAVRYFSGGMKRRLSLAIALMHKPQILILDE
FT                   PTVGIDPVLRKSFWNEFEKIRAAGGTIIVTTHVMDEAYKCDRLALIREGEIIAEGSPEE
FT                   IIKATGARNIEEAFLCYSGVKEEAEA"
FT   gene            393745..394815
FT                   /locus_tag="Clocel_0305"
FT   CDS_pept        393745..394815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0305"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: esi:Exig_0967
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50085"
FT                   /db_xref="GOA:D9SPN6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN6"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL50085.1"
FT                   /translation="MRTLTIAKRVVKQLVGDKRSLGLLFIAPVFVLFLLNIILNSTIDK
FT                   ANLVLLNSDNMPKQLIEAFEKEANIQLSEEKSDTLEQLKSREIDGVIEFKDNKIIINLE
FT                   GSQTYVTAAVTKSVSTAISQFTKDNLESKPQLKQLGVKPLEKELNFLNGSEDMTSFDGI
FT                   APMMMGFFIFFFVFLLAGVSFLRERISGTLDRLLATPIKRMEIVLGYFFGFGLFVTLQT
FT                   IVIQVFMVYGLKIEIKGNPFIVLLINILLAAGSLALGTLLSAFAKNEFQLFQFIPLIIV
FT                   PQILFSGLFSLREAPIWVLMLSKIFPLTYGARALSSVVLRGEGLSVVVVDIIVLTGYAV
FT                   LFIILNSLALKKYRSL"
FT   gene            complement(395023..395565)
FT                   /locus_tag="Clocel_0306"
FT   CDS_pept        complement(395023..395565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmq:BMQ_3824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50086"
FT                   /db_xref="GOA:D9SPN7"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN7"
FT                   /inference="similar to AA sequence:KEGG:BMQ_3824"
FT                   /protein_id="ADL50086.1"
FT                   /translation="MKIDFTLTEEDYLDITMMHMKGSKKFKSSFIAQRFVIPFLVCLVV
FT                   FDVAKHFGFIPAIIACVALYIGWVLLFPKYYKNSALKKIRKISAKSGEGGPFGNCSIDI
FT                   TSEGVVSSNKEGSLRTNWKRVNKVQETEKFLLIYVDNTNCCVLPLRAFKDQDERKIFMN
FT                   ILKKHCEVEQKDFVTKG"
FT   gene            complement(395676..396551)
FT                   /locus_tag="Clocel_0307"
FT   CDS_pept        complement(395676..396551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0307"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: ere:EUBREC_1372
FT                   putative mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50087"
FT                   /db_xref="GOA:D9SPN8"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN8"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ADL50087.1"
FT                   /translation="MSKHTLKNSDIIIAINDLGAELCSIKDASTDTEYLWNADATHWKR
FT                   HSPILFPIVGGLVNNEFTYKGKTYPMSQHGFARDSVFELISKTETELSHRLISSEESLK
FT                   VYPFDFILDISYKLEGRKITVSWKVTNPSDTTLYFSIGAHPAFMCPVNSQGVQSDYYIG
FT                   FDSNKNITYSLLGTGGCLNPTTYELPLENGIVKITEDLFTKDALIIENSQSSRVSLLNP
FT                   EKKPYVTVTFDAPLFGLWSPASGKAPFVCIEPWYGRCDQEGFTGEFSEKQWMNSLEKDQ
FT                   IFEASYTIEL"
FT   gene            396753..397805
FT                   /locus_tag="Clocel_0308"
FT   CDS_pept        396753..397805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0308"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: cbe:Cbei_2914
FT                   D-galactose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50088"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50088.1"
FT                   /translation="MKFLKKSILLATITILLLNNANHTTNAKDAITNEKPFKVAVFVRD
FT                   INNLLLADVKEKLEEIEKESSSKVDFIFIDSKWDQGIQNQNIQESLDKGYDLFVVNPVS
FT                   ANADEIKGTVSKVVTLNIPVILFLPTSSSLTKSFENLPRVAIIARDLQESGVKQGKILA
FT                   NVWKENKDIIDKNKNNILEYAILQGAKDHLSTIERTKYSIQTLTEENIQVKQLFATTCN
FT                   WDKECARLAIESAFLTLSSKIEAIICNNDEMAMGAIEALQKYGYNKGDKSKYIPVVGVG
FT                   GLSIAKELISQGAMTGTVVEDVPTHVKAIYDIGLNLISGRSITYGTNLKATGGNVIIIP
FT                   YEDYIYNPKL"
FT   sig_peptide     396753..396836
FT                   /locus_tag="Clocel_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.724 at
FT                   residue 28"
FT   gene            397904..399220
FT                   /locus_tag="Clocel_0309"
FT   CDS_pept        397904..399220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0309"
FT                   /product="Kelch repeat type 1-containing protein"
FT                   /note="KEGG: cce:Ccel_0108 kelch repeat protein; PFAM:
FT                   Kelch repeat type 1-containing protein; SMART: Kelch repeat
FT                   type 1-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50089"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP0"
FT                   /inference="protein motif:PFAM:PF01344"
FT                   /protein_id="ADL50089.1"
FT                   /translation="MKNRLKSKIKTGLILAIGMFVLILGSTNILTAKANELTSALQEST
FT                   MVDSMKNPRQDATTVMLDGKIYVLGGQSQGEKLATVEVYDPVKNVWASLSNMNLARSHS
FT                   TAVVLGEKIYVIGGWGKTGYLSSAEVYDPVKDSWTIISSMKSSRCYHSSVVLNGKIYVI
FT                   GGQSEYGKLSSVEVYDPATNSWTMAANVKNVGTLSTSIVLNNKIYVIGGQKSGAKLSNV
FT                   EVYDPESNFWSTVASMKDARIWHTSTVVDGKIYVIGGRGGSKTSNEPLSSAEVYDPATN
FT                   AWTMLSKMNNPRRQHTSVEMNGEIYVIGGYNETEYLSLIEVYNPATNTWTTKANMIAGR
FT                   YGHFSFVLRGEIYSIGGINNNKGVTIVEAYKNSKSEIKLTITMDNDNIKAYDITKEKFE
FT                   EFLNWYEAVSNKDKTVSKIFTINNDSILHEEIEYFTMQE"
FT   sig_peptide     397904..398008
FT                   /locus_tag="Clocel_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.685 at
FT                   residue 35"
FT   gene            399469..401259
FT                   /locus_tag="Clocel_0310"
FT   CDS_pept        399469..401259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0310"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /note="KEGG: cce:Ccel_0108 kelch repeat protein; PFAM: Ig
FT                   domain protein group 2 domain protein; Kelch repeat type
FT                   1-containing protein; SMART: Kelch repeat type 1-containing
FT                   protein; Ig domain protein group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50090"
FT                   /db_xref="GOA:D9SPP1"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP1"
FT                   /inference="protein motif:PFAM:PF02368"
FT                   /protein_id="ADL50090.1"
FT                   /translation="MGLKKELKIKTGIIAVICTLMFIIGSANLISVKAATFATPSNQWV
FT                   PVASMSGTRHWQNSYVINGKIYVMAGHNGSVSIASVESYNPATNTWTVMASMKEPRHYY
FT                   TSVELDGKIYAIGGHNGSKGLASAEVYDPETNTWTSLPNMKEARYYTSAVVCNGKIYVV
FT                   GGHNGSAVLSSIEVYDPATNTWTTSAVMKAARYAHTSVELNGKIYAIGGFDGNYLSSVE
FT                   VYDPVTGIVSLLPSMNNTRHYHESVVLDGKIYSIGGKNANCLASAEVYDPEKNTWTLLP
FT                   NMKDSRWYFDLFTYNGKIYATGGGNAVYISSVEVYDPITNKWSSLPNMLSTRAYHTSVV
FT                   LNDRIYAIGGCNGPALSAVEAYQIYDIQINKGTSALRVGETDTLQVTKIPAEIQVNWTS
FT                   SDPSVATVDDNGKVTAIKAGTASITAKATDGSNYSVTCVVTVTGEPKIDTILKLNKTAI
FT                   SITIGQVEPLLAITNSPSVTWSSANTDVATVDSNGNVIGMQKGTATITATTADSKTATC
FT                   VVTVNAKSRANLIITMTNNNIKTYDLSMEALNIFLNWYDGRANGMGKSYYIFVNPNNGY
FT                   KEYIPYDKIEYFNIEEYEVN"
FT   gene            401676..403202
FT                   /locus_tag="Clocel_0311"
FT   CDS_pept        401676..403202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0311"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   geo:Geob_3196 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50091"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP2"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADL50091.1"
FT                   /translation="MAINLINSISALLSGTSNTSATKTANETKTATATANLVAAASTSD
FT                   SLSISGTLQKGSTGQEVMDLQNALKKLGYFTSTVDGDFGDLTKSAVIKFQAAKGLTQDG
FT                   IVGTETKAAISDALTAASALKLGSSGEAVKELQVNLTKLGFDTKGTDGVFGQNTYNAVV
FT                   AFQNSRGLTADGIVGLNTKNAIDTAISALNNPSLALKIGSSGDEVIQLQVNLTRLGYDT
FT                   NGADGVFGQNTYDAVVAFQTAKGLTADGIVGAATKNAITEALKNVGTSNNNTSSSQQIA
FT                   LKKALAITSSFEGSGFVNVTGNFDGQGISVGALQWNIGQGSLQPLLRRMDTENNALTRQ
FT                   IFGSNYDSFHNMLSKSQSEQLAWAKSINNSSNKIVEPWNSQIKALCGTVQFQQIQMDAV
FT                   KPVADRALAICQKYNLKSERAFALAFDIATQNGSVSSTADSIIKSKVTASTTEKEKLVI
FT                   IATAVADCSKAIYRNDVYSRKMTIVNGSGTVHGSYVNVDVKYGLSDAAFR"
FT   gene            403690..403926
FT                   /locus_tag="Clocel_0312"
FT   CDS_pept        403690..403926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0312"
FT                   /product="Bacteriocin class II, amylovorin-like"
FT                   /note="PFAM: Bacteriocin class II, amylovorin-like; KEGG:
FT                   stc:str1685 pore-forming peptide, putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50092"
FT                   /db_xref="GOA:D9SPP3"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP3"
FT                   /inference="protein motif:PFAM:PF10439"
FT                   /protein_id="ADL50092.1"
FT                   /translation="MTNFETCTMDELVLIDGGDWSWKSLAQSTVSGAVGGAIAGSAGGT
FT                   VTLPVVGTVGGGVGGGILGAVGGAAAYLVCGWW"
FT   gene            404006..405142
FT                   /locus_tag="Clocel_0313"
FT   CDS_pept        404006..405142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0313"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: csc:Csac_0642
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50093"
FT                   /db_xref="GOA:D9SPP4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP4"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADL50093.1"
FT                   /translation="MRIINILGLVIVIAINMITPILISKNVERFFRETDLVEETLAKIK
FT                   KQQNFQNLIIIISIFLFAFFFSNFFSKNEFTRFIMMLSPFIFIIIILVYSSIIYHPIYV
FT                   KVRGIETTIKEEVKDTFRAAIVLLLPSFVIVLVKVEFINKVLINQFVNIFISVFIIIGI
FT                   NLIYPYVFYFSLRAEAIKFPNLNDIVLEFLEQHNIKKVKVYQWPAVKGKMANALVGGLI
FT                   IKKIFISDYLIENMEVDELKAILAHEIGHIKKYHLWIKVTLLILAYPIFTFIGYMMDSV
FT                   ELYFSIKIPIPIGITFFVGCLSIYFSIIYMFFSRYQEYKADEYALKSGIEAEILISAFT
FT                   KLAKLNNSLLKVDEKEERIQTHPSFNNRIERLRKLSLK"
FT   gene            complement(405165..406472)
FT                   /locus_tag="Clocel_0314"
FT   CDS_pept        complement(405165..406472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0314"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="PFAM: Cl- channel voltage-gated family protein;
FT                   KEGG: pjd:Pjdr2_3532 chloride channel core"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50094"
FT                   /db_xref="GOA:D9SPP5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP5"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ADL50094.1"
FT                   /translation="MSEIKEKFFLSVEKVHHVALLANLIKWTAIASIVGIVVGSLSALF
FT                   LESLNLVTNTRLNHPWLLFLLPLAGAFVSFLYSKYGKTSSQGNNLILDQIHGGDNGIPL
FT                   RMAPLVFIGTIITHLFGGSAGREGTAVQIGGSIAEYIGKILKLDKTDRRIILMCGISSG
FT                   FGSVFGTPLAGTIFGMEVIAIGTMEYSALIPCFIASFVGNLVTTVLGAKHSHYALSGIP
FT                   ELSTMVLLKVIIASLLFGLVSILFSEGIHSCKKIFSKLFKNPMIKSIIGGVIIILLTLL
FT                   IGTREYLGLGLPYISASFNEGVPKLAFLGKIIFTSITLGTGFQGGEVTPFFFVGSTFGN
FT                   ALGGILDLSPIFLAGLGLVAVFCGATNTPIASFFLGLELFHGEAVIYLFIACIISYLFS
FT                   GYHGIYTSQKIGNAKTKLLRLPNNTTIGSIKEYRKR"
FT   gene            complement(406778..407011)
FT                   /locus_tag="Clocel_0315"
FT   CDS_pept        complement(406778..407011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50095"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP6"
FT                   /inference="similar to AA sequence:KEGG:CAC2598"
FT                   /protein_id="ADL50095.1"
FT                   /translation="MSDKSKIIKVKKNTQGDIIYVMLENGNVYPINEIITMAKEHLIEG
FT                   VNVAKSRNGREYLRSNPNDEEDDNLDNKPTFQ"
FT   gene            407292..408998
FT                   /locus_tag="Clocel_0316"
FT   CDS_pept        407292..408998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0316"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cac:CAC1352 membrane associated chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50096"
FT                   /db_xref="GOA:D9SPP7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50096.1"
FT                   /translation="MSNGIKEKKTFRISIKQKLMGIFSIIILLMSAEVMLLVYNSMQTK
FT                   NKYENVLEDINTANKIGDQITSVNKELLDVQFGSKKLSEAKYRETIEEIKAESKAILQS
FT                   QGNDNSKISMYQIYKLMDSVSKSIDLTEASINANKKDEAIKNSQNVGDIVTYVKGYSQK
FT                   YVLQAAKNSEILKEQIATEYRKASIVGSILFIFILGIAISSVALLSYSFIKPIEELKNK
FT                   ATEISKNNLMIDKVNVKTKDELYDLAGAFNNMVDNFKSIIHKINDATTNISSTSLELNN
FT                   TSSQNGAVTEEISATSIEIVSSVNMQNEKVMDTVENLNKMFQVSQDINQSSIKILESAN
FT                   NSVAIADEGNKNISEFLSQLEIIKNSANDTSRITDNLNSRAKEMNSIVNTITSIASQTN
FT                   LLALNAAIEAARAGESGRGFGVVAEEIRKLAEESNDSAEKIGKIVENFKFEADNINDKM
FT                   NESITQISIGNDIAENTMKNFKNISEVNNSVERDVHEISIQIKDFIAMINDISNRMNEV
FT                   NDISNSNYRSSSEISEAINQQAESMMSLIDLASELSNLAEGLDGTIKDFKL"
FT   gene            409029..410057
FT                   /locus_tag="Clocel_0317"
FT   CDS_pept        409029..410057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0317"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="KEGG: atu:Atu3137 C4-dicarboxylate-binding protein;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctP subunit;
FT                   PFAM: Extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50097"
FT                   /db_xref="GOA:D9SPP8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP8"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ADL50097.1"
FT                   /translation="MLKKVISISMLMIGILSFSGCSNKTEGNTYIDMIENKNTSVKTLF
FT                   LAESQAPEYPTTKGDYEFARLVKEKTDGRINIQVVTNSELGSEKDTIAQTRMGAIDFTR
FT                   VSATPLSNYSKIMTVLSLPYLYRDEDHLWAVLSSDIGQRAFNDIEKVGLVGLTYYDSGA
FT                   RSFYNNKKEIKSVADLSGLRIRVQESDLMKSLVTSLGATPTAMDPAAVIQALAVGQIDG
FT                   AENNVATYVSSSQYNVAKYYTFDEHSRVPDILVASKTVLEGLSKEDQEIIKQAAIESSD
FT                   FQRKEWKANEDTMYKKMEDAGVKITKLDQAAKEEFKTAVKPVYDKFGADFTDLIKQIEA
FT                   TK"
FT   sig_peptide     409029..409103
FT                   /locus_tag="Clocel_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.638 at
FT                   residue 25"
FT   gene            410422..411228
FT                   /locus_tag="Clocel_0318"
FT   CDS_pept        410422..411228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0318"
FT                   /product="Domain of unknown function DUF3298"
FT                   /note="PFAM: Domain of unknown function DUF3298; KEGG:
FT                   cno:NT01CX_0696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50098"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP9"
FT                   /inference="protein motif:PFAM:PF11738"
FT                   /protein_id="ADL50098.1"
FT                   /translation="MMKNSIKRIAMMLILLNLTNINTFIGIERSIMVFGKNNIGSIKSQ
FT                   GSCKYINLDKSNNSNEYYESKLTIPVLIGIKDKKLEKSINDYFKEKIRSLDRNLSMEAM
FT                   KASNYSKSNKIPFNKYYLQTDVQVNLCNDYILSYNITYYQYSGGAHGITYVESVNLDLI
FT                   NSKKLNLKDIFKKGVDYKALINTRIKEDISKTPELYFKEENLGFKGIKNNQEFYLNDKG
FT                   LVIYFSLYEIAPYVAGIPEFMFSYADYDLYFNLAKPIDRNYLYIYN"
FT   gene            411262..411558
FT                   /locus_tag="Clocel_0319"
FT   CDS_pept        411262..411558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0319"
FT                   /product="protein of unknown function DUF1292"
FT                   /note="PFAM: protein of unknown function DUF1292; KEGG:
FT                   sth:STH1993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50099"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ0"
FT                   /inference="protein motif:PFAM:PF06949"
FT                   /protein_id="ADL50099.1"
FT                   /translation="MEENQIEYELIEKIEIRNRSYAIIAEKGKEDEAFVMRIKEVKGVK
FT                   DLVPVNDDKEFDEVMKKYEEKFIDVDDAGDEEKLIEEDEETITEIDDLAGNER"
FT   gene            411629..413149
FT                   /locus_tag="Clocel_0320"
FT   CDS_pept        411629..413149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0320"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   cno:NT01CX_0695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50100"
FT                   /db_xref="GOA:D9SPQ1"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ1"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL50100.1"
FT                   /translation="MEYLIGALVGSIIGYITNWLAIKMLFRPHEEKRFLGIKVPFTPGL
FT                   IPKERERIAKSVGEAVGTHLLTKEQLVDRFTSDSMAKEIDNWLKKEINLAASSEKTIKE
FT                   KLQEFVKDEYSSLKVACQSMIFNKILAYIRTKKTKEKITIYIVGKISDILERNPRIIIE
FT                   NSIYIKLKEKIVLALSETKDNNQTSGITGKLLQSILNPIVTEDRPLKEVMKEGIVDGFK
FT                   NLIINNSKPIAKELKKALNEESTKEEIKNLVNKVIATQLNPMVAMFVKPDNISEKVYIF
FT                   INEELEKDESQIKVAQFICKFLDKGIEMSPAKIAYQIDKNLSENTKETVIKKIENMLLC
FT                   SQNVQILVDNLEEIIVKKNTIKELFGEQNEEFISIINSVITNMISTVIESVETEEKVRE
FT                   IINELIKNAEEIKLGAVINNSSKEVRDSMVLYGTEFLITLVKEKGETALETVDLAKIVE
FT                   DNINSFDVDYAEKIIIDIAQKELNAITWLGALLGAIMGLLSPVINSFM"
FT   gene            complement(413181..413378)
FT                   /locus_tag="Clocel_0321"
FT   CDS_pept        complement(413181..413378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0321"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: lsa:LSA1561 cold shock protein CspA family
FT                   protein; PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50101"
FT                   /db_xref="GOA:D9SPQ2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ2"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADL50101.1"
FT                   /translation="MQGNVKWFNGLKGYGFITSDDGSEIFVHYSGISGEGYKSLEEGDK
FT                   VSFETAEHNNKLQAVNVKKI"
FT   gene            413795..414562
FT                   /locus_tag="Clocel_0322"
FT   CDS_pept        413795..414562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0322"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: cno:NT01CX_0686 TatD family hydrolase;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50102"
FT                   /db_xref="GOA:D9SPQ3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ3"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADL50102.1"
FT                   /translation="MIFDTHAHYDDDAFDEDREEIIREITENGVKNILNCAASMDGVYK
FT                   SIELAKKYDCFYAAVGIHPEHADQLDKDNLEIIRNLAKESKVLAIGEIGLDYYWEENPP
FT                   REVQQKALRDQMKLAEELDLPVIIHDREAHEDTLKILKEFPRVKGVVHAYSGSVEMARQ
FT                   CVKLGYYLGIGGVLTFKNARKLVEVVEEIPLEHLVVETDAPYMTPVPYRGERNRSDYIS
FT                   YVIKKIAEIKNIEEETVNKRLISNSYDLLKIGK"
FT   gene            414798..415874
FT                   /locus_tag="Clocel_0323"
FT   CDS_pept        414798..415874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0323"
FT                   /product="G5 domain protein"
FT                   /note="PFAM: G5 domain protein; 3D domain-containing
FT                   protein; protein of unknown function DUF348; KEGG:
FT                   cbl:CLK_3254 3D/G5 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50103"
FT                   /db_xref="GOA:D9SPQ4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ4"
FT                   /inference="protein motif:PFAM:PF07501"
FT                   /protein_id="ADL50103.1"
FT                   /translation="MLTNIKTTFEKATRNFSNGTKAVIFFLLLILIISPIIIIGQVRKN
FT                   VTFMVDENPIEVVTYKSNLKDILTEANIELAPEDIISTGLDSKIKDGQIVDIKKAVNIT
FT                   INVDGKQVKIKSAQDDIDTLLKSEECLDTFKNANISSIRSNDRIIPDIKEPLEEGSIVN
FT                   ITRMDTRVETKSQQLDYQVVTENDPNVYVGERRVVQDGQVGHKDVEELVSLEDGVEVSR
FT                   KVVAEKITLQPVNQVISEGSKPKQVQVVSSRGETIPYAFSRVLTMRATAYSKQQEGLTD
FT                   RTATGEYVVHDESGYSTIAVDPRVIPLGTKLYISGYGLAIASDTGGAIVDDRIDVYFDT
FT                   IAECTSWGIRSVEVYVLE"
FT   gene            416129..417274
FT                   /locus_tag="Clocel_0324"
FT   CDS_pept        416129..417274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0324"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; KEGG:
FT                   cbh:CLC_2685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50104"
FT                   /db_xref="GOA:D9SPQ5"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ5"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADL50104.1"
FT                   /translation="MSKSVKAIAALCVTAMLFSTNVQAVQSSEDVQNQINSQQAELNDL
FT                   KKEKDQLLGQIDQYADEIADTMATIDANNKKMDQIQTDIDKAIADIETAEKDEKEAREK
FT                   YYERLRLMYKNNNNMIIEILFSSSSLGDLLEKVKVIQKIGQSTEGILEQLKDKQANTKQ
FT                   RQDELVLENEKLEDTKKQNETYLSEVQAKMDKANGLSKQLQEKEGQKAKEIESSKATLD
FT                   DIKKKEAEAKLQDFENSESPQGGNTVSEGGAGVLTPGPSPTIEQPNLVESGVTSRGTND
FT                   VSYSRKYTMISTAYTAGNPGVGSRTASGLPVSRNPGGYSTVAVDPSVIPLGTKLYISGY
FT                   GYAIAADTGSAIKSKKIDVYFNTLKECYSWGVRYVEVYVLE"
FT   sig_peptide     416129..416203
FT                   /locus_tag="Clocel_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            417635..418189
FT                   /locus_tag="Clocel_0325"
FT   CDS_pept        417635..418189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0325"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain-containing protein; KEGG: cpr:CPR_2527
FT                   primase-like protein; SMART: Toprim sub domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50105"
FT                   /db_xref="GOA:D9SPQ6"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ6"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADL50105.1"
FT                   /translation="MIKEIIVVEGRDDVTAVKRAVDAEVISVSGFGINAKVIEKIKEAQ
FT                   KRQGVIVLTDPDFAGEKIRKIISKRIPEVKHAYISRIEGTKDGDIGVENAEPAAIIKAL
FT                   ENAKCEMKEKREEFDIEDLIFFKLTADPDAKVRREALGKELRIGYGNANQLLKRLNNFG
FT                   VTKEEFMVAMNKINEETKNGK"
FT   gene            418179..419027
FT                   /locus_tag="Clocel_0326"
FT   CDS_pept        418179..419027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0326"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: cbo:CBO0081 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50106"
FT                   /db_xref="GOA:D9SPQ7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ7"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADL50106.1"
FT                   /translation="MANNSTKDIVLKYNFKFTKSLGQNFLTDDSVLNDIVNGAEVNEND
FT                   VVIEIGPGVGTLTKELLGKAKKVIAIEVDSSLIPILQEELKEFDNFTLIHKDATKVDFN
FT                   ELIEGEDTVKIVANLPYYVTTPIITDLLNKKYNFTSITVMIQKEVADRINANPSSKEYG
FT                   ALTLLVQYYCDTKIVRVVPPSCFIPQPKVDSTVIRLDKLPAPRAVVEDEELFFRIIRDS
FT                   FNMRRKTLWNGMKGLGLEKELLEKAFADADIDPKRRGETLSIEEFAKLSNCVNQIKKHN
FT                   R"
FT   gene            419083..420366
FT                   /locus_tag="Clocel_0327"
FT   CDS_pept        419083..420366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_3324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50107"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ8"
FT                   /inference="similar to AA sequence:KEGG:CKR_3324"
FT                   /protein_id="ADL50107.1"
FT                   /translation="MTQKKRYSRLFIILQENDKGYGLSSDKAPNGYVKIETKNNKCKVN
FT                   FYVQNLKKIEDDYHMVLVCDKKVGDKLIDLGKMKVDSGKADMVLEYPVENIARTGVAMD
FT                   KICGTAIGIFKDGKLVSVMCGFSNKEIPEDWMSFEVLESIQNDKEPTTRNIDEDEGYIE
FT                   EQEDEEEEKVEETPDTRDETNEDEDDAEEDILEEAEPDEEKHRGIDDIVDIIEDITDIV
FT                   EEVGDEVEEELDKLKKKKEKEDDEEEIEAFSEYSFKDKKEEPPVDFEKYERSIPNRSDE
FT                   EDYPRGTMGEFFTSLTEGFRKVDDFFPELKRTKWYKVPIETIEDMYSTNDYKKYTAIYY
FT                   PMVNNYPYFSKYGHFLIGYKCDHDYNLKYIVYGVPGKKGIMDQPFGGKTGYVVWAPVDN
FT                   DRTSDDDLGYWLMFYDFKNTTVVIPMEN"
FT   gene            420445..421035
FT                   /locus_tag="Clocel_0328"
FT   CDS_pept        420445..421035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50108"
FT                   /db_xref="GOA:D9SPQ9"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ9"
FT                   /inference="similar to AA sequence:KEGG:CLI_0139"
FT                   /protein_id="ADL50108.1"
FT                   /translation="MGIESNARKGLLVFLIAIMSFAVMMLGVVFQGKLGNSVLIHNDLK
FT                   TLETFKTGNTGFSYKIPHKWQYKEKRINDLSLTYYNSFFSEDNKITGTVQAIRYIGDIQ
FT                   SEIKEGKVLSEIPSGGDFNINNAGSFDGNKLVAEYKFTDKSGIDYNVSEYFFIGNEAYL
FT                   KISFYLKEADDNNTRETILRGILKEVTLEGKAI"
FT   gene            421439..422251
FT                   /locus_tag="Clocel_0329"
FT   CDS_pept        421439..422251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0329"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: cby:CLM_0127 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50109"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR0"
FT                   /inference="similar to AA sequence:KEGG:CLM_0127"
FT                   /protein_id="ADL50109.1"
FT                   /translation="MKRTLKTLMVFIVIIAVVLSGCGTKNTYFDYMKDGNVDKIIIKNA
FT                   RDKGLRFIITDAEKINNLYKVLEVAENTTSKTSLETDYIIELYNAADIVDTLNYVVGIS
FT                   SSEDGNLFNENNSFKVSKRLDEDIFSYLEDIRKPKYFNKVYYESITKVVDTYNRSNSNS
FT                   SVISFNITDDDDVQKFIYSTELKNFTNQMSGKLNVVKDDASMGNLKLTFETIGYKSSTE
FT                   DNALKATFKAKATIKAVDTGIITNYWISNVYSGNSWNYNITTEEPSDF"
FT   sig_peptide     421439..421504
FT                   /locus_tag="Clocel_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.325 at
FT                   residue 22"
FT   gene            422312..423169
FT                   /locus_tag="Clocel_0330"
FT   CDS_pept        422312..423169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0330"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; ArgK protein; KEGG:
FT                   ctc:CTC00253 MRP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50110"
FT                   /db_xref="GOA:D9SPR1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR1"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADL50110.1"
FT                   /translation="MSTCDTCASSSSCKGKNNQESTCGKLMPKYGNIKNIIGVISGKGG
FT                   VGKSTVTGILATKLKKAGYKVGVLDADITGPSMPRFFGINEKRATAFQDPETKAVVLNP
FT                   IETELGIRVMSLNLLIDNEEDPVIWRGPAITGMLNQMYGDTQWGDLDYLLIDMPPGTGD
FT                   VTLTVMQTIPVTSLVVVSTPQDMVSMIVKKVINMAQRLNISILGSVENMSYIICEKCGD
FT                   KTRIFSNKDPIEHAETLGVKFLGELPIDTKLTDSLEQGTAEAYISEEPIYDEIYHGFLT
FT                   AIKN"
FT   gene            423260..423448
FT                   /locus_tag="Clocel_0331"
FT   CDS_pept        423260..423448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50111"
FT                   /db_xref="GOA:D9SPR2"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR2"
FT                   /inference="similar to AA sequence:KEGG:CLL_A0122"
FT                   /protein_id="ADL50111.1"
FT                   /translation="MEANVDKDTCIGCGLCPSICPEVFDMQDDGKAGVIVDQVPGNAED
FT                   TAKEAEESCPVNAISVS"
FT   gene            complement(423676..424176)
FT                   /locus_tag="Clocel_0332"
FT   CDS_pept        complement(423676..424176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0332"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: cac:CAC0898 shikimate kinase; PFAM: shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50112"
FT                   /db_xref="GOA:D9SPR3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR3"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADL50112.1"
FT                   /translation="MKNLILIGMPGCGKSTIGKLAAMKLGIPFVDVDEYIENKYDAKVS
FT                   EIFEKKGEKFFRDLESTCIKELSEKTDLVISTGGGSVLREENMINLKANGVIMFIDRSP
FT                   EDIISDVDIASRPLLAQGSERIYTLYNERINLYTKYCDHHITNNSSIDTVVNTLLLQYI
FT                   VKK"
FT   gene            complement(424173..425312)
FT                   /locus_tag="Clocel_0333"
FT   CDS_pept        complement(424173..425312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0333"
FT                   /product="chorismate mutase"
FT                   /EC_number="4.2.1.51"
FT                   /note="TIGRFAM: chorismate mutase; KEGG: ckr:CKR_0706
FT                   hypothetical protein; PFAM: prephenate dehydratase;
FT                   Chorismate mutase, type II; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50113"
FT                   /db_xref="GOA:D9SPR4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR4"
FT                   /inference="protein motif:TFAM:TIGR01805"
FT                   /protein_id="ADL50113.1"
FT                   /translation="MELNELRKQINDIDKNLLELFQKRMDTAIAIGQYKKEHSMQVFDE
FT                   TREKEVIQRAKTAAEDKYQDFVEAFYQNLMALSREIQREVLNESIDLQIETSSDKTAKK
FT                   PTVVFQGVKGSYSDEALSLYYGDNVNTINVQDFEDVFEELKKGTADYGILPVENSSTGS
FT                   IVDVFDLLAKHDCCIVGEQLLKVEQCLLGVKGATAEDIREIYSHPQGFSQSTEFLKKFP
FT                   DCLKTPYYNTAISAKYVSELNDKSKAAIAGKRAASIYGLDILAENINTSNNNYTRFITI
FT                   SKKLLVADTSDKISVMFILPHESGSLYNALTYFARNNLNMLNIESRPMPNKNWEYMFFI
FT                   DFQGNLHDQRVKNALADLSENSIYVKVLGNYKAAINKAL"
FT   gene            complement(425327..426403)
FT                   /locus_tag="Clocel_0334"
FT   CDS_pept        complement(425327..426403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0334"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: cno:NT01CX_0623
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50114"
FT                   /db_xref="GOA:D9SPR5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR5"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADL50114.1"
FT                   /translation="MSDVWGQNLKISLFGESHGEGIGVVIDGVPSGLKIDMDFIKSEMA
FT                   RRAPGKNKLSTKRKEADEPRILSGVFNGTTTGAAICAVIENTDTKSKDYSELKKKMRPG
FT                   HSDYAAYLKYVGFNDYRGGGHFSGRITAPIVFAGAVAKQLLAQKGIRICSWIKSIEDIE
FT                   DVSLDKINVDEVLMDAVQGSDFPVLTKELGEKMQERIVEASMDCDSLGGVVQCAAINIP
FT                   GGIGSPFFRSVESVLASILFSVPAVKGVEFGEGFNISKLRGSQANDEMYYDADGNVKTY
FT                   TNNNGGLTGGITNGMPITFNVAIKPTPSISKEQRTIDIEAKENTTLVIHGRHDPCIVHR
FT                   VIPVIESVTAIALAELIL"
FT   gene            complement(426396..427616)
FT                   /locus_tag="Clocel_0335"
FT   CDS_pept        complement(426396..427616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0335"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; KEGG: ckr:CKR_0704 hypothetical
FT                   protein; PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50115"
FT                   /db_xref="GOA:D9SPR6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR6"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ADL50115.1"
FT                   /translation="MEITINPKKLSGKVMVPPSKSVSHRAIICASLAKGKSLVKNIKYS
FT                   QDIEATLDCMSAMGMTYERYEDSLTINGIDVFNSNGILSMNTRESGSTIRFLIPMALLC
FT                   SETVEVTGSEKLMQRPLKPYFDIFDTKGIKYSYEGNKLKLSGKLTSGTYEIAGDVSSQF
FT                   ISGLLFALPLVEGNSIVKITTALESIGYVDLTLDMLKNFGIEIINNDYKEFIIKGNQSY
FT                   KAMDCTVEGDYSQAAFYEVAKVLGNDIQCLGLNENSSQGDKEILSIVEKVKNNGLNGIK
FT                   IDVKDIPDLVPILTVLGTFCKGTTEIYNAARVRIKESDRLESTTCELRKLGAKITELPD
FT                   SLIIEGTGKLKGGVVDSWNDHRIAMALAIASTICEEPVTITCAESVNKSYPHFWEHFKS
FT                   IGGNINE"
FT   gene            complement(428012..428866)
FT                   /locus_tag="Clocel_0336"
FT   CDS_pept        complement(428012..428866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0336"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: cac:CAC0893
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50116"
FT                   /db_xref="GOA:D9SPR7"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR7"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ADL50116.1"
FT                   /translation="MSDGDFTIAIVGLGLIGGSTALALKGFKNCTRLGIDIREDVCKAA
FT                   MEEDAVDFASTDPSQIIPKADLIIICIYPDPMIAFINDNIKYFKKNVIITDVGGIKEAI
FT                   VSKMEALLTDDMEFVGGHPMAGREFDGFESADINLFQGAGFLITPSRKSTPSSIALVHE
FT                   IAKYIGCKRIEEVSPKKHDEIIAYTSHLMHVSAAALCMNPPADMTLTFTAGAFKDCTRI
FT                   ANINGKLWSELFIENKEPVLTEISKFISNIELLKKYIEEEDFDSLKETLDKVRGIKEEL
FT                   LTR"
FT   gene            complement(428882..429895)
FT                   /locus_tag="Clocel_0337"
FT   CDS_pept        complement(428882..429895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0337"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: cbt:CLH_2894 3-deoxy-7-phosphoheptulonate
FT                   synthase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50117"
FT                   /db_xref="GOA:D9SPR8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR8"
FT                   /inference="protein motif:TFAM:TIGR01361"
FT                   /protein_id="ADL50117.1"
FT                   /translation="MVVVLKPQTSREQMLVLAENLKKLGVNVAITEGVTGYVLGILGDT
FT                   SKIDQERVELFPEVEKVMRVQEPYKKANRKFHPNDTIVDICGRQIGGNKLAIIAGPCSV
FT                   ETPEQITSVANSVKNSGAGLLRGGAFKPRTSPYAFQGLEDEGLELLKVARANTGLPIVT
FT                   EIMSPKYVEIFEEAVDVVQVGARNMQNFDLLKEVGKMSKPILLKRGLANTIEEWLMSAE
FT                   YIMASGNENVILCERGIRTYETYTRNTLDISAIPAIKKLSHLPIIVDPSHAAGRREMVL
FT                   PLSLAAIAAGADGLIVEVHNDPANAKCDGPQSLTPEQFQDLMNRIKPIAESVGREL"
FT   gene            complement(430065..430196)
FT                   /locus_tag="Clocel_0338"
FT   CDS_pept        complement(430065..430196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_1726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50118"
FT                   /db_xref="GOA:D9SPR9"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR9"
FT                   /inference="similar to AA sequence:KEGG:CDR20291_1726"
FT                   /protein_id="ADL50118.1"
FT                   /translation="MKAIIKTIVSTVEYYYFSLGFYFSAGYFYCRKFNIAFNESVAS"
FT   gene            complement(430269..430448)
FT                   /locus_tag="Clocel_0339"
FT   CDS_pept        complement(430269..430448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50119"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPS0"
FT                   /inference="similar to AA sequence:KEGG:DDB_G0289311"
FT                   /protein_id="ADL50119.1"
FT                   /translation="MIAKILELNEYYGLLSLVNGETISVRTSSLPKGSMIGDNVAIDMK
FT                   NYHTFVNDKFIDFF"
FT   gene            complement(430541..430990)
FT                   /locus_tag="Clocel_0340"
FT   CDS_pept        complement(430541..430990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0340"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cac:CAC0949 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50120"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPS1"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADL50120.1"
FT                   /translation="MPSNLSKKDIKLEEKRLFEEYKAKLAELKKTEKEEKAVGQIFTKG
FT                   LLPIYVMFILSLGATNGNDIAHKISDRTNGLWTPSTGGIYPLLKNMEKSGWIVGEWDNP
FT                   KKKTQKIYSLTNLGHKELLTKKSLLKDRILETREVFNIVYTDLYK"
FT   gene            complement(430996..431838)
FT                   /locus_tag="Clocel_0341"
FT   CDS_pept        complement(430996..431838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0341"
FT                   /product="degV family protein"
FT                   /note="KEGG: ckr:CKR_2066 hypothetical protein; TIGRFAM:
FT                   degV family protein; PFAM: DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50121"
FT                   /db_xref="GOA:D9SPS2"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPS2"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ADL50121.1"
FT                   /translation="MEKIAIITDSTCDLPKAEIDKYNIKVARLKVKYSDREYTDGIDIT
FT                   PEEIYARLDKEIPTTSTPTLGEIDNLFKEVIAENYTHAIVIPISSGLSGTMNNFRLVAD
FT                   GYDEIETFVFDSRALSRAVGFLLTKVGDMIAEGKSFKEITSEIPKLRENMELYFTVDSL
FT                   EHLIKGGRIGRISGSLGQLLNLKPIVSMDEEGKYYTVDKVRGSKQAFNKLVNFGLEQLN
FT                   NHKCRIMVMHANVPESAQKLYDAFKDHPNLTSIELGTLSAVAGVHSGPTLFAFVYMRE"
FT   gene            432364..434811
FT                   /locus_tag="Clocel_0342"
FT   CDS_pept        432364..434811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0342"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: ckl:CKL_0995 glucose-1-phosphate
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50122"
FT                   /db_xref="GOA:D9SQ55"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ55"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADL50122.1"
FT                   /translation="MKAIVMAGGEGTRLRPLTCNIPKPMMPILGKPVMEYAIENLRKIG
FT                   ITQIGVTLQYLPDEVINYFGDGKEFGVNIQYFIEETPLGTAGSVKNAESFLDETFVVIS
FT                   GDALTDIHLEKAIKYHKEKEAMATMILKEVSVPLEYGVVVTDKDGKVNGFLEKPSWSEL
FT                   FSDKANTGIYILEPEIFSFYEQNQKFDFSNDLFPIMLKENKPLMGYVADGYWCDIGSIE
FT                   QYMKCSYDILSGLVDVDINAVEVEDGVWVGKDCTISPKATITPPVYIGNKCRIYEGSKI
FT                   GPFSIIGKNNIISSNCNIKRSIMFDNCYIGTRVELKGTVLCNKVQMESRAAAFEESSIG
FT                   DETLVCSKATIKPGVKIWPEKVVESGSIIKSNLIWGGKHTKSIFGKQGVVGEVNVDITP
FT                   EFVAKLGSAYGSNLSHGAKVAISCNDYGASQMFKYALATGLLSMGIEIFDLKRVTTSMA
FT                   RHTAHLFGADGAIHVMQDREDAQKVTIQFMDENGVNISSSMERKIEGTLLREDFRRVKA
FT                   DELRRIDHYEDCIEYYIRHIINSLDDKLVMEKKYNLVISVREKYVAKAVFKICETLKIG
FT                   IKEYDTPKDIKGLAREVVNSGANMGIYFSDDGEEAVIIDEKGTIIRNSIYEALKAYILL
FT                   KRSNLKVYATPVSSSMALEKIAEMCESKLVRTKTSQKDVFNGFLSGISEGGVSKEEILR
FT                   WYLMSLDSICMFALTLNHLAKYNTTVSALISLIPRYNSKKAETLCPWNKKGKVMRSLIE
FT                   QHEIASIDLIEGIKLNYKNTWALVLPDKEEPLCRIYAESESKEKVDEIIADLTRKIENI
FT                   VYN"
FT   gene            435215..437326
FT                   /locus_tag="Clocel_0343"
FT   CDS_pept        435215..437326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0343"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: cbe:Cbei_0068 anaerobic ribonucleoside
FT                   triphosphate reductase; PFAM: ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50123"
FT                   /db_xref="GOA:D9SQ56"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ56"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADL50123.1"
FT                   /translation="MLYVVKRDGRKVKFNSDKITKAIKRSSEELGYDLKESEAIDLTQG
FT                   IITSIEEEDLEEVTVEQIQNFVEKVLTEKGYTNISKSYSAYRNERTRVRELKSDLMKAI
FT                   QLIGVETDRDNANVGNNFSSKLLRIASESNKWHNLSSMPKQLAKAHENGDVYYHDLDSY
FT                   NLTVNCLHIPTKEVLTRGFNTGYGYIRVPKRIESAAELSCILLQSTQNDMFGGQSHPDF
FT                   DNDMSCFVATTREQIRIELSELGITEEKINQVIEKKVKNAVAQAMQGVVYNLNTMHSRA
FT                   GSQVPFSSINLGIPQSEDAALVCQVFLEEYDKGLGNGEQPIFPNIIFRVKNGVNREPQD
FT                   PYYYLFKLACKVAAKRMNPTFMNIDSDFNKEYYDKGYLPATMGCRTYLMSNINGEPGTK
FT                   GRGNIAPTTINLPRIAILAKKDVDKFFELLENRLLLARESLLHRYQVLRNLKIKDLPFV
FT                   AGQGLMKGAEGLGPDDSIEPILRQGSWGIGFIGLAETLVALIGKHHGETEEAGELGFKI
FT                   INYIREFADKYKEVDKLNWSCYATPAEGLSGKFILKDQQVFGKIKGVTDKEYYTNSYHV
FT                   PVGFPVSITDKIKIEAPYHKLCNGGHISYLELDDYPDGETIEDIITYAYKNTNISYLGI
FT                   NFHIKYCRHCGTYLNYGQHKCPNCGSNDIQGISRVTGYLSLDERFGAGKVAERRDRLSH
FT                   GTSVRTYVE"
FT   gene            437343..437840
FT                   /locus_tag="Clocel_0344"
FT   CDS_pept        437343..437840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0344"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: cbf:CLI_0150 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   TIGRFAM: anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50124"
FT                   /db_xref="GOA:D9SQ57"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ57"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ADL50124.1"
FT                   /translation="MNKLKVGGFLDNSLVNGIGLRSVIFVSGCTHECQGCHNQELQCFS
FT                   YGEEVTIEEIMDRIKKNLGIIRGVTLSGGDPMEQPQNLMQLSKEIKKLNLNIWCYTGYT
FT                   YEEILNDQDKSELLKEIDVLVDGPFILKLKDEGLKYKGSSNQRIIDVKKSIEQDKVVLL
FT                   DI"
FT   gene            438172..438582
FT                   /locus_tag="Clocel_0345"
FT   CDS_pept        438172..438582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50125"
FT                   /db_xref="GOA:D9SQ58"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ58"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3417"
FT                   /protein_id="ADL50125.1"
FT                   /translation="MHFHTNSKESIPSDNIYRNETYENIFKLIEKKNHRIRRVGLGTLS
FT                   FFLIAFAIAFIISVQGKPSIGDNIFIKLGIKTWSRVNWGFHYPVLVSLFFSYLALYLSE
FT                   KYYYQIGGKLARMLSRVYSILLTSIIMVYIYI"
FT   gene            438617..438973
FT                   /locus_tag="Clocel_0346"
FT   CDS_pept        438617..438973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0346"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: ckr:CKR_3318 hypothetical protein; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50126"
FT                   /db_xref="GOA:D9SQ59"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ59"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL50126.1"
FT                   /translation="MDENFQCQCNEVHSECVECVKSTMLEEKKFINLSELFKMFADPTR
FT                   LKIIYALLKKELCVCDIAEVIEMSQSSVSHQLRVLKALKLVKYRKEGKVVYYSLDDEHV
FT                   NNIFNFGLSHIEHQ"
FT   gene            complement(439147..439785)
FT                   /locus_tag="Clocel_0347"
FT   CDS_pept        complement(439147..439785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0347"
FT                   /product="zinc-dependent hydrolase"
FT                   /note="KEGG: cac:CAC0482 zinc-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50127"
FT                   /db_xref="GOA:D9SQ60"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ60"
FT                   /inference="similar to AA sequence:KEGG:CAC0482"
FT                   /protein_id="ADL50127.1"
FT                   /translation="MKIYFLGESSFILESNNHSRILIDPYNDFYHKELYNLPFDVVTIS
FT                   HHHPNHSYLKNLINKPLVIDTADYHATKDFLIKGIISYHDNVKGARRGKNIIFTYESDG
FT                   YRLCHLGDLGHELSLEFLDFIGDVDVLMIPTGGNFTIGPTEAHNLCIALKPKVIFPMAY
FT                   KTDSISYPLEGLDPFISKMKNGEKLLTNYFEITSPLTSLNRVIILNYSV"
FT   gene            439894..440961
FT                   /locus_tag="Clocel_0348"
FT   CDS_pept        439894..440961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0348"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: cbt:CLH_3143
FT                   CAAX amino protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50128"
FT                   /db_xref="GOA:D9SQ61"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ61"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADL50128.1"
FT                   /translation="MYKARKGNLLMLIIAVMGILGSLLIAVVGKLAPQILSFLRSDIGT
FT                   IVLLGITDFVFLGVPIGAYILFKRRPLKEIFRFNKLSVIDAMLVAASAILFLPTVSILG
FT                   TITSIFSNNDVGEMVTSISSMPTLVMLFSVAVLPAIFEELALRGIALSEYRNKSIVTAV
FT                   LMNGLLFSLFHLNIQQSLYTFAMGAIMALIVIYTDSIFSSMVFHFVVNGINVIMAKISI
FT                   FILEHTDPSMMDSTNAKVETNAATIISFAFFGIIAMSFLVGGILVVILIRNRNRDKWVG
FT                   KYPPFRMKPANKWFKKDADLDKKSLNSTDEQSDKEYRRVFRRQKRAQRIVDVTLILNIV
FT                   IYIAYTLIMTEQITL"
FT   sig_peptide     439894..439974
FT                   /locus_tag="Clocel_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.559 at
FT                   residue 27"
FT   gene            441605..444712
FT                   /locus_tag="Clocel_0349"
FT   CDS_pept        441605..444712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0349"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="KEGG: cpe:CPE2541 isoleucyl-tRNA synthetase;
FT                   TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50129"
FT                   /db_xref="GOA:D9SQ62"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ62"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ADL50129.1"
FT                   /translation="MYKRVDSSKSFVDIERDMAQLWEEKNIIKKSFAANEDGEYFTFYD
FT                   GPPTANGKPHVGHVLTRSIKDLIPRYKVMKGYKVIRKAGWDTHGLPVELEIEKKLGISG
FT                   KSDIEKHGVEDFVKLCKESVFTYVKMWEEMSTKIGYWVDMENPYVTYHNSYIESVWWAL
FT                   RQMWDKELLYKGHKVMPYCPRCGTSLSSHEVAQGYKDVKDLTAFVKFKVKGEENKYILA
FT                   WTTTPWTLPSNVALAINKTYTYVEVKQNDEIYILAKDLLSILKDEYEVVKEFKGEELLG
FT                   TEYEQLLPFYTPEEKAFFVIHGDFVTLSDGTGIVHIAPAYGEDDNIVAKQNNLPTINLV
FT                   TADGKFLPEVTPFQDKFVKNCDADIVKYLEERNQLLKAEKHVHSYPHCWRCDTPLLYYP
FT                   KASWFIKTSSLRDKLLENNDKINWYPDNIRTGRMGKFLENNIDWALSRDRYWGTPLPIW
FT                   ECECGHRHLIGSIDELKTKGIDVPEDIELHKPYIDKVQITCDKCGSAMTRVAEVIDCWF
FT                   DSGSMPFAQLHYPFENKELFEQNFPAQFISEAVDQTRGWFYTLSAISTLIFDRNAFENC
FT                   IVLGHVLDKKGLKMSKSKGNVVAPNDVLDTVGADATRWHFYTSSAPWLPTRFSKEDVAE
FT                   TQRKFLSTLWNVYSFYVLYADLDNFDATKYESHKSDNVMDKWILSKLNTLIKSVEDHLD
FT                   GYRLTQAALELENFVDELSNWYVRRNRARYWTTELTEDKIGAYTTLYKVLVTLSKISAP
FT                   FVPFMTEQIYQSLVVSLDSNAVESVHLCIWPEYDATAINPELEREMDLAYTIVKLGRSA
FT                   RNSANIKNRQPLSEMLVSTKSLPNYYGDIVKEELNIKQIEFGADLSKYVSFEIKPNLPI
FT                   LGKAYGKLIPEIRKEIAARNQMDLAQTISAGKAVTITVGGTDLELNKENLLVTMQGLEG
FT                   FAFAGEGDTGVVLETTITEELREEGFVREILSKIQTMRKESGFEVADKINLYVANNSML
FT                   EEIVKKFASDIMKETLTVNIFYGEAREYVNNKINGEELNIAVEVVK"
FT   gene            445486..447075
FT                   /locus_tag="Clocel_0350"
FT   CDS_pept        445486..447075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0350"
FT                   /product="Protein of unknown function DUF2142, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2142, membrane;
FT                   KEGG: cac:CAC0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50130"
FT                   /db_xref="GOA:D9SQ63"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ63"
FT                   /inference="protein motif:PFAM:PF09913"
FT                   /protein_id="ADL50130.1"
FT                   /translation="MNKLFQSKFMFTILLVLSTMGILLVNIRNCFKNIGLNKGSLIHTA
FT                   MGKGIMFFLIFIIASSIAILIFLYKQKNDKNIIVKGFISIAMILGMCILFVNPPFQVPD
FT                   EVAHFFKAYEVSLGRPVSMGSEHGNGYYVPKSFMKLYSDSKVEELIKGKDRLNVSDIKD
FT                   SWNVNLDSDDKFFASYDNVATYMPLQYIPQSIGILIGRIFNLGPLVLFYLARLMNFLTY
FT                   IILAAVAIKLIPVGKEILFLIALMPQNISEVASCAPDALINSLCMVFIALCLYYYKRDK
FT                   KLSKKEMALLLIIVMCVSSFKVVYFPLALLTFLLKDKFESKKFAYSYLCATLFLSILIN
FT                   LIWIPYSSAEIGTNFANNMGKSGIDVGAQVKQAITNPIKYMYILFSTIESNFSFYINST
FT                   IGIIGWLNMPMPQYIIITFMFLMFISTIIENDIEIKVNQKIRYIFIVVFLMIILLIFSS
FT                   LYAIWTPVGADIIEGVQGRYFIPIIALLLLSFKTDRLKINVNKFNLYMIGFVLFSCIII
FT                   ITSIVGKYYVIA"
FT   gene            447113..448045
FT                   /locus_tag="Clocel_0351"
FT   CDS_pept        447113..448045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0351"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cac:CAC2324 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50131"
FT                   /db_xref="GOA:D9SQ64"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ64"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL50131.1"
FT                   /translation="MEIAVLIPCYNEEITIGKVVEDFKRELPQAKIYVYDNNSKDRTSE
FT                   IAAAKGAIVVKETRQGKGNVVRSMFRDIEADVYIMVDGDDTYPAEFVHKLIKPVMDDEA
FT                   DMVIGDRLSNGTYKSENKRPFHNFGNKLVKSLIGWTFKNEINDIMTGYRAFNRFFVKTM
FT                   PVLSSGFEIETEMSIHSLDKRFRLTEIPIDYRDRPEGSDSKLNTYRDGYRVIKVIFSLF
FT                   KDYKPLAFFSILSILFLLLGIIIGTPVIVEFIESSYITKLPSAVLAVGLVIIAILSMAC
FT                   GLILDTISKNSKKQYELQLNDYKKEGIQL"
FT   gene            448045..448392
FT                   /locus_tag="Clocel_0352"
FT   CDS_pept        448045..448392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0352"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cac:CAC2501 membrane protein,
FT                   transporter of cations and cationic drugs"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50132"
FT                   /db_xref="GOA:D9SQ65"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ65"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADL50132.1"
FT                   /translation="MEKMYKSFNQNKIGILIITISAIFTAFGQYFWKISDGKSLLFLFI
FT                   GFTLYGLGAVTMILAFKHGSFSVIHPMMSLGYVFALLIGYRLLSEHISLGKILGTIFIF
FT                   IGVVFIGVGDE"
FT   sig_peptide     448045..448131
FT                   /locus_tag="Clocel_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.881 at
FT                   residue 29"
FT   gene            448385..448723
FT                   /locus_tag="Clocel_0353"
FT   CDS_pept        448385..448723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0353"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cac:CAC2502 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50133"
FT                   /db_xref="GOA:D9SQ66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ66"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADL50133.1"
FT                   /translation="MSNSIFIGLLLVLTLFGSLGGFYFKKATATDTLIALIKCPFLYLG
FT                   GALYVVGALLNIYVLKFRPYSMVLPLTSITYIWSLIISKIFLKEKITRYKIFGITFIII
FT                   GAIFIGMF"
FT   sig_peptide     448385..448474
FT                   /locus_tag="Clocel_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.718 at
FT                   residue 30"
FT   gene            448986..449990
FT                   /locus_tag="Clocel_0354"
FT   CDS_pept        448986..449990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0354"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ctc:CTC00263 catabolite control protein A;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator; regulatory protein LacI; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50134"
FT                   /db_xref="GOA:D9SQ67"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ67"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50134.1"
FT                   /translation="MAASIKDVAREAGVSIATVSRVLNDVDVVNDETKKKVMDAIKKLG
FT                   YRPNIVARSLKTQKTKTIGIVIPDISSAFYPEIVRGAEDVANIYNYNIILCNTDLDSEK
FT                   EKEYLRVLKEKMVDGIIYMSNSLADEILELTRELDLPTVLVETTDLNKTFPSVTIDNIK
FT                   AAYDATSYLIKKGNKNIAYFGPPRNIINASASRYKGYEEALVDNGLAINENLVVAGGLK
FT                   AKDAENYIEKLEENNALKDVDAIFCSTDELAMGVINNLRERGINVPKDVDIVSFDNTYT
FT                   SSIFYPKLTTINQPTYDMGSVGMRMLIKIINKKPIDVTQYVLPYELIERDSCK"
FT   gene            complement(450065..450313)
FT                   /locus_tag="Clocel_0355"
FT   CDS_pept        complement(450065..450313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hiq:CGSHiGG_03090 putative type I
FT                   site-specific restriction-modification system, R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50135"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ68"
FT                   /inference="similar to AA sequence:KEGG:CGSHiGG_03090"
FT                   /protein_id="ADL50135.1"
FT                   /translation="MLDKIKIGIYKNRLGKKVESLLGFDSKTSSEIVQQAYDLYKKTVD
FT                   TYAKNNNLSHDESKKKIFELLQEDKDIKDFLEKQKSS"
FT   gene            450749..454732
FT                   /locus_tag="Clocel_0356"
FT   CDS_pept        450749..454732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0356"
FT                   /product="superfamily I DNA helicase"
FT                   /note="KEGG: cac:CAC3036 superfamily I DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50136"
FT                   /db_xref="GOA:D9SQ69"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ69"
FT                   /inference="similar to AA sequence:KEGG:CAC3036"
FT                   /protein_id="ADL50136.1"
FT                   /translation="MSQKVKNLFNYLINVKGLTDNSIKSIGLKDKNVVLLSNYPKDGIE
FT                   YNPLDEETYIKITKSSGEVYEKIFKIYMSCEREGDNFEIVLGDYIFTWIFQGKKIIYPL
FT                   VTTRMKMIYSKDTEAFTLSVYDNILNLEIDLFRDKELDTKALISIKSRFDLEFLGIQDQ
FT                   FSINSYIKEIISVLDTEGELHEEVYMESEIVTTQNINVYRMPLIMTRKVDNKLLVSEVG
FT                   KILKEIDKGMAIPPSMEAIVEEKVLNDPYKNEFKDIANDLMFPLSSNVEQREIVHRLRD
FT                   NYGVLVQGPPGTGKSHSIANIVCHLLANGKRVLVTSQNAKALKVIISKLPEEIKALCVY
FT                   QLGEDNTLKEIDSSIRRIDEMTSKNPMEYIRKISVLEEKLTSIRENQKLLVKQIKEIEE
FT                   IEYQKIKYNGRVYDISDLARWLASEENENSWIEEEIDLKDKCFITDNEMIRFQHLMDKL
FT                   TREEVENVTLYLENIELIPKKEVFLEYIKKYESLKKREKEFGMMLQSWHVPDNFTIDKD
FT                   IFKVLDLGAYEIKKIKDSWAYKVLGYYNSGSVSRTAIDKIYVLLKCDFTRLLELRIKAA
FT                   DKFIYIPEDIELSKLKFAIKRVKEEVEEKNGLSYGYKFTHRKECKMLAKCTLNNEKICD
FT                   LEGIDSVLDYIEEKLIENNIKHFWNISAKEFNGKEIAKFNLEEMAYLEDALRYIDMIVM
FT                   WEHRYIDKITNCLGDIIPLNKLDWYNEETYIDMKNNLIVLQEYLDYRESKEYILKFKLR
FT                   LSDIEFLSPLRAAIDPFNSIEFNKIYKEFKNYEKLVPFVKEYNIYYNKLKEKLPVTCEK
FT                   LMNAENRSGLKNINKAWMWKQLNALLKRIHDLGIDKLIDACEKENIKEREVIKELAQNK
FT                   AWYQQCLKTTEEKRKSLYCWLQAVKKIGKGRSKFYTKYLSMAQEEMEKCKDIIPAWIMP
FT                   INRVFESLTVNQELFDVVIIDESSQCDLSATTLLMRGKRTIIVGDDNQISPQIIGIDNT
FT                   LVTHYSEAYLKDIPYSRWFDAETNIYTTAQRVFPTRVMLKEHFRCVSEIIGFSNELCYN
FT                   NEIAPLRGREEQGLIPIKTVFVEEGIRESNKSINIKEADTIVDQIYHCCKDEKYKGMTM
FT                   GVISMLGEEQGELIQEKLREKIGEAEIINRKLVCGDAYSFQGDERDIILLSMVVSGDLK
FT                   TRPLTKDVDIKRFNVAASRARNQMWLFHSIDIKNLNPLCVRYKLLNYCQGYQGEKVINQ
FT                   RTGFVQDVYEFLNSKGFKVATLAQNKYGVDFLIEDDKKTIAVQCFGGDLKDIEDQDGME
FT                   NQKIIATMGWKIFKVRESEFYRNPSGLIEKLQKATVEVSGIIA"
FT   gene            455002..455697
FT                   /locus_tag="Clocel_0357"
FT   CDS_pept        455002..455697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0357"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   cbo:CBO0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50137"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ70"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADL50137.1"
FT                   /translation="MKTIKLDSKVFTYEIKRSKRKTIALRVVSKGTIKISAPLMISVKT
FT                   IEDIIREKTSWILDNAKKQEEIEARFRNRNKILFLGKEYCIEREINKDKTFDFKIDGEI
FT                   FKIIFPRVLEEQEEKELLMRWMKNESRKILKARTDFYCKLLELSYNEIHIKDQKTLWGS
FT                   CSSKDNINYNYRIIMAPIEIVDYLVVHEACHLVHRDHGKAYWNLVGSVIPDYKERRAWL
FT                   KNNGLLLKI"
FT   gene            456055..458031
FT                   /locus_tag="Clocel_0358"
FT   CDS_pept        456055..458031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0358"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; type III restriction
FT                   protein res subunit; KEGG: cno:NT01CX_1274 excinuclease ABC
FT                   subunit B; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50138"
FT                   /db_xref="GOA:D9SQ71"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ71"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADL50138.1"
FT                   /translation="MEEFKIVSEYKPTGDQPQAIESISERVLAGDKFQTLLGVTGSGKT
FT                   FTMANIIEKVQKPTLVLAHNKTLAAQLCSEFREFFPDAAVEYFVSYYDYYQPEAYVAQT
FT                   DTFIEKDASINDEIDRLRHSATAALFERKDVIIVASVSCIYGLGNPDEYRKLSLSLRKG
FT                   MEKDRDEIMRKLIDMQYERNDINFVRATFRVRGDILDIFPASSQKVGIKVEFFGEEIDR
FT                   IREFDVLTGQILRELKHVLIFPASHFASSKETVERSIGKIEAELDERVKELLAEEKLLE
FT                   AQRLKQRTNFDIEMIREMGYCQGIENYSRIMDGRNKGEPPKTLIDFFPEDFLMFIDESH
FT                   VTLPQVRAMYGGDRSRKEALVNYGFRLPCAYDNRPLKFEEFEEKLKQVVFVSATPAKYE
FT                   FDHSTNVAEQIIRPTGLLDPIIEVRPIDGQIDDLYSSIQETIVRGFRILVTTLTKKMAE
FT                   DLTDYLKEMGVKTNYLHSDVTTIDRMKIIKELRMGDFDVLVGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSNTSLIQTVGRAARNADSKVIMYADKITDSMSYTIKETERRRKIQIDY
FT                   NEAHNITPTTIIKGIRDNIQISTIAEEEAVYLTEETMSQEDLKKKIASLEKEMKAVAKE
FT                   LQFERAAELRDEINKLKTIMNND"
FT   gene            458219..461038
FT                   /locus_tag="Clocel_0359"
FT   CDS_pept        458219..461038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0359"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: cac:CAC0503 excinuclease ABC
FT                   subunit A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50139"
FT                   /db_xref="GOA:D9SQ72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ72"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADL50139.1"
FT                   /translation="MQDKIIVKGAKVHNLKDVSVTIPRDKFVVFTGLSGSGKSSLAFDT
FT                   IYAEGQRRYVESLSSYARQFLGQMNKPDVEYIEGLSPAISIDQKTTGRNPRSTVGTVTE
FT                   IYDFLRLLYARVGIPHCPKCGREITKQTVDTMVDKIMSLEERTKIQVMAPIIRGKKGEH
FT                   VKVLENIKKNGFVRARIDGELYELEDEEIKLEKTKKHNIEAVIDRLVIKEGIEARLTES
FT                   IETSLKLAEGRVLIDVIDGEEMLFSEHFACPECNISIDEIEPRFFSFNAPFGKCDTCDG
FT                   LGTLMEIDEDLILPNKELSIMQGAVAPWGEGRLKEDSWGFSVLTALSKRYEFDLNTPIK
FT                   DLPREVVEALLYGTNGEKLTIYYANGYKDQYNYAFEGVVNELRRRYMETGSDTIKTEIE
FT                   NYMSDNPCPKCKGARLKPEVLSVTINGRNIYEFCNMPIREELAFMQGLELTEKEKIISN
FT                   QILKEINERLKFLIDVGLDYLSLSRSARTLSGGESQRIRLATQIGSSLVGVLYILDEPS
FT                   IGLHQRDNDKLIATMKHLRDIGNTLIVVEHDEDTIREADFIVDIGPRAGEHGGEIVIAG
FT                   TLDEVKDCKESITGQYLNGEKRIEVPAERRKGNGNSIVVTGGRENNLKNVTAEFKLGMF
FT                   TAVTGVSGSGKSTLVNEILYKGINKQLNRAKINPGQHKDIKGIENIDKIINIDQSPIGR
FT                   TPRSNPATYTGMFDLIRELYASTNEAKMRGYKQGRFSFNVKGGRCEACKGDGIIKIEMQ
FT                   FLSDVYVPCEVCKGKRYNRETLEVKYKGKNIDDVLNMTVEEALEFFENHQRIKTKLETL
FT                   MDVGLGYVRLGQPSTQLSGGEAQRIKLAYELSRRSTGKTLYILDEPTTGLHTADVKKLI
FT                   SILQRLVDGGNTVIVIEHNLDVIKCVDNIIDLGPEGGVRGGTILCTGTPEEVAENKGSY
FT                   TGHYLKRML"
FT   gene            461540..463609
FT                   /locus_tag="Clocel_0360"
FT   CDS_pept        461540..463609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0360"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="KEGG: cth:Cthe_1235 cellulose
FT                   1,4-beta-cellobiosidase; PFAM: Fibronectin type III domain
FT                   protein; SMART: Fibronectin type III domain protein; Ig
FT                   domain protein group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50140"
FT                   /db_xref="GOA:D9SQ73"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ73"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ADL50140.1"
FT                   /translation="MKIKILSKKVKMFLGLIVLVMLININANAITFNYDIKNKVIEIES
FT                   DNGLNIKYKYDQDNRIKEISYGDFKIKYKYDQYGRLSEIRYDDGSRIIYEYDKYGRLIG
FT                   TRIIPGHVTLVGISVEKQVYDMDINKTTNIKVIGKYSNGSSRDITNYSTFIVANNNIVT
FT                   IQNVGIITAKAYGETDLKISYLDKTCTVKINVINRGTPRKPNAPTGLIAEKVTQNTVNL
FT                   KWNPAADSLGVAGYDIYSGSNLVGSTNGTSFSINGLENNKEYTFKVRIKDVNGNLSDFS
FT                   EEISVKTLNVVTLLDISVEKEVYDMDINETMNIKVTGKYSDGSSKDITNDAIFTTTNEN
FT                   IITVPNQGTIVTKTYGETDLKISYLDKTYIVKINVTDTTEPSEPEALVAEDITQTTVNL
FT                   KWAPSTDNAGLAGYDIYLGNNLVGSTDNISFLVNGLEPDKEYTFKVLAKDVNGNLSDFS
FT                   EEISVKTLSVVTLLDISVEKEVYDMDINETMNIKVTGKYSDGSSKDITNDAIFTTTNEN
FT                   IIAVPNQGTIVTKNYGETALNIGYLDKTYTVKIRVVDKIIPSSPNNLVAESITEKTVNL
FT                   RWSPPIDNVDVVGYDIYLGSDIIGSADSTSFIVKGLESNKEYIFKVRARDVNGNLSELS
FT                   EEIKVKTLIDFTLADLSKRYNMSKNQPEWEEKYDLNNDGIIDIYDIAILCRTLG"
FT   sig_peptide     461540..461629
FT                   /locus_tag="Clocel_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.740 at
FT                   residue 30"
FT   gene            463819..464586
FT                   /locus_tag="Clocel_0361"
FT   CDS_pept        463819..464586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0361"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: cbf:CLI_1121 D-alanyl-D-alanine
FT                   carboxypeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50141"
FT                   /db_xref="GOA:D9SQ74"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ74"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ADL50141.1"
FT                   /translation="MQTMKRKIYTLMLVVIPIVAFVVNGQNNKIIATMNDVKIDETLAD
FT                   NNQIASVKEVNEENFSLSEQEIKNPINYPSNLFLVNRSNVLNESYISQSMKITNVEFVT
FT                   YAEPSVRYMDSIAADALEYMFNVAKTNGITLLAVSGYRDYSYQQVLYNNEDPDNNKYVA
FT                   PPGTSEHQTGLAVDILSNEYSNLDEGFDQTQTFKWLESNCYKYGFIIRYPRGKEAITGY
FT                   NYEPWHIRYVGVKEATEISERHITLEEYLNRVG"
FT   sig_peptide     463819..463896
FT                   /locus_tag="Clocel_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.899 at
FT                   residue 26"
FT   gene            464904..465839
FT                   /locus_tag="Clocel_0362"
FT   CDS_pept        464904..465839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0362"
FT                   /product="NlpA lipoprotein"
FT                   /note="KEGG: cth:Cthe_2802 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50142"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ75"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2802"
FT                   /protein_id="ADL50142.1"
FT                   /translation="MKNFKRSISLIIITMLVLSIVGCGKEKKSETSVKIGYLPITHAIP
FT                   LYIENEVAKGDIELVKFGSWAELMDALNSGKIDGASVLIELAMKAKAQGVDLKAVALGH
FT                   TDGNAVVVSDEINTAKDIKGKNFAIPNKVSTHNILLYEMLKKENIKINEVNIVELPPSE
FT                   MAVALQEKRIDGYCVAEPFGAKSVVNGNGKVLKQSSEILKNSICCSLVLRGDFIEKNKA
FT                   KASEVVSKYVEASKYIEENEVDTRSKAKEFLSVKEDVLDVSLQWISFKKLKIEEADYNS
FT                   IVGYIKEMNLFDNPPTYEEFIDNSLLEEVK"
FT   gene            465841..466602
FT                   /locus_tag="Clocel_0363"
FT   CDS_pept        465841..466602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0363"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cth:Cthe_2803
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50143"
FT                   /db_xref="GOA:D9SQ76"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ76"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL50143.1"
FT                   /translation="MKHKRKLLNIIISLSLLLILWQLLSLFGEVGKTSIPSPLEVVKAI
FT                   KDMIEDKILFKYIGISLYRFAVGYFIAAIFAIALGLIFGWYKKAWDIIDPIVQVLRPVS
FT                   PIAWFPFIVIIFGIGNLPAIVIIFIAAFFPILLSTVTAVKNIEKSYLKVASNFEIKGLK
FT                   LMGKIVLPAIFPYIANAMHIALGSAWVFLVAGEMVGAQSGLGYLIIDARNNLRLDMLMA
FT                   GIIFIGLIGLILDKLIARVERKIGVKWGRTY"
FT   sig_peptide     465841..465927
FT                   /locus_tag="Clocel_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.927 at
FT                   residue 29"
FT   gene            466762..467532
FT                   /locus_tag="Clocel_0364"
FT   CDS_pept        466762..467532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0364"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cce:Ccel_0435 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50144"
FT                   /db_xref="GOA:D9SQ77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ77"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50144.1"
FT                   /translation="MGINIENISKTFTRDNKDYKALENINFDIEDGEFICLLGPSGCGK
FT                   STLLNITAAFEKPTEGKVLIDRSEVLKPQIDRVTIFQDYGLLPWRSVEKNVQLGLENLK
FT                   ISKEEKAELSLKYIELVGLEKFKKHYPSELSGGMKQRVAIARALVVNPKVLFMDEPFGA
FT                   LDPITRLKLQDDITDIWKKEKMTIIFVTHDVEEAIYLGSKIVVMGQNPGRVKKIIDNKL
FT                   EKPAKRNSLEFQNLKEDILDLLDQNSNKKIEYYI"
FT   gene            467586..469613
FT                   /locus_tag="Clocel_0365"
FT   CDS_pept        467586..469613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0365"
FT                   /product="carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, catalytic
FT                   subunit; KEGG: cth:Cthe_2801 carbon-monoxide dehydrogenase,
FT                   catalytic subunit; PFAM: Prismane"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50145"
FT                   /db_xref="GOA:D9SQ78"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ78"
FT                   /inference="protein motif:TFAM:TIGR01702"
FT                   /protein_id="ADL50145.1"
FT                   /translation="MEAIIGKVKYHHQIINGEGNSHNNNNHGGSEVNDYLQAVSEYRKT
FT                   FASKQDVLDNTPDPAVREMLLHMEQIGCDTTFDRFDQQKPQCSFGLAGSCCRICYMGPC
FT                   KITPKSPKGICGADADLIVARNILRGMAGGVAGHGIHAREVLLALKNAAEGKLNLPILG
FT                   EDKVKKTAVQFGLETEGKTVNELASQIADILLEDLSRTVPGTFRAIEANAPEERKKVWK
FT                   EMDIIPIGAYHEAFEALHRTGAATDGDWENVMKQFLRCGLAFVWSGVVGSAIGTDSLFG
FT                   IGNRSTSKVNVGALKKGYVNIAVHGHLPVLVSEIVKQGRSEEFIKLAKENGAEGIQFYG
FT                   VCCSGLSAMYRYNDVIPLSNAIGAELVLGTGALDLWVADVQDVYPSIMDVARCYKTTVV
FT                   TTSDSARLPGAEHYGYDHQHSNIGETEALAKKIITRAIESFADRRDVPVFIPSYEVDAE
FT                   IGFSLEYIQNRFGGVKPVLDAMKSGKILGIVNLVGCNNPRVVYEKTVVDIADILIKNNV
FT                   LVLTNGCASFPLLKLGFCNTSALAKTGEGLRSFLESDLPPVWHMGECIDNARASGLFTT
FT                   LAKEAGELIKDMPFALSSPEWSNEKGIGAALGFRLLGINSYHCVHAPVHGSEKVMNFLY
FT                   TGTKDTLGSTMNVEVDHIKLAEMILQDLREKRVALGWDKE"
FT   gene            complement(469717..470286)
FT                   /locus_tag="Clocel_0366"
FT   CDS_pept        complement(469717..470286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0366"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: ckr:CKR_0471 hypothetical protein; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50146"
FT                   /db_xref="GOA:D9SQ79"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ79"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADL50146.1"
FT                   /translation="MNKLQEILDYNHHFVESKEYEKYATSKEPNKKLVILSCMDTRLTE
FT                   LLPKALNLKNGDVKLIKNAGASIMHPFGSIIRSIVVAVYEYNADEVLVIGHHGCGMSNL
FT                   NADKTIEKAKERGVSSEVLSTLSNAGIDVKGWLHGFNSVEESIKESVDLIKNHPLLPKD
FT                   IKVHGLIIDPSTGKLDVVINGYTENN"
FT   gene            470617..472563
FT                   /locus_tag="Clocel_0367"
FT   CDS_pept        470617..472563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0367"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: cpf:CPF_1272 para-aminobenzoate synthase,
FT                   component I; TIGRFAM: para-aminobenzoate synthase, subunit
FT                   I; glutamine amidotransferase of anthranilate synthase;
FT                   PFAM: Chorismate binding-like; glutamine amidotransferase
FT                   class-I; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50147"
FT                   /db_xref="GOA:D9SQ80"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ80"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADL50147.1"
FT                   /translation="MFLMIDNYDSFVYNLARYVQELGEEIVVIRNDKITIEEIFHLNPK
FT                   GIIISPGPKTPKEAGISLEVIDKFKGIKPILGVCLGFQCIGDYFGAKVKKGIYPIHGKL
FT                   SKTTHNQVGIFKGIKSPINVTRYHSLIVDKIDLPEELTITATSDDGVIMGLQHRYYDIY
FT                   GVQFHPEAALTEEGHNLLKNFIDICKKDLEPTVMDITIEEFQSYLNPCEIYSVFSKEKN
FT                   TIFLDSSKEDKELSRFSFIGVNPYKIYKTKGNKIYIDDKCYYGDPFLELEKLIKSMILD
FT                   NQYGNMDLPLLCGCIGYFSYDIGRIIEVIEDTSEKDFDSYDSYFVFYDNIIIFDLINDK
FT                   KYVTALGQSKDRKEAIAEIKEKILGAKGIKEEFQEKDQNTFYSNFTKEAYIDTIKKVKE
FT                   YIANGDVYITNLTQRFWCYNNKEGFQLYKDLRSINKAPFASYLNLDDIQVISSSPERFI
FT                   KIENNILETRPIKGTRPRGRNKEDDEKNRLELINSEKDKAELLMVTDLERNDLSKVCKV
FT                   NTVNVQGLFKLEEYSTVFHLVSTITGELMDNVSAVKAMRECFPGGSITGTPKIRSMEII
FT                   EELEKVRRNLYTGAIGYFDLRGNCDFNIVIRTIIKKDNKAYFGVGGGITIESDEEMEYE
FT                   ETLDKAKALMKVL"
FT   gene            472571..473323
FT                   /locus_tag="Clocel_0368"
FT   CDS_pept        472571..473323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0368"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: cpe:CPE1018
FT                   4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50148"
FT                   /db_xref="GOA:D9SQ81"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ81"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADL50148.1"
FT                   /translation="MIIINDKISEQLVFDDGFYFGKALFETILVLEKPVFLKEHLERLN
FT                   KGLELLKINKKITEEYINRVISEKEIKNQVLKITVSVKNIVINTRPITYTDEEYKNGFK
FT                   LCFSEVIRNSTSMLSYVKSVNYIENIIEKEKAMDKGFQEVIFANEHGKICEGSCSNIFF
FT                   IKNKNIYTPKVSCGILTGVVRAWVINNYKVEEGEYDINNLLESDEIFITNSIMGIMKVK
FT                   TLNDRVYDDQITKGIMDYYFKTLDEDYR"
FT   gene            473621..474070
FT                   /locus_tag="Clocel_0369"
FT   CDS_pept        473621..474070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0369"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: ckr:CKR_3149 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50149"
FT                   /db_xref="GOA:D9SQ82"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ82"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADL50149.1"
FT                   /translation="MFSELSVIFKVIIIIIIYVIIFFALRIMYKDLKGGGRQNQGPKHT
FT                   PVKRKKYGLEVININPSDNLKIGSVIMISGQIVIGRKDNNDLILSSQYVSGTHARVFLQ
FT                   NDKYLIEDLQSTNGTFLNGERLEGKAQLSIGDTVSIGEAEFKVIG"
FT   gene            474075..475274
FT                   /locus_tag="Clocel_0370"
FT   CDS_pept        474075..475274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0370"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: cac:CAC0505 cell
FT                   division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50150"
FT                   /db_xref="GOA:D9SQ83"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ83"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADL50150.1"
FT                   /translation="MDTYRDEKRLLRYTYLFIVVCSLNLFIIKDPLDFGALIMGAVMIV
FT                   LLAYTYFILRRFFPDGDKYIFIFSSMLTALGLVMIYRLDRGLAIKQIVWLILGIAIFIF
FT                   IVVLVPELKRFKKFKYIYMVLTLAFMAMATFIGTEIFGAKNWVYVGPISFQPSEFGKVF
FT                   LILYLAAALEEYENFKQLIEPAFIVMVSLGFMILQRDLGTALMIFAISLTMLYISTSKL
FT                   KYILTCLALFAIGATLSYFLFYHVRRRVLIWHDPWPYVGNESYQLVQGYYGIAMGGLFG
FT                   SGLGLGHPEFVAVRESDLIFSVIAEEMGMLVGFAVLILHFLLFYRNIRGAIYAKSNFTK
FT                   LLTVGLSTMIATQTLVIVGGVTGFIPLTGITLPLVSYGGTSLLITFISLGIIQKVSEGE
FT                   "
FT   gene            475277..476689
FT                   /locus_tag="Clocel_0371"
FT   CDS_pept        475277..476689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0371"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: cce:Ccel_2476 penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50151"
FT                   /db_xref="GOA:D9SQ84"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ84"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADL50151.1"
FT                   /translation="MKDITNNVKKVMIVYLIIFISLISYITYFILFTGPKIEDRSDNQR
FT                   LWAQRNEVLRGTIYDKNMTPLSQSTRNSEGNQVRTYNGGAYTAHALGFEDARYGITGLE
FT                   NKYDSYLMKDNHSKIIDSILSGEKRKEKIGESVVTTLDINLQKKAYEALGNNKGSIVVL
FT                   DVKTGGILAMVSKPSYDPNDLEAQWEGLQSSENRPLLNRSVSGLYPPGSTFKVITSLSA
FT                   IENLQGITEEIFNDDGALEIGGGYSLKNDSGEVLGKINLEEALAYSSNVVFGDIGIRLG
FT                   NKKLRDTAEALYFNNDTPADGIVIDNSIFPKYSDNEEGNIAQSAIGQAGVLASPIQMAL
FT                   VAATIAHGGEMMEPHMVSRIIDKDSKLVEEIKPKSLGQKVPTNAANLVRSYMRSVVTGG
FT                   TGVNVSSKNVQVAGKTGTADNETGSPHSWFIGFAPYDNPEIAIAVVAEGAGYGAQVAVP
FT                   AASKVINQYFSK"
FT   gene            476814..478691
FT                   /locus_tag="Clocel_0372"
FT   CDS_pept        476814..478691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0372"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   cac:CAC0508 excinuclease ABC subunit C; SMART: Excinuclease
FT                   ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50152"
FT                   /db_xref="GOA:D9SQ85"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ85"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ADL50152.1"
FT                   /translation="MFDFEYQLKILPDKPGVYLMKNSLGEIIYVGKAKILKNRVRQYFQ
FT                   NSKNHSEKVRTMVKHIAEFEYIVTDSEIEALVLECNLIKKHKPRYNILLKDDKQYPMLK
FT                   ITVNEDFPRIFITRNVKKDGAKYLGPYTNISAVYETLETIKQLFPLRTCRLDIKAGKIA
FT                   SRPCLNYHIGLCNAPCSNHITKEAYGEMIKEIVDLLSGKDISLVKDLKEKMNISAEALE
FT                   FEKAAEYRNKLIAIEKVQEKQKMATKRFEDEDFIHLAKDDKDAVVQVFFVREGKVIGRE
FT                   HFFLENVVSEENSAIIAEFISAFYGGTAFIPKYIYVPEIEDLELLEQWLTMKRGFKVSI
FT                   KIPQKGEKKDTLTMVQKNAVITLEQFKQKLIKEKEAYTNVLEELAEILALGDIPHRIEA
FT                   YDISNIMGVDSVGAMVAFEEGKPKNSDYRRFKIKTVYGANDYDSMREILTRRFKRGLEE
FT                   IEALTSSEIALEAGKFFVFPDLILMDGGKGQVNVALEVLRELKINIPVAGLVKDNNHKT
FT                   RGIIYDNEEIVLKSSSPIMHFITRIQDEVHRFAITYHRSLRDKRAIKSVLDDIKGIGEK
FT                   RRRNLLMRFGSIENIKNATLEELATTPSMDKRSAQQIKDFFKKLEEERK"
FT   gene            478696..479418
FT                   /locus_tag="Clocel_0373"
FT   CDS_pept        478696..479418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0373"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: cac:CAC0509 putative hydrolase; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50153"
FT                   /db_xref="GOA:D9SQ86"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ86"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADL50153.1"
FT                   /translation="MKYPVDLHTHTIVSGHAYTTLTENINFAIEKGLKVLGTSEHAPSM
FT                   PGSPHIWYFENMLKVPRKIKDLIILRGCEANIKDYEGNVDIDSKGYANLDYMLASVHKE
FT                   VLEGGTIEENTRAYVKALDNPMVFILGHIGNPIFPVDYETVVRAVKEKDKIIEINNASF
FT                   GASRVGSKENCIEVAKLCKKYGAKIILSSDAHICYDIGNFSVSEEILNSIDFPEELIMN
FT                   IDCRIIDYLKSKGRLEDL"
FT   gene            479582..480499
FT                   /locus_tag="Clocel_0374"
FT   CDS_pept        479582..480499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0374"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; KEGG: ckr:CKR_3144 hypothetical protein; PFAM:
FT                   FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50154"
FT                   /db_xref="GOA:D9SQ87"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ87"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADL50154.1"
FT                   /translation="MNVYKDFAKKLGSVLDKENIKVNEYMKNHTSFKVGGSVDILVTPT
FT                   NIEEIIEVIKLCKADRIPFFVMGNGSNLLIKDGGIRGVVIKLEKLNHVEVNGNEIKVES
FT                   GVLMKDLSKAALEARLTGLEFICGIPGTVGGAIAMNAGAYNGEIKDVIDSAVVLDEDGK
FT                   ILTLTNRELELGYRTSSVLKRHYIALSATFILKNGNYDEIKAIIDDLTRRREEKQPLEY
FT                   ASAGSTFKRPTGYFAGKLIQDSGLKGYSVGDAQVSEKHSGFVINKGTATAKDVLAVIAH
FT                   VQKVVKEKFSVELETEVRIMGEDN"
FT   gene            480722..481606
FT                   /locus_tag="Clocel_0375"
FT   CDS_pept        480722..481606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_3143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50155"
FT                   /db_xref="GOA:D9SQ88"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ88"
FT                   /inference="similar to AA sequence:KEGG:CKR_3143"
FT                   /protein_id="ADL50155.1"
FT                   /translation="MRFVIVTGLSGAGKTQAIRSLEDLGYFCVDNLPPTLIPKFAEACY
FT                   QTEGKIDRIALVIDIRGRKFFDDLFESLNYLKSKQYRYEILFLDASDEVLIKRYKETRR
FT                   KHPLAQQGRIIDGITLERAKLKELRDRADNIIDTTKLATRELREKIERIYQEEGQIEAQ
FT                   LSITILSFGFKYGIPVDSDLVVDVRFLPNPFYIPELKAFSGNDKQIQDYVFSFKETQDF
FT                   LDKYTDMLNFLIPYYFQEGKRQLIVSIGCTGGRHRSVAIANEIYNRLFAAGGRVTLEHR
FT                   DINEDVRGGGNKL"
FT   gene            481603..482946
FT                   /locus_tag="Clocel_0376"
FT   CDS_pept        481603..482946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0376"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: cac:CAC0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50156"
FT                   /db_xref="GOA:D9SQ89"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ89"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADL50156.1"
FT                   /translation="MKFLDWFRPGIKVKRWVFLASMGILFIAFGIAEIALRFRYYNGYY
FT                   RAFYVFIIVSGIFVVYLSVMQGMKSIIALINTGYLQVSINSRKLGNLIYEKRLLVKGPK
FT                   IVAIGGGTGLSTMLRGLKYYTSNITAIVTVADDGGGSGDLREDLGILPPGDIRNCILAL
FT                   SDTEPLMEELLQYRFKDGRLKNQSFGNLFLAAMDGISVNFEEAVQKMSSVLAVVGKVVP
FT                   VTLENMVLKAELENGDIVEGESNIPYEAFKNKNPIKRVFIEPEDAKAVQEAIDAINEAD
FT                   AIILGPGSLYTSVLPNLLIKDISEALKKTDALRIYISNIMTQPGETDGYDVADHIEAIN
FT                   RHVKGKIVDLTIVNQQGISKELLEKYLDDASEFVDLNEKKIKQMGIDVVKGNLVATSSN
FT                   GHVRHNSEELAAIIVETIMDRKLFFDRKKIIEYFYLSERLKETKNIDS"
FT   gene            482957..483910
FT                   /locus_tag="Clocel_0377"
FT   CDS_pept        482957..483910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0377"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199;
FT                   Sporulation regulator WhiA-like; KEGG: cac:CAC0513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50157"
FT                   /db_xref="GOA:D9SQ90"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ90"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ADL50157.1"
FT                   /translation="MSFSAKVKSEVCRQTEYTKEEVTALLSAIMKASGTLTLGARRQFS
FT                   FRVTTENPSIARLVFKLLKEYFNVHSKLMVKKGTSLKKNNIYMVVIQEETNVKELLLDV
FT                   GVMQEIEGILTFSNEIPQEIIPSESAKKAYIRGAFLGGGSISNPEKTYHMEFVTHNSEY
FT                   ALGLSKTINEFQLNSKVIQRKNSYIVYIKEGEQIVDLLNIIGAHSSLLYVENIRIMKEM
FT                   RNNVNRLVNCETANLSKTVNAAVRQIESIKLIQKEIGLARLPSNLREIAELRLKYPDES
FT                   LKELGDMLNPPIGKSGINHRLRKIEKIAEEIARGEY"
FT   gene            483938..484954
FT                   /locus_tag="Clocel_0378"
FT   CDS_pept        483938..484954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0378"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: transcriptional regulator, LacI family; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50158"
FT                   /db_xref="GOA:D9SQ91"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ91"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50158.1"
FT                   /translation="MAKAPSLKDVAKLAGVGLGTASRVLNNSGPVTDEKRQAVFEAMEK
FT                   LNYKPNAIARSLKSKKTKTIGVMIPDISNPFYPEVIRGIEDVANKYSYSIFLLNTDRSR
FT                   EKEQKCLSVLQEKMVDGAILMSFSVPEEIKNHINNIPIVLISSIPKNTEFVTVRIDNEE
FT                   AAYEAVNHLCKFGHKDIVMISGPLSDENAAIPRVQGYMRAMLDNGIKFSSENIVDGDFS
FT                   SEWGYIAMKKILEREKIPTAVFTHSDNLAIGAIKAIMEKGLRIPEDISIVGFDGIASSE
FT                   YIYPGITTIKQPRYEMGAMGMETLVKLINGVETKKLIKMDVQLVERNSCKNLLTEDK"
FT   gene            complement(485207..485752)
FT                   /locus_tag="Clocel_0379"
FT   CDS_pept        complement(485207..485752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0379"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: cdl:CDR20291_1373 putative
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50159"
FT                   /db_xref="GOA:D9SQ92"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ92"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADL50159.1"
FT                   /translation="MKKFICTVCGYIHEGDAAPELCPVCKAPAAKFQEQTGERVWADEH
FT                   RIGVAKGVEQDVLDDLRANFMGECTEVGMYLAMSRQADREGFPEVAEAYKRIAFEEAEH
FT                   ASKFAELLGEVVVADTKANLQARVDAEYGATDGKKKLATRAKELGYDAIHDTVHEMCKD
FT                   EARHGKAFLGLLNRYFNK"
FT   gene            486309..486623
FT                   /locus_tag="Clocel_0380"
FT   CDS_pept        486309..486623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50160"
FT                   /db_xref="GOA:D9SQ93"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ93"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0333"
FT                   /protein_id="ADL50160.1"
FT                   /translation="MITKQKSIESKDIKKVVYLAIFATLIMIITNIVSYNYLPDYISVK
FT                   SDGSSTIRKEVYVIIFPCISIITNFINLKLNNRSIVNSIFLNIILPLVNIYIIFTSIPR
FT                   "
FT   gene            complement(486839..487144)
FT                   /locus_tag="Clocel_0381"
FT   CDS_pept        complement(486839..487144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00309880 Ku70/Ku80 beta-barrel
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50161"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ94"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_00309880"
FT                   /protein_id="ADL50161.1"
FT                   /translation="MSYVPNSVYFVDGRLIVNGQRVYGDASSHVDANPSSRITNYGIIT
FT                   YSGRTCVCVEVTNIAVYTWRYINGSGHMEYLTVPLGQFVIDLETGACISGGVLQWY"
FT   gene            487402..489219
FT                   /locus_tag="Clocel_0382"
FT   CDS_pept        487402..489219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0382"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: cbl:CLK_0937 stage V sporulation protein D;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50162"
FT                   /db_xref="GOA:D9SQ95"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ95"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADL50162.1"
FT                   /translation="MKKKKPFEKNQRLFVAFMTIIFIFIGLMGNYARLLIKHGEEYKTD
FT                   AERRWFSKEEVTAKRGKILDSNGNELGVSGNVFRADLDLKTLREDGEDTDDAKARYDIG
FT                   DVAGDMAKILGMTKEEVMEIINSTDSEGEPQNFAQLKRKIEANQAEALTKLKSEKEVRA
FT                   IIISEDTKRYYPNNEFASKLIGHVNGDDKGLTGVELYYDKYLSGISGQYIQEEDGFSNP
FT                   LPFTKPTYYPPVQGSDIYLSIDNRIQRLAERIAEKGKKDTAAESVYIVVSDPNTGEIVA
FT                   MASTGGYDLNNPWISGKSYEELQASWRNNIVSDSFELGSIFKPILAAAALENKAIANDQ
FT                   IIVDCKGSINVAGSPIACDSGTSHGPETIVDILRNSCNVGCVKVAELLGADKLHQYIEK
FT                   VGLGQATGIDIEGESEGIVLRTDEMGPVELATISYGHANTSTMIQYIAAFNAIANGGTY
FT                   ISPHILKEIKGYNSDGSTFAQKTFDTGRKKAIIAPEVAATVRQDLINVVNHPKGMQIPG
FT                   YQFGGKTGTAMATEKGEYIAGKYISSFASMLPADKPQYTMMVTVKYPKPEAYYASQTAM
FT                   PIAKELWTAMIAELGIKPTMPVTTTPTGN"
FT   gene            489296..489595
FT                   /locus_tag="Clocel_0383"
FT   CDS_pept        489296..489595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oaa:100085604 similar to Vav 1 oncogene"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50163"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ96"
FT                   /inference="similar to AA sequence:KEGG:100085604"
FT                   /protein_id="ADL50163.1"
FT                   /translation="MKLSICKEWKVLFLFISDRNGNSFVELKHKNRRKGRKVYLQFKIS
FT                   IIKLKVRRTLIKKDVFQKILEEKEEAIKDCIVLCRNEYKPYFNLGWICNDLRDV"
FT   gene            489999..490565
FT                   /locus_tag="Clocel_0384"
FT   CDS_pept        489999..490565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:541384 myosin binding protein C, fast type
FT                   b"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50164"
FT                   /db_xref="GOA:D9SQ97"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ97"
FT                   /inference="similar to AA sequence:KEGG:541384"
FT                   /protein_id="ADL50164.1"
FT                   /translation="MDERKKNIVIVSVIGFLILIMMIFFCKFSFDKLMNKSERTKKHNP
FT                   NIVNNAVSDANCIIDWRMSDMVVHQLARAQDENVKAMIREGYKEYFNSNSDLLDVESKI
FT                   IKELPKGFGNRRPQSLVSVPITVEHPTSIDQICDIIKKRPSFSINGAENTAETDATAKY
FT                   HQDFIITNNKEGVYTIYMIFYDSGA"
FT   gene            490757..491245
FT                   /locus_tag="Clocel_0385"
FT   CDS_pept        490757..491245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0385"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   amt:Amet_1698 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50165"
FT                   /db_xref="GOA:D9SQ98"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ98"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50165.1"
FT                   /translation="MVIVREARIEDIPYVTAIYNQGIEERTATLESRLRNVKEMEKWLI
FT                   TRSDKHKVLVAEEFETIVGWASINEFSPRECFNANAGMSIYIEKESRGKGVGKTLLIEL
FT                   IETAKSFGFRKLILNTFKKNNASNALYKSMGFKEVGIYEKHGFLDGEYIDIRIMEKLL"
FT   gene            491352..494966
FT                   /locus_tag="Clocel_0386"
FT   CDS_pept        491352..494966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0386"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: phosphoesterase PHP domain protein; TIGRFAM:
FT                   DNA polymerase III, alpha subunit; KEGG: cac:CAC0516 DNA
FT                   polymerase III DnaE; PFAM: DNA polymerase III alpha
FT                   subunit; PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50166"
FT                   /db_xref="GOA:D9SQ99"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ99"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ADL50166.1"
FT                   /translation="MSRDFVHLHVHTGYSLLDGSGKISLMVKRAKELGMNAMAITDHGV
FT                   MYGCVEFYKAAKEVGIKPILGSEIYVASKSMHIKEQGRKNDTHHLVLLVKNSTGYDNLM
FT                   KIVSAASIDGFYYKPRVDHDFLKKHSEGLIALSACLGGEVQGHILKSNLDIAKETALFY
FT                   KETFKDGFYLELQNHGMREQIMVNEHLIAMSKELDIPLVATNDIHYINKEDSRAHDILL
FT                   CIQTGKTIDEKGRMSYQPEQFYIRSQEEMEELFGYVEEALDNTVKIAEQCNFDYEFHVS
FT                   KLPNFPLPSEQDHFQYLRDTCYKGLAELYEEITEEIKVRLDYELDIIKTMGYVDYFLIV
FT                   WDFIRFANENGIPTGPGRGSAAGSIVAFTLGITKIDPIKYSLLFERFLNPERVSMPDID
FT                   SDFCYERRQEVIDYVVDKYGYESVSQIITFGTMAARMCIRDVGRAMNYSYSEVDAIAKM
FT                   IPNMLGINIERALEVNSELKAAYEENERVRDLIDVSKTLEGLPRHTSTHAAGVVIASQP
FT                   LVSYVPLQKNDEAIVTQYTMGTLEELGLLKMDFLGLRTLTVLKDAVDMVKQNKRIEIDL
FT                   DKIDDADPKVYTMVGEGKTVGVFQLESAGMTSFMKDLKPDSLEDIIAGISLYRPGPMAE
FT                   IPRYIEGKRNPAKIRYETPELEPILGVTYGVMVYQEQVMEIVRKLAGYSMGRSDLVRRA
FT                   MSKKKHKVMEEERQNFIYGIVDKDGNIEVPGCLRNGISVEAANKIFDQMMDFASYAFNK
FT                   SHAAAYAVVAYQTAYMMCYYPTEFIAAMLNSVMGNNEKVAYYIRFAKEKDIEVLPPHIN
FT                   ESYSKFTVNKEKIRFGMASIKNVGGNVTDSIVKVREEKGKFKDFMDFAEKIDVSTVNKR
FT                   AAESLIKSGAFDEFGVYRSQLLAIMEKVLDGVSSQKKRNIQGQLNLFQDFENDDSTMDI
FT                   KIEYPKIKEFEKKYILAMEKEMTGLYLSGHPLDEYVQTLNYVTNTNSSEIVSNQLLEGE
FT                   EQLDNTKIRDGDKVIIGGTIAEISKKITRNNAMMAFLRLEDLYGSVEVIIFPKTYEKVK
FT                   TMLDDDALVIVSGRISIREEEAPKVLCEKIEPLIKNSEEKLKAIFDHSKDRTKGYDSTN
FT                   NRSNLKNFERSKPQISSTLVDNGRKIYIQVTDEDGQKEAIDFLRSLPKDYRGNTRIVLF
FT                   RKSDRVALNVSYELWVNEDTDIVKLLKEKFKEENVKEK"
FT   gene            complement(495154..495654)
FT                   /locus_tag="Clocel_0387"
FT   CDS_pept        complement(495154..495654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_2462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50167"
FT                   /db_xref="GOA:D9SQA0"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA0"
FT                   /inference="similar to AA sequence:KEGG:CHY_2462"
FT                   /protein_id="ADL50167.1"
FT                   /translation="MKKAIYMYIVYIVYFLGIGMTSSCIVLMPFNPVRYSIILSIGLGL
FT                   FLTGSIFNELVINKTHLSTVEILKLVVVSLTLAIGIGMISGGISHFKESPQYVSYLIPL
FT                   GILISFISFIVKNNFKLSRKEKIIMLIGVAIISIIIFVILSMMAMNASMDMQPGGDIFK
FT                   GSH"
FT   gene            496405..497364
FT                   /locus_tag="Clocel_0388"
FT   CDS_pept        496405..497364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0388"
FT                   /product="6-phosphofructokinase"
FT                   /note="KEGG: ctc:CTC02490 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50168"
FT                   /db_xref="GOA:D9SQA1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA1"
FT                   /inference="protein motif:TFAM:TIGR02482"
FT                   /protein_id="ADL50168.1"
FT                   /translation="MKTIGVLTSGGDSPGMNAAIRAVVRTALQNNIRVVGIQRGYSGLI
FT                   NGEITELTRDSVSDIIQRGGTILKTARSNTFRTEEGRRRAADVLKVFGVEGLVVVGGDG
FT                   SFMGAKLLSDLGVATIGLPGTIDNDLAYTDYTIGFDTALNTVIDAVNKLKDTSSSHERA
FT                   SVVEVMGRNCGDIALYSGLAGGAESIILPEKPFDMDELCRGILEGKMRGKLHNLIMVAE
FT                   GVGKAEEIAKKIEDITGIEARVTKLGHIQRGGSPTVADRVLATRMGYRAVELLREGKSA
FT                   RVVGIKNNKIIDLDITEALAIESKFDEDLFKIAETISY"
FT   gene            497477..499237
FT                   /locus_tag="Clocel_0389"
FT   CDS_pept        497477..499237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0389"
FT                   /product="pyruvate kinase"
FT                   /note="KEGG: cbi:CLJ_B3675 pyruvate kinase; TIGRFAM:
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PEP-utilising protein mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50169"
FT                   /db_xref="GOA:D9SQA2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA2"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ADL50169.1"
FT                   /translation="MQKTKMVFTIGPASETEEVLSGLINAGMSCSRHNFSHGDHAEHKG
FT                   RIDLVKALRTKFNKQIAIMLDTKGPEIRTGKFDPKKVELQKGDKFTIHCGDMDLIGDTT
FT                   KCAITYTELYKDVVKGNTILIDDGLVGLTVEEIEGNKIHCTVQNTGFVATHKGVNVPNV
FT                   SIKLPAMTDKDRADLVFGCEQGVDLIAASFIRKAADVLAIRKVLEENGGADIQIFSKIE
FT                   NQEGVDNIDEILEFSDGIMVARGDMGVEIPIENVPVVQKMIIEKCNKAGKPVITATQML
FT                   DSMMRNPRPTRAEASDVANAIFDGTDAVMLSGESANGDYPIVAAETMAKICQNAEKHID
FT                   YAKALEKRKEQSIPNVANAISLATCTTAMELNAAAIITATQSGYTAKAVSKYRPASPVI
FT                   AVTPNEKAARKLALNFGVIALVSNKVETTDELISDAVAKAKETELVNDGDLVVIAAGLP
FT                   VHVSGTTNMLKVHVVGDVLVSGKGVGKAAGFGNAKVITNVADAAKLVQRDDVIVVKNLD
FT                   KNLMEVLDKVAGVIAEEGGVTSHMAIECVSRNIPLICNAGGATAAIKDGTFVTLDVQRG
FT                   VVYEGKANVK"
FT   gene            499695..500066
FT                   /locus_tag="Clocel_0390"
FT   CDS_pept        499695..500066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0390"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   cac:CAC0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50170"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA3"
FT                   /inference="protein motif:PFAM:PF07561"
FT                   /protein_id="ADL50170.1"
FT                   /translation="MADVNCAAWTCVNNIDGLCSARTINVLGNSAIKPMETQCETFAPR
FT                   EFINAIKNSTNLNLGGALAQMMQAGKDYGVRMTPSINCDAENCVYNELGMCNAKAIAIS
FT                   GDDPMTSKNTQCATFTSTW"
FT   gene            500415..502802
FT                   /locus_tag="Clocel_0391"
FT   CDS_pept        500415..502802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0391"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; carbohydrate binding;
FT                   glycosyltransferase 36 associated; KEGG: cpy:Cphy_1929
FT                   glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50171"
FT                   /db_xref="GOA:D9SQA4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037828"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA4"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADL50171.1"
FT                   /translation="MNYGYFDGENKEYVITKPNTPAPWANYLGSPEYGAIISNNAGGYS
FT                   FVKSGANGRIIRYRFNAINMDQPGRYIYLRDNDNGDYWSGSWQPVGKPLDKYENQCHHG
FT                   TAYTNIKSKYTNIKAETLYYVPLDKTYEVWRVKVTNEDTKVRNLSLYGYVEFSNENNYE
FT                   QDSVNLQYTQYITKTYFRNNKIIQTINENVKQSVNGSTGKERFFGVAGAEVAAYEGDRD
FT                   TFVGEYRNYSNPIAVESGKCQKVLNYNTNSCGALQIDITLNPGETKELAFVLGAHNDDA
FT                   SSKILASYEDLSQVEKELQELKDYWHGKLNNFQINTPDENFNHMINTWNSYQCFITFVW
FT                   SRAASFQYCGLRNGYGFRDTVQDIQGIIHLAPELALEKIKFMISGQVDNGGGLPLVKFD
FT                   HNPGHEMTPDDPAYTYDRYRADDALWLFPTILKYINETGNDDFLDEVIPFANKGEATVY
FT                   EHLKRAINFSMERQGNNGMPAGLHADWNDCLRMGAKGESTFVAFQLYYAMAILKNIATD
FT                   KKDDAYVAYLDEKLAELKETMQTKCWEGDQFIRGIREDGIVVGSKNDPEANLWLNPQSW
FT                   AVISGCADKEQCEKALDKVYERLNTPYGAVLLDPPYKDHAFDGALMLLFNPSTKENGGI
FT                   FSQSQGWIILAEALMGRGNKAFEYYRECSPAEMNDNAEVRKLEPYAHGQFIEAKESPFQ
FT                   GRAHVHWLTGTASTVMVGCVEGILGMRPTVDGLNISPSVPSDWKEFSIFKSFRGKKLNI
FT                   LVKNPDGKEGGVRELIVNGEKVEGSFLPVSMLKEENEIIATM"
FT   gene            503230..504594
FT                   /locus_tag="Clocel_0392"
FT   CDS_pept        503230..504594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0392"
FT                   /product="fumarate hydratase, class II"
FT                   /note="KEGG: bsu:BSU33040 fumarate hydratase; TIGRFAM:
FT                   fumarate hydratase, class II; PFAM: fumarate lyase;
FT                   Fumarase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50172"
FT                   /db_xref="GOA:D9SQA5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA5"
FT                   /inference="protein motif:TFAM:TIGR00979"
FT                   /protein_id="ADL50172.1"
FT                   /translation="MDYRIERDSMGEIKVPSDKYWGAQTQRSFENFKVGSEIMPLDQIK
FT                   AIAIVKKAAAIVNHKIGKLDQEKAEAIKAAADEIIEGKLDDNFPLVVWQTGSGTQTNMN
FT                   VNEVIANRANEILGAKIIHPNDHVNMSQSSNDVYPTAMHIAAVMSLEETLIPEINALID
FT                   TFLELEEVNKGIIKTGRTHLQDATPISFSQEISGWRTMLQMSVEMIKNTLPFLKELAIG
FT                   GTAVGTGLNSHKDYASTMALEISKLTGKEFSADNNKFHGLSSKDAMVFAHGALKALAAN
FT                   AMKIANDVRWMAGGPRCGLNEIYIPENEPGSSIMPGKVNPTQCESLTMVSCQVMGNDMT
FT                   IGMAASQGNFELNVFMPVIIYNFLQSVSLLSSGISSFNSKCAVGITVNKEKMKEYVDKS
FT                   LMLATALNPKIGYDNAAKVVKTAFKEGITLKEAAIKLEILTEEEYDQIIKPENMV"
FT   gene            504767..505936
FT                   /locus_tag="Clocel_0393"
FT   CDS_pept        504767..505936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0393"
FT                   /product="malic protein NAD-binding"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: clo:HMPREF0868_0752 malic enzyme, NAD
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50173"
FT                   /db_xref="GOA:D9SQA6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA6"
FT                   /inference="protein motif:PFAM:PF03949"
FT                   /protein_id="ADL50173.1"
FT                   /translation="MSNIYDIALEKHGNWKGKLSVEVKVPMETREDLSIAYTPGVAEPC
FT                   RKIHQNKEDVYKYTWKGNSVAVVTDGTAVLGLGDIGPEAALPVMEGKAILFKQFAGIDS
FT                   VPICLNTKDPKEIIAICKAIAPGFGGINLEDISAPRCVEIERALKKELNIPVFHDDQHG
FT                   TAIVVTAGLINALKVVGKKKEDVTVVVSGAGAAGSSIIKMLLDFGVKEVYGFNINGIIS
FT                   MENYDSYDFLTKELAEITNKANKQITMAEALKEADVFIGVSAPRILTKEMVQAMKKDPI
FT                   VFAMANPEPEITYEDAKAAGAKVVGTGRSDFPNQVNNVLAFPGLFKGALMSRAEQITEE
FT                   MKLAAAVGIASIISDEEVNEDYVIPSAFNEKVAEIVAKEVARVAEEQRQ"
FT   gene            complement(506066..506593)
FT                   /locus_tag="Clocel_0394"
FT   CDS_pept        complement(506066..506593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0394"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbe:Cbei_3606 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50174"
FT                   /db_xref="GOA:D9SQA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50174.1"
FT                   /translation="MNINFQLGTKDDINELEQLYNDLNDYLASGTNYPGWIKGIYPVRQ
FT                   NAVDGINSNNLYVAKHNGKIIGSIILNHKPDPTYHTVNWGLDLDYSKVFVIHTFLVHPQ
FT                   FLKSGVGNALIDFAINQGIKSQVKAIRLDVYEGNIPAIKLYEKFSFKYIDTVDLGLINQ
FT                   GLNWFKLYEKLL"
FT   gene            506959..508377
FT                   /locus_tag="Clocel_0395"
FT   CDS_pept        506959..508377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0395"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: cno:NT01CX_1299 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA; TIGRFAM: RNA
FT                   methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; deoxyribonuclease/rho
FT                   motif-related TRAM"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50175"
FT                   /db_xref="GOA:D9SQA8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA8"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADL50175.1"
FT                   /translation="MLEFIRIGDEMKREAPVKKNEEYIIDINGMGYEGEGVGKIDNFTV
FT                   FVPGALKGEKVKVLIVKVNKNFGFGKLKEVIEPSKDRVAPACEIYEKCGGCQLQHLSYK
FT                   GQLEFKKSRVQDCIERIGGFDLSEDNIQLHETLGMENPYRYRNKVQLPVGGTVEDVKIG
FT                   FYSQRSHNIIDMESCNIQFEEADTVVDIVKQWMQENKIQPYNEETHTGIVKHIMVRKAF
FT                   NNDELMVVVVTNGKSLPKKEILIKELQDSFNNLVSVVQNVNDKKTNVVLGLDNVTLFGK
FT                   DTISDYIGEFKFNISPLSFFQVNPVQTEVLYNKALEYAGLTGNEVVFDAYCGTGTISLF
FT                   LSKKASKVYGVEIIEAAIENANINAKENKIDNAEFFVGKCEDVIPKLIADGVKADVVVV
FT                   DPPRKGCEKSLLDALVSMSPERIVYVSCDPGTLARDLRILCDMGYDLKEVQPVDMFPET
FT                   GHVESVVLITRKDR"
FT   gene            508883..509653
FT                   /locus_tag="Clocel_0396"
FT   CDS_pept        508883..509653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0396"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ckr:CKR_2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50176"
FT                   /db_xref="GOA:D9SQA9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL50176.1"
FT                   /translation="MNIAVITGASSGLGKVFFQKMMERYTNLDEIWLIARREDRLKELA
FT                   NKYPDKKVRILPLDLSDTKSIETLDDVLREQRPNIKVLINNAGFDRAGLFGEMKYEDIH
FT                   SIINVNVMGMTMISRTCLQYMSNGSYEIITGSIGSFVPLPWRAVYSASKAYVRFFARAL
FT                   HDEERKRGVNIMLLSPGSMNTEMFRENTTGGKLSIFPYLNLEKETVKAMKKAERGAAVY
FT                   TPRAFYKAYRVFAKIVPSALAVKFTSVESSVPKE"
FT   gene            509702..510469
FT                   /pseudo
FT                   /locus_tag="Clocel_0397"
FT   gene            510480..511052
FT                   /locus_tag="Clocel_0398"
FT   CDS_pept        510480..511052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0398"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ckl:CKL_2572
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50177"
FT                   /db_xref="GOA:D9SQB0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL50177.1"
FT                   /translation="MKYDLNNKTNRFAQRTLLAFSSSLMEILETKGFERITVGEICEAC
FT                   NYPRATFYNYFDDSYDLLNYCWIAMMQEIKVDDYPYMKPEERVYIIFERIYDYFDSYRE
FT                   RLGKIMMFNSLDGALVTSCNLFVKQQSSQIMMDCPYGDVHPIPHQLVAEHYSNTLQLII
FT                   EWCFLRKKIDSKEDALKYLHYLLRNIG"
FT   gene            511076..512230
FT                   /locus_tag="Clocel_0399"
FT   CDS_pept        511076..512230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0399"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   cac:CAC2798 NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50178"
FT                   /db_xref="GOA:D9SQB1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB1"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADL50178.1"
FT                   /translation="MINEIDVFAPSELAGIRLNNRILRAATDEGLADESGNPTEKLIKL
FT                   YETLAKGGVGGIITGYMSVSKDGESMMPGMTMIESDERITRLAEVVSRVHEMKTPIICQ
FT                   IAHCGRNGIAGKDFNVNRISEETIERVINDFVCAAIRAEKAGFDGVEIHLAHGYFLSEI
FT                   LSPHTNKRKDKWGGSTEKRVRIVKEILMKIRSKLPDYPILVKVNGNEIYKDGIHTEESV
FT                   QISRLLEKCGVDAIEVSCGIDWKQMGPARGKVPVEMIMHDYPGIKNLPKPVKTLLKPFV
FT                   PMMMEEASVDRKYNVPAAKKIKESVGIQVIVIGGIHDLEDIESTINEDGIDFVSMSRPL
FT                   ILEPGLINKFKQQTEQKAKCLSCNYCLIGLYNAPVRCYYGKVPK"
FT   gene            512768..513240
FT                   /pseudo
FT                   /locus_tag="Clocel_0400"
FT   gene            513437..514441
FT                   /locus_tag="Clocel_0401"
FT   CDS_pept        513437..514441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0401"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcl:ABC1398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50179"
FT                   /db_xref="GOA:D9SQB2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB2"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADL50179.1"
FT                   /translation="MEGYEITLVKGHDGGRNVIYSCEKEGVNAKILRIAFLNDRSREDF
FT                   LAEVEYIRYLFEYGGSVANVVSSKSGKLLEEITHNNHTFFVCLFEKARGKMLVENNYQY
FT                   REGVPITEYYYNCGKVLGKMHQLSKCYNPVHRRYSFFDKYNAEYIDKLIPNSLYLLKEK
FT                   LLELLKILEGLDKNRDSFGMIHFDYNDGNYSIDFNTGEITVYDFDNSCFGWYMYDLADL
FT                   WTHGVGWIQFEPDADKRKKFMDDYFETVLQGYRSETSIDNSMLDKLPLFTKVTLMENII
FT                   DGFECMMNNGEELEYDEELSYLIKCMEDDIPYKGFFHEVYSCEEPFEYEERDI"
FT   gene            514800..515546
FT                   /locus_tag="Clocel_0402"
FT   CDS_pept        514800..515546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0402"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.187"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; KEGG: tit:Thit_1850 glycosyl transferase,
FT                   WecB/TagA/CpsF family; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50180"
FT                   /db_xref="GOA:D9SQB3"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR034714"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB3"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADL50180.1"
FT                   /translation="MNNYVDILGISFSKLNLQETINLIDNKIEKYRSQLFHIITVNPEI
FT                   AIEIQEDSELRKISLEADLITPDGIGIVLASRLKRNPVPERVTGYDLLLESLKVGNSKG
FT                   WSFYFLGSDEEVNKKTAEYVMKNYPNVKIAGRHHGYFNKEEELKIVENIKSAKPDILIV
FT                   ALGSPLADKWIYKNKTQLNSKVVFGVGGSLDVITGKVKRTPEVWKKLNLEWLFRRINEP
FT                   SRKERQKKLKVFAYRAFGEAFNKNIK"
FT   gene            515903..516376
FT                   /locus_tag="Clocel_0403"
FT   CDS_pept        515903..516376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0403"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   cac:CAC3531 IS605/IS200-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50181"
FT                   /db_xref="GOA:D9SL34"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D9SL34"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADL50181.1"
FT                   /translation="MDNSSLAHSKWNCKYHIVFAPKYRRQIIYGKIKADIGVILRKLCE
FT                   HKGVEIIEANACKDHIHMLVSIPPKLSVSQFMGYLKGKSSLMIFDRHANLKYKYGNRQF
FT                   WCKGYYVDTVGRNKKIIEEYIKNQIQEDLAYEQMSLKEFIDPFTGESVNKGKK"
FT   gene            516663..517454
FT                   /locus_tag="Clocel_0404"
FT   CDS_pept        516663..517454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0404"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   rca:Rcas_3235 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50182"
FT                   /db_xref="GOA:D9SQB5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB5"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADL50182.1"
FT                   /translation="MVQNFSRKKVLLYIAFSYGVTWILWIPLFLNYSYNINVFTLPGQF
FT                   YLASFGPLTSVIVTLMILEGKKGVYSWFSRTYSCTFPKKWLLLAIAMPLCYGIVGILAH
FT                   RFMLGEWLKLSSFGLTSKLPGFNLWQTAVVWVATFGLGEESGWRGFLLPELTKKYSLRV
FT                   SSLIVSAIWIFWHFPAFFFNSTYVNMGLGIIGWAISLTFGSVLLAWIANGSKFSVIPVL
FT                   IWHGGFDLITASDQAEAAMAMVCSMLVIIQGIYLIRGMARR"
FT   gene            517959..518762
FT                   /locus_tag="Clocel_0405"
FT   CDS_pept        517959..518762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0405"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: lbf:LBF_2413 AraC-family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50183"
FT                   /db_xref="GOA:D9SQB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50183.1"
FT                   /translation="MATFDQQSIYIKDLPSSLAKMGFQFYQSKNIEDGLVTLPAFTGVR
FT                   INFIFDGKSVASGVLKSGDLMIAGYTDSPLYGNVYNFSMASIGIHFSLFYYLTGLFPRQ
FT                   CRIPYKVPENSRIYSDLVPFFFLPRENWDSHALSIIKKNQLVLNKVVIKQMERVSLATQ
FT                   LYGYNQMKGFQDISNELGISYRQLQRDFHAFLGMTPSQYERLLRYQVAALNIKNTSIIE
FT                   VALSSGYYDQAHMIREFKKFSDKTPRQIAELNDITVPFVDRKIDL"
FT   gene            complement(518983..519756)
FT                   /locus_tag="Clocel_0406"
FT   CDS_pept        complement(518983..519756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0406"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cpy:Cphy_1168 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50184"
FT                   /db_xref="GOA:D9SQB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB7"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50184.1"
FT                   /translation="MFKINYCDYNHSNPDYDQINRPYGSGDYLFLFFLTPMKIKIGEET
FT                   IFSKENAFILFPKGTPQEYSAVKKFKNSFLHFSPQDDFTSQYSIPVNQIVYLPNPEVIN
FT                   DILKQIYIEFSLKNMHYVEKVDSLINQLFIDFSRQLQSIPYDFNKDLNIFEQFNKARVE
FT                   ILTHIEKDWTSKSMASLTNLGTSQFYNYYRYFFSRSPKSELLDARIARAKYLLKVNKLP
FT                   VSQVATLSGFNNLSHFTRYFKKSCGITPLEYSKTL"
FT   gene            519921..521240
FT                   /locus_tag="Clocel_0407"
FT   CDS_pept        519921..521240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0407"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   csc:Csac_1560 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50185"
FT                   /db_xref="GOA:D9SQB8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB8"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADL50185.1"
FT                   /translation="MRPGFQLNNHNRDLNTCFESHDPSMMWDPVSKTYYSYCTDTAIVS
FT                   DYRQGIPVRKSKDLINFEFVGRVLSDEAIAQGRDNGEGFDPTFGFWAPYTEYVDGEYRM
FT                   YYSATKAFGSSESRIWLAVASNPEGPFENRGVVMDTWNTSDAEPNAIDAHVCDTADGRK
FT                   YFIYGSFFGGIFIKELDKETGMPINPDKYYQGECIAKKPYNSYIDGPEGAAIIYNPDTE
FT                   YYYMFLSYGWLGDDYDIRVGRCKKITGPYVDYNGESMVGNALGMKLAGSYHFKGSNPYA
FT                   GNDSEGWKFDGFRGPGHGVPFYAPEKDEYFFVHHVRDGAQIFCKKEKDRQSFRMHYMAI
FT                   RKMYFVDGWPLFSPEPYAGEKSTVTKLSDKKEMLELEWEWLLLKADNNTMAESVVSKLP
FT                   DYLIPEKTYVFTAYDYENCRECIVLSGITNVGETVWAKIH"
FT   gene            521339..522082
FT                   /locus_tag="Clocel_0408"
FT   CDS_pept        521339..522082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50186"
FT                   /db_xref="GOA:D9SQB9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB9"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0694"
FT                   /protein_id="ADL50186.1"
FT                   /translation="MKELYDMIFKRKSFRKFNDALSFSEEELQDINEEIKRLIPLITGI
FT                   EVKYEIVPREKTTCKRGECCLLIYSEEKEHYLLNVGYMFEQLDLYLASRNIGVCWYGMG
FT                   KVNETQYNNLPYVIMLALGKAEENQFRKDYRKSKRKETSDIWKGDLSFEIAEFVKYAPS
FT                   ACNTQPWRVVCENHTLKIYRITEIKSIIPKEKVSFYNSIDMGIFLYFVELALSHNKISF
FT                   QRTLSPENNEADLIPIGIYMLKKEG"
FT   gene            complement(522291..522968)
FT                   /locus_tag="Clocel_0409"
FT   CDS_pept        complement(522291..522968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0409"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: ckl:CKL_0487 manganese catalase; PFAM:
FT                   manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50187"
FT                   /db_xref="GOA:D9SQC0"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC0"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADL50187.1"
FT                   /translation="MFKHEKQLLNQLEVKVERPNPQYAVLMQEQLGGGNGELKAAMQYL
FT                   SQSFRIKDQTIKDLFLDIGTEELSHMEIVAETINLLNGHNVDNTSVGSGEIETHVLTGL
FT                   SPVLINSSGEPWTANYVTVTGDLVADLLSNIASEQRAKVVYEYLYRQINDKHVKNTIDF
FT                   LLNREEAHNALFREALNKIKDTGSNMDFGVTEDSRLYFDLSTPGRYFENPNPTAPEFAN
FT                   PRR"
FT   gene            523175..524053
FT                   /locus_tag="Clocel_0410"
FT   CDS_pept        523175..524053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0410"
FT                   /product="Chorismate mutase, type II"
FT                   /note="PFAM: Chorismate mutase, type II; glutamine
FT                   amidotransferase class-I; KEGG: wsu:WS2172 anthranilate
FT                   synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50188"
FT                   /db_xref="GOA:D9SQC1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC1"
FT                   /inference="protein motif:PFAM:PF01817"
FT                   /protein_id="ADL50188.1"
FT                   /translation="MILIITNNDERTNSFVECIKKVAKTEVKIIQDKEVSIEKISKLQP
FT                   DSIIISLKYKKDLETGSFKEILEKYKSVIPILGVAGGYAIIAEYFGCEIVELNNNNDAL
FT                   ITCDTNEELFKDFPLSFNAMGGQSIYINKDKLVDQVISIAFSEESAQIEAIKHRNYPVY
FT                   GVRFYPDFINNNDDLIIIRNFLSINDKICLDDSEIIKVKMGQIRKNIDEIDRKIVRLLS
FT                   KRNANVKEASKYKKTSSDVVAEDRIKDVLQKVRTIASAEEIDPDLVVRIYEFIIRSFIA
FT                   YEMSEFEKNKK"
FT   gene            524190..525203
FT                   /locus_tag="Clocel_0411"
FT   CDS_pept        524190..525203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0411"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   cac:CAC2432 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50189"
FT                   /db_xref="GOA:D9SQC2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC2"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADL50189.1"
FT                   /translation="MNIFENITKSSIIKKMAIIGVIIAIIYMLKSMINLLLLTFIFTFI
FT                   FSQIHKFVYTKVNSWIKLSSKMVTISVYVIILAIIVIMSIRYIPQVTQQLIDIINLLST
FT                   FNLEQVHDKVGDTIFNIIKEIQIQDYLKQSEDKIIELATQIGTFSMNVVIAFLLSFFFI
FT                   LEKEEIIAFGQRLEGSKLAFAYEYCKYCGGIFLNSFGKVIQLQIVIAFINSVLSVIALA
FT                   IMGFPQALGIGTMIFILGLIPVAGVIVSLVPLSIIAFNIGGMVKIIEVIIMIAVLHALE
FT                   SYVLNPKLMSMKTKLPVFMVFVILLVGEHLMGVWGLLLGIPLFIFFLDIFDIKVEG"
FT   gene            525635..526315
FT                   /locus_tag="Clocel_0412"
FT   CDS_pept        525635..526315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0412"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cce:Ccel_2324 two component transcriptional
FT                   regulator, winged helix family; PFAM: transcriptional
FT                   regulator domain-containing protein; response regulator
FT                   receiver; SMART: response regulator receiver;
FT                   transcriptional regulator domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50190"
FT                   /db_xref="GOA:D9SQC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC3"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADL50190.1"
FT                   /translation="MNTILLIEDNKDVNRMISEVLFDAGYQVKSAYTGIEGINEIKNSN
FT                   YDLILLDIMLPYKSGDEILKEMRNFSDTPVIVISAKDMVGTKIDILKLGADDYITKPFD
FT                   LGEVLARIEATLRRCHKQVHINKVIKYKDIVLDDNSKHVSVNGVEIELTAKEYMILEML
FT                   IKYQGKVFTKANLYESIWKEEYLGDDNAVKTHVSNLRSKLQKANEHEKYIETVWGLGYR
FT                   LYKE"
FT   gene            526482..527405
FT                   /locus_tag="Clocel_0413"
FT   CDS_pept        526482..527405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0413"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cce:Ccel_2323 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50191"
FT                   /db_xref="GOA:D9SQC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50191.1"
FT                   /translation="MKKYILKTHNLSKIYKGSNALKDVSVSLEAGKIYGLIGQNGAGKS
FT                   TLMRVITGLTFPTSGSLELFGHGGEKELQLERKRIGSMIEYPSLSPNMTAMENMRLHRI
FT                   MKGIPDKQVEDELLELVGLLDTGKKKAKDFSLGMKQRLGIAIALIGNPELLILDEPING
FT                   LDPLGVVEIRKLLKKLCEERQMTILISSHNLPELYQTATDYIIIHKGEIKQTLTLEQLE
FT                   ENCKHHLLISCVQPEKLASVLEMKLNTQNYKVMPDKSIKLYDYLDKKELVGRTLFENGI
FT                   IITNLSNEGDTLEDYFISIVGGSKDV"
FT   gene            527398..528195
FT                   /locus_tag="Clocel_0414"
FT   CDS_pept        527398..528195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0414"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: cce:Ccel_2322 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50192"
FT                   /db_xref="GOA:D9SQC5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC5"
FT                   /inference="similar to AA sequence:KEGG:Ccel_2322"
FT                   /protein_id="ADL50192.1"
FT                   /translation="MYNLILADLFKIRKSMTIKVIFAITTISAVAMVMMAYLIQQGSIS
FT                   TSMAGIGFMFSDINVMSILGAVMAGVFICGDFDNKIIHESIANGNSRGTVIVVKIITFL
FT                   CSIVVILIPYIVATVIAFGTGYKFSMGSVSIGFLNLLTVETGKVLSAVEMWKLLVVMLT
FT                   LLLVYLAQMSLCIPLALALKKPVFVVAIYYGATILFAQLVGVKNFSLVIYNIFSCTPYG
FT                   GKHSMVVLNTGTGEIFKTISISLLFISTMFFISYFTFRKSEIK"
FT   gene            528215..529117
FT                   /locus_tag="Clocel_0415"
FT   CDS_pept        528215..529117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0415"
FT                   /product="histidine kinase"
FT                   /note="KEGG: cce:Ccel_2321 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50193"
FT                   /db_xref="GOA:D9SQC6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50193.1"
FT                   /translation="MIIAVCILGILVISLSSYVIFVQLQLRSINKQLTKRIKENTHQPI
FT                   SLALINKELNILAININKCLKAEENLRLNIIGEEKHFREMIANISHDLRTPLTAIKGYQ
FT                   QLMKKGGLSEEQMEKLIIAQKHADELGRLIEHFFEYSYLVNLEPELQKEKINLTNLVAE
FT                   CLAEAISTFEERNLSVKFCDVLPVFALVDKEMTLRIIRNLIRNSIQHSNNDIEVRVFTD
FT                   NNAIISFSNFVSNTSEMDVKRIFDRFYVADKAREKTGGLGLAIVKLLANQMGGRTEATL
FT                   VDGIFKIVVELPKYEKEFL"
FT   gene            529497..530723
FT                   /locus_tag="Clocel_0416"
FT   CDS_pept        529497..530723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0416"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="PFAM: Domain of unknown function DUF1858; KEGG:
FT                   aoe:Clos_0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50194"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC7"
FT                   /inference="protein motif:PFAM:PF08984"
FT                   /protein_id="ADL50194.1"
FT                   /translation="MTNKYFDIEDTLFNITENYSEATELLIALGFSNLKDENMRKVFGK
FT                   SISLEAALKLKKINVETFMAELIEKIENNNPGSEELSEKNNTIKIAGVLPCPVKAPLTE
FT                   AFEGWVNNQNFDYKLEYELKAASMGISWLKDALMEQSKEQLPDLFISAGFELFFDKKLF
FT                   GKYKAEDMFEDLTDFEHYNEDFENDYIKLKDPNRQYSIVGVVAAVFLVNVEELSGRKIP
FT                   TSWEDILQEEFENSVSLPIADFDLFNSILLNIYKNYGEDGVRRLGKSLKKSMHPSEMVK
FT                   SHIKKFDKPTITIMPYFFTKMVKEDGPMVPVWPKEGAIVSPIFMLSKKSKKAELKPIVD
FT                   FFASKEIGEILSHNGRFPSVNPEVDNMISKENKYMWLGWDYIKEKDISVEIKKSLDIFN
FT                   SFVEGDKTV"
FT   gene            530720..531421
FT                   /locus_tag="Clocel_0417"
FT   CDS_pept        530720..531421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0417"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; KEGG:
FT                   str:Sterm_1977 cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50195"
FT                   /db_xref="GOA:D9SQC8"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC8"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADL50195.1"
FT                   /translation="MNLVNISGPPSSGKTSVILKTIEAIKKRGLKVGVVKFDCLYTDDD
FT                   VLYGKAGVPVKKGLSGSLCPDHYFVSNIEEVVQWGVKENLDLLITESAGLCNRCSPYIK
FT                   GIKAICVIDNLSGINTPKKIGPMIKTADIIVITKGDIVSQAEREVFASRVNSVNPQAII
FT                   IFVNGLTGQGAFELSTLVYDEGLDIETVKGKELKFPMPSSLCSYCLGETRIGDEYQMGN
FT                   VRKIKIGDGNA"
FT   gene            531414..532430
FT                   /locus_tag="Clocel_0418"
FT   CDS_pept        531414..532430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0418"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: aoe:Clos_0149 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50196"
FT                   /db_xref="GOA:D9SQC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50196.1"
FT                   /translation="MLKIEELEKEKIKDLEKQYPFILSFFENNKLDVKGYKEYTFQEYL
FT                   KHFTQEEIEEWAIDIEKMKIDLEIFINQMLEFLGVEKDRVDSITIIAGKDKYGNKENFD
FT                   KLTINKSEIISIVGPTGAGKSRLLADIEWAANKDTPTERVILINGEFPDKSLRFSTSNK
FT                   LVAQLSQNMNFIMDLSVKEFIELHARSRMIDNEEEVTNKILEAANELAGEKFNLDTPIT
FT                   GLSGGQSRALMIADTAILSTSPIVLIDEIENAGIDRKRALNLLVSKEKIVLMATHDPSL
FT                   ALMADKRIVIKNGGIYKVIETDREEKSILEELERMDTIISKMRTNLRNGDILEKEKV"
FT   gene            532704..533150
FT                   /locus_tag="Clocel_0419"
FT   CDS_pept        532704..533150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0419"
FT                   /product="putative GAF sensor protein"
FT                   /note="SMART: GAF domain protein; KEGG: bpf:BpOF4_03585
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD0"
FT                   /inference="protein motif:SMART:SM00065"
FT                   /protein_id="ADL50197.1"
FT                   /translation="MDKLLVKQMEALITKEDWLITNLSNASALLWSELQDINWAGFYLI
FT                   RDGELVLGPFQGKVACTHIALGKGVCGTAAVEDSTKRIENVHDFPGHIACDSASNSEIV
FT                   IPIHSSKGTVVGVLDIDSPLFGRFSVEDQEILEDIVKIVEKAFD"
FT   gene            533401..534471
FT                   /locus_tag="Clocel_0420"
FT   CDS_pept        533401..534471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0420"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: hor:Hore_01750
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50198"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD1"
FT                   /inference="protein motif:PFAM:PF06089"
FT                   /protein_id="ADL50198.1"
FT                   /translation="MEPLVALTRSNRIESIHAGYICITDSNNNVLYNIGDCKDKVFLRS
FT                   AAKPFIATTFIKSGAMEQFDISEKELAIICSSHTGEDYHRETISSILNKIGVSEEDLKC
FT                   GISAPYNKEMNERLIRKNERPSKLYNCCSGKHSGMLAACKALGLPIDSYNDKCHPLQKL
FT                   ILYNISKLLGCSEEDIILGIDGCTVPSFMITIQQISYLYALLADGGNTKEEYKDALTKI
FT                   RNSMVAYPEMIDGYEEFYTELMGHSDKRMIAKVGDEGLYCVAVPEKKIGIVVKIVDGNE
FT                   RACYPVIIEVLKQLGIFTKTESKQLYNWAFTPLKNHVSDVIGYTLPVFNINKNQSNKNI
FT                   TIGQLLEFKGDNLWNN"
FT   gene            534459..535502
FT                   /locus_tag="Clocel_0421"
FT   CDS_pept        534459..535502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0421"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: hor:Hore_01750
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50199"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD2"
FT                   /inference="protein motif:PFAM:PF06089"
FT                   /protein_id="ADL50199.1"
FT                   /translation="MEQLAVLTRSGYVESIHYGYICVVDSSGKIIKEIGDSNTKIYFRS
FT                   SAKPIQAVPVIESGASQHFGFTKKEISIMCSSHSGQIMHQDTVTEMLKKIGEEANVLKC
FT                   GIMIPYNKEEANRLQSSKEKPSVLHCSCSAKHVGMLTLAKYKNYSIDDYNRIDHPAQHE
FT                   ILNTISYFTDYNEENITVGIDGCGAPIYIIPIYNIALSYARIMNFANDENSKYHKACKT
FT                   IIESMIEYPEMVAGDEEFCTELMRFTNGKLIGKVGSEAVYCVGIKDKGIGICVKIIDGN
FT                   ERAVYPVVMQILKELNILDKNELNNLQHWSRVELKNNLDEVIGDILPSFQLLNKYKLGD
FT                   KVADTSV"
FT   gene            complement(535661..535747)
FT                   /pseudo
FT                   /locus_tag="Clocel_0422"
FT   gene            536136..536549
FT                   /locus_tag="Clocel_0423"
FT   CDS_pept        536136..536549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_22044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50200"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD3"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_22044"
FT                   /protein_id="ADL50200.1"
FT                   /translation="MEKLNVFRDKKGIEKVTLLMILFTISLLMGCNNSISKGKKVDYIE
FT                   VVKLSDNKKWTFLEKDEIDKFIKALDDKEKFNGKFEIRTPDYSVDIYFKNKSKESYSLW
FT                   LGEEDNIQGILMDENTIWYIDKKSNPTLRKLLS"
FT   gene            536630..537121
FT                   /locus_tag="Clocel_0424"
FT   CDS_pept        536630..537121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0424"
FT                   /product="ybaK/ebsC protein"
FT                   /note="KEGG: amu:Amuc_1956 YbaK/EbsC protein; TIGRFAM:
FT                   ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA synthetase
FT                   associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50201"
FT                   /db_xref="GOA:D9SQD4"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD4"
FT                   /inference="protein motif:TFAM:TIGR00011"
FT                   /protein_id="ADL50201.1"
FT                   /translation="MAKQKEIKTNAMRILDKLKIEYNHQSYECDEFVDGLDTAEKLNLP
FT                   YEQVYKTLVTVGSSKEYFVFVIPIDKELDMKKAAKAVGEKSIAMINIKDLNSVTGYVRG
FT                   GCTSIGMKKQYKTIISDTAEALGKIYVSAGKVGVQLQLTPNDLCRAANAVYGDIIVEHQ
FT                   "
FT   gene            537167..537703
FT                   /locus_tag="Clocel_0425"
FT   CDS_pept        537167..537703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0425"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="KEGG: cpy:Cphy_3732 phosphodiesterase; TIGRFAM:
FT                   phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50202"
FT                   /db_xref="GOA:D9SQD5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD5"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADL50202.1"
FT                   /translation="MKIMIASDIHGSAYYCKMMIEAYEREQADKLLLLGDILYHGPRND
FT                   LPKDYNPKQVIEMLNDMKESILCVRGNCDTEVDQMVLKFPIMADYCILYIEEQMIFATH
FT                   GHNFNEENLPPLHKGDILLHGHTHVPKCVDKEEYIYMNPGSVSIPKENSSNGYMIIENN
FT                   EFIWKDFEGRIYNQY"
FT   gene            537867..538625
FT                   /locus_tag="Clocel_0426"
FT   CDS_pept        537867..538625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0426"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   cth:Cthe_3110 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50203"
FT                   /db_xref="GOA:D9SQD6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD6"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADL50203.1"
FT                   /translation="MLNQFSRTELLFGKEAMEKLENSKVAVFGIGGVGGFVVEALVRGG
FT                   VGEFELIDDDKVCLTNLNRQIIATRQTVGKYKAEVMKERILSINPKAKVTIHNSFFLPQ
FT                   NSDEFDFKSYSYIVDAIDTVTAKIELVMKSQELGIPIISCMGTGNKLDPTKLEVADIYK
FT                   TTMCPLAKVMRHELKKRRVKRLKVVYSTEKPKRPIEDMAISCRANCICPPGAERKCTDR
FT                   RDIPGSTSFVPSVAGLIIAGEVIKDITGVR"
FT   gene            538751..540226
FT                   /locus_tag="Clocel_0427"
FT   CDS_pept        538751..540226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0427"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   cby:CLM_1348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50204"
FT                   /db_xref="GOA:D9SQD7"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD7"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ADL50204.1"
FT                   /translation="MTETKETIEIGWNLDNSYESLPEIFFTKQGLSPITSPKLIILNAP
FT                   LATFLGLNVQALQSEEGIANLVGNKIPKGASPLTQAYAGHQFGSFTMLGDGRALLLGEQ
FT                   ITPQGEKVDIQLKGSGRTRYSRGGDGRAALGPMLREYIISEAMYGLGIPTTRSLAVVTT
FT                   GEPIIRETEQPGAILTRIAASHIRVGTFQYASQWGEREELKALADYTIQRHFPEGINNE
FT                   NKYLFLLKEVINRQAQLIVKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDTYDPATV
FT                   FSSIDVYGRYAYGNQPNIAVWNLARLAETLLPLLHSDQEQAVEIAQEEVSNFAQLYQNN
FT                   WFAGMRAKLGIFNEEPEDKILIEELLGMMHKHSADYTNTFRALTLDMCSHTELFTSPEF
FT                   KHWYQKWQERLSRQQESKDSVQQLMKKNNPAIIPRNHRVEAAIEAAVKNGDYSVMEQLL
FT                   DALSNPFEYSEKQEEYAKLPKPSKQKYKTFCGT"
FT   gene            complement(540381..541256)
FT                   /locus_tag="Clocel_0428"
FT   CDS_pept        complement(540381..541256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0428"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: cth:Cthe_2413 NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50205"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD8"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL50205.1"
FT                   /translation="MNKRFFIFQKAINLFKNFIPYNICIINDSVVDVYRSAKTNSERVT
FT                   QTLLCQEVNIEREILGWTKVEVVDGYIGWVKSDKIYKTINNPLPTKVVIKSKMKSIFSA
FT                   MNGTSIIKEITLGTELPVIEKINNWYKVDLTMNRIGWLEDTDTLETASGTHILKTTGID
FT                   FVDTAKKFLGVPYLWGGVSAWGIDCSGLTYICCRVNGVDLPRDAQPQYYSISTSINPNP
FT                   SDMKPGDLLFFSSKPDSKKYLNLISHVGIYIGNNDFIHASGSIGSVTITSLSDEYFTKR
FT                   LVGVKRVFEN"
FT   gene            541675..542079
FT                   /locus_tag="Clocel_0429"
FT   CDS_pept        541675..542079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50206"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0297"
FT                   /protein_id="ADL50206.1"
FT                   /translation="MMTKLRSKVFSFILTILAAISFMAVPASALTYSSSSVKSSWTNSS
FT                   YTYYSANIVNNDVQIQGGISYSQAISRIKAGQSVMCYSKSTARNIAYAAGGNKTPVGPE
FT                   IHGSLNNGYYYHYHVYNRATHAHIWYYSQS"
FT   sig_peptide     541675..541764
FT                   /locus_tag="Clocel_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 30"
FT   gene            542188..542634
FT                   /locus_tag="Clocel_0430"
FT   CDS_pept        542188..542634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_4010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50207"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE0"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_4010"
FT                   /protein_id="ADL50207.1"
FT                   /translation="MYSLNNNPEGQVYKELLDIAFDACDEFILVQRPDMDFEESAQRII
FT                   KLLEPFLIEKKKSRSWPGTTLLEQIADVYRYRADKEAQKILLEATESLYSWVQPKLPED
FT                   LCFFKNKNTWMSSTAHERQCDFESLSDDEVLRLKKLSGLQIRKI"
FT   gene            complement(542994..543848)
FT                   /locus_tag="Clocel_0431"
FT   CDS_pept        complement(542994..543848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0431"
FT                   /product="ABC-type transport system involved in
FT                   multi-copper enzyme maturation, permease component"
FT                   /note="KEGG: tte:TTE2403 ABC-type transport system involved
FT                   in multi-copper enzyme maturation, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50208"
FT                   /db_xref="GOA:D9SQE1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE1"
FT                   /inference="similar to AA sequence:KEGG:TTE2403"
FT                   /protein_id="ADL50208.1"
FT                   /translation="MLAIALSTFKEIYRKKIFHFIGILTILYLILLSIIFRYIGKNINM
FT                   NDSVISMISGFSSIISILGFYFSSMLVAFLTVMLSIGIVSSEIESGTVLTILTKPIKRS
FT                   SYIIGKYFGTAVLIILYSAILFIAVILLSTMTKISIIETFGIVALAKGFLFFILEPLTI
FT                   LALALYGSTIFKTLNNGILIIAIYILGTIGGVIEQVGTFTSNSSLSTLGIISSLISPFE
FT                   VVYRKMISTIFTSLGAFSPLMGFGMTGGASTTPSGWMIVYVFAYLIFFILMSIMNFRKK
FT                   DIG"
FT   gene            complement(543848..544753)
FT                   /locus_tag="Clocel_0432"
FT   CDS_pept        complement(543848..544753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0432"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: tit:Thit_2065 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50209"
FT                   /db_xref="GOA:D9SQE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50209.1"
FT                   /translation="MVIETENLSKIYKNNKGCKDISIAVPQGEIYGFLGPNGAGKSTFI
FT                   KTIVGLLFPTSGTANILGKPIGDIEAKRKIGYLPELFKYQEWMTGLDLLSFHASLYKLD
FT                   KKTSTKKIDEVLEIVNLKGAEKNKIGTYSKGMQQRIGIASALLCDPELLFLDEPTSALD
FT                   PIGRKEVRDIMIELKNRGKTVFLNSHLLSEVEMVCDSAAIISKGTIIKQGKMNELLEGD
FT                   TVLDIHAEDITNEILNKLEKIDEDVVFDGKNIKMHINQNRQIHDIASLIIAGGGKLYGL
FT                   TPHRNSLEELFIKLVERGQE"
FT   gene            complement(544759..545856)
FT                   /locus_tag="Clocel_0433"
FT   CDS_pept        complement(544759..545856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_2064 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50210"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE3"
FT                   /inference="similar to AA sequence:KEGG:Thit_2064"
FT                   /protein_id="ADL50210.1"
FT                   /translation="MKCPNEGLIQAYIDKELNDFEMKEIEIHLSQCEKCKETYTELNSL
FT                   NKFTLEKLNVYKEDFNVSNLKPTNLNIEMKSKKGVFKDMKKYKNIAVAACAALAITTCV
FT                   TVEPIRATIIDAVSIFRAKEIKSVDISLSDINDLEKALQEHKTDIDIDKIGKVNFHGGE
FT                   RKTVTLDEAKTTLPFTLSLPTALSDKTIESVVIDEPSKIDFTLNVENVNEILKSLGGKN
FT                   IFPKDLDGKTFSFNTSGILNVSYRDVADNKHISVTESKVPELLAPADANVDEIFNALSE
FT                   LSVLPPNIQKQLKSMKDWQNTLYVPNVENEFEELDLGGTKAVGHFEDTNENKNSYVLIL
FT                   KNDVLISLYGNVDKNEILEIAKTMR"
FT   gene            complement(545853..546389)
FT                   /locus_tag="Clocel_0434"
FT   CDS_pept        complement(545853..546389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0434"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: tit:Thit_2063 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70 region 4 type 2;
FT                   sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50211"
FT                   /db_xref="GOA:D9SQE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADL50211.1"
FT                   /translation="MGVISYFKKKKDKQSLKNIYEEFYNPIYKKISYLTGDMHVAEDLT
FT                   QEVFMKLYNSPPDHDNIAAWLNKVSTNISYNYIRDKKNHENKNEIIYEKEVSNIISIEE
FT                   IAINNCEINLTRKVLNMLSPRDRMCLLLKFSGYKYSEIAETIKIDKNSVGTVISRAQAK
FT                   FKENYLKAEEGVNRK"
FT   gene            546998..547789
FT                   /locus_tag="Clocel_0435"
FT   CDS_pept        546998..547789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0435"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: eel:EUBELI_01397 polar amino acid transport
FT                   system substrate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50212"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADL50212.1"
FT                   /translation="MRKKLGLLLVIVLVFTSLVGCGSKSSEVKKEKFTVGFDAEFEPYG
FT                   FMNENGEYVGFDLDLAQEVCKRNNWELVKQPIDWDAKDMELESGSIDCIWNGFTINGRE
FT                   DKYTWSSPYVNNSQVFVATTSSGVKKKNDLAGKIVAVQKDSSALAALNAEENAGLKNSF
FT                   AKIVEFGDYNTAFMELEMGTVDSIAMDIGVAKAQMESRDNKKFNILEQYLSTEKYGVGF
FT                   LLGNEKLRDKVETSLQEMLKDGTFLEIATKWKLQDSICLGE"
FT   sig_peptide     546998..547060
FT                   /locus_tag="Clocel_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.638 at
FT                   residue 21"
FT   gene            547857..548507
FT                   /locus_tag="Clocel_0436"
FT   CDS_pept        547857..548507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0436"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: msi:Msm_0806 polar amino acid ABC transporter,
FT                   permease component; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50213"
FT                   /db_xref="GOA:D9SQE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADL50213.1"
FT                   /translation="MSLSIMLSQLGKGFIYTIEIFALTLLFALPLGLLISFGRMSKNFL
FT                   VRAVTKFYISVMRGTPLMLQLIVVYFAPYYVFKIQLGNSYRFIAVIIAFVLNYAAYFAE
FT                   IYRSGIESIPVGQYEAAKVLGYTKSQTFFKIILPQVIKRILPPVTNETITLVKDTSLAF
FT                   VLSIVEMFTAAKQVAASGTTMMPLMVAGLFYYIFNLLVAIAMEQVEKKLSYYR"
FT   gene            548519..549277
FT                   /locus_tag="Clocel_0437"
FT   CDS_pept        548519..549277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0437"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: eel:EUBELI_01396 polar amino acid transport
FT                   system ATP-binding protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50214"
FT                   /db_xref="GOA:D9SQE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50214.1"
FT                   /translation="MKILEINNMKKSFDNLEVIKDISLSVNEGEVLSIIGPSGSGKSTV
FT                   LRCATMLETMDSGELIYLGEHAARKDVDGKSIYASKKNLKRIHKHFGLVFQNFNLFPHY
FT                   TVLKNIIDAPITVDKISKKEAEERAMVLLKKLGLEDKKDAYPFQLSGGQQQRVSIARAL
FT                   ALQPKILFFDEPTSALDPELTGEVLKVIKELAKEKMTMIIVTHEMQFAKELSDRIIFME
FT                   NGIIQEEGTPEEVFTTDNSRVKEFIGKFIG"
FT   gene            549766..550587
FT                   /locus_tag="Clocel_0438"
FT   CDS_pept        549766..550587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0438"
FT                   /product="ThiJ/PfpI domain-containing protein"
FT                   /note="PFAM: ThiJ/PfpI domain-containing protein; KEGG:
FT                   npu:Npun_R2060 ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50215"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032633"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE8"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADL50215.1"
FT                   /translation="MKKLLFILSEYGYWGEELIGPLETVEKAGYTVTFATSHGRRPHAL
FT                   PPSMDDTFIDPPLGRPVVSKEMAQKVKELEASSKLDNPINLSELLPERPYMSSSTYLRE
FT                   FEAYNEGVERVEEELKEYDAILLVGGSGPIVDMVNNQRVHDLILAFYRLGKPVVAECYG
FT                   VACLAFAREYWTRKSIIWGKRVTGHPLEYDYKDGTGFIGVDFNMGPPPYPLEFILRDAV
FT                   GPDGQFIGNVGRTISAIVDYPFITGRSTADSYKTGELLVQVLENGLKRYGW"
FT   gene            550611..552317
FT                   /locus_tag="Clocel_0439"
FT   CDS_pept        550611..552317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0439"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; thiamine pyrophosphate central
FT                   domain-containing protein; KEGG: npu:Npun_R2059 thiamine
FT                   pyrophosphate binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50216"
FT                   /db_xref="GOA:D9SQE9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE9"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADL50216.1"
FT                   /translation="MNVKTGKEAIIEQFLADGITHMFGNPGTVEQGFLDALEKYPDFHY
FT                   ILTLQESIAVAMADGYARKTKKPTVVQLHSGVGLGNGIGMIYQAKRGHAPLVVINGESG
FT                   IKYEAMDAQMAADVVAMAEPVTKWSTKVVDPESLLRVLRRAIKIATTPPMGPVFVCLPM
FT                   DILDAPIQDEIVPTSILNTRSYPEEKTLESAAEILASAKYPMIIMGDGITFSGAQEELV
FT                   KVAELIGAEVWGADSSEVNISASHPQFRGLLGHMFGEQSKKDVEEADAVLIVGTYIFPE
FT                   VFPLLKGIFANGAKLIHVDLDSYEIAKNFPVDIGIVSDPKSTLSKLAEVLDKTMAPDQR
FT                   LIAALNISRMVKEKAKTIEEMNSKDEKLMNSFPIYPPKFMQELARQLPKDAIIFDEALT
FT                   SSPDLNRYIPATVPGQFFQTRGGSLGVGIPGAMGIKLAAKDKTVIAFTGDGGSMYTIQA
FT                   LWTAVHHNIDAKFIICNNKSYRLLMQNIDQYWKERDIPKHEYPKSFILDNPDIRFDQLS
FT                   ESMGVSALRIEKPEEIADAVQRMLSTKGPFLIDLVIENNQYTSESVCKCGQ"
FT   gene            552340..552768
FT                   /locus_tag="Clocel_0440"
FT   CDS_pept        552340..552768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_2188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50217"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF0"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_2188"
FT                   /protein_id="ADL50217.1"
FT                   /translation="MLTRYEVNELVFKWFRKLDIHDTVEGFLPLLVAEGLEMNLPEGTF
FT                   KGIEGFTEWHHNIVNKFFDHTHTLAIVDIEIEEEKAKVKVVVNWQTKIWNPPDVKSTWL
FT                   GFDAYQTWIVEKDSKTGKAVIAKYTVDNLEPMLGSASL"
FT   gene            552802..553197
FT                   /locus_tag="Clocel_0441"
FT   CDS_pept        552802..553197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50218"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF1"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_0376"
FT                   /protein_id="ADL50218.1"
FT                   /translation="MKNVPDTPVGRLYSQHIHHVENQEIEALMNQYTDDCVLISSFTKT
FT                   PLYYRGKEQLREHLNGILDMKGLVTEVAFYSETENPQTLMVTEKITTIGENGEEVHMRF
FT                   ADSWVLRDGKIAIHFAGMVQYSDGSLA"
FT   gene            553290..554051
FT                   /locus_tag="Clocel_0442"
FT   CDS_pept        553290..554051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0442"
FT                   /product="ThiJ/PfpI domain-containing protein"
FT                   /note="PFAM: ThiJ/PfpI domain-containing protein; KEGG:
FT                   syd:Syncc9605_0828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50219"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032633"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF2"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADL50219.1"
FT                   /translation="MSKKILIIASNLGLWGEELQAPWDALKNAGHEVTLATMTGKTPLP
FT                   LVISMDDTFIDPMQGYNVNPKFVVDRIKKILETGQWNNPIKIEDAKMEDYDAIALVGGP
FT                   GSPFDIVGNNDVHKLLLEAYKSNKIIGALCYVVGALVLTRDPDNEKKSIIYGRKVTAHP
FT                   AAWDIYSPLKYPLYGASPKNPGTDITTPGFVYQLQPLVEDAVGPNGQVFSDPRTNRENP
FT                   LCIYDHPFVTALSVESSIAYGNRLVEVLGSL"
FT   gene            554086..554907
FT                   /locus_tag="Clocel_0443"
FT   CDS_pept        554086..554907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0443"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   syd:Syncc9605_0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50220"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF3"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADL50220.1"
FT                   /translation="MEASNMKVINKAGITIHISSSPLDGEKVNSIIVESQNKLVVIDVP
FT                   LLRPYSKDFRAYANQLGKPIDRVIITHAHPDHWAGLEAFEDLPIYSLSETQEEIQENGE
FT                   WMLTYHRSLHGDLITDKKIVPNNIIEEGKLIIDSVEYNAIKVTEAEYKHLLVLELPRIK
FT                   TLISQDMVYNKVYLFLGELTSTGELACDNWIDELKKYKEKNYEVVIPGHGEPTDSSIID
FT                   ENINYIIEAKGIIKTSKDSDEFKNRMIEKFPDYEIPLMLDMTAYFIYMQNK"
FT   gene            554932..555354
FT                   /locus_tag="Clocel_0444"
FT   CDS_pept        554932..555354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0444"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: npu:Npun_R2049
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50221"
FT                   /db_xref="GOA:D9SQF4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADL50221.1"
FT                   /translation="MVVFPISHVAISCKNPIQVEKFYTKYFGFKRARVYSTGPDQVVMI
FT                   KSGNTYLELFKSTKELPVPKSEGSGQDYPGWKHICFLVDDLEVKLNEMGEDAKISLGPT
FT                   DMSAFIPNMKVCWIEDPEGNIVELNQGYVDEENPPG"
FT   gene            complement(555455..556521)
FT                   /pseudo
FT                   /locus_tag="Clocel_0445"
FT   gene            556924..557568
FT                   /locus_tag="Clocel_0446"
FT   CDS_pept        556924..557568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0446"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: amt:Amet_4729 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50222"
FT                   /db_xref="GOA:D9SQF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL50222.1"
FT                   /translation="MAKILIVEDDISINELMKRNLSLIGHECKSIFDGQVALTAITQEN
FT                   FDLIILDVMLPGCSGFEIVKHIKAIPVMFVTAKDSLQDKLQGLSSGAEDYLVKPFEILE
FT                   LIARVNIILRRNNKNDDFILGLVRVNFKCRKVFFNDIEIEMTPQEYMLLEVLITNRNIA
FT                   MSREKLLELAWGFDYEGDTRTVDVHIQKLRKKLSLEEQIKTVYKLGYRLED"
FT   gene            557575..558978
FT                   /locus_tag="Clocel_0447"
FT   CDS_pept        557575..558978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0447"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: amt:Amet_4730 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50223"
FT                   /db_xref="GOA:D9SQF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50223.1"
FT                   /translation="MKFWTKTYFAVLILFLLVFNGSILGILHTTYQYILSSEKEKALGE
FT                   HHFIKNTIENDMDNLSVNNKLSQSAIENLMNYYSDYYDKQDVSFLLMKNSNVAFSNLQY
FT                   EEENLKEEFFNVDSGQNIILQGDTNSKFILVSGTIENSKDKYSFVYCYKLEGVIILWTK
FT                   LENTFVYFSFFISLVLALLLGLMLNKRSKPLKQLINFVDEIKDGNYHSKVQLHGRDEFA
FT                   MLGNNFNEMAEKIRETLEQLNNDMEMKQQFIDNLSHELRTPLTSIYGYADYIQKAAISE
FT                   EDKYESTQYIMEESKRLQYMANRLLDMTIRKQKSIVKEKIIVEELLDKVKRTITPIADE
FT                   KLISINISNTLSEIFGERELIESVMVNLLDNAVKASEEKGSIEILTIHFNGEDIIQIID
FT                   KGKGIAEEHLRHITEPFFRTDKARSKAEGGVGLGLTLCKQVMDMHDGKLKISSQLDKGT
FT                   TVSLIFTTL"
FT   gene            559089..559958
FT                   /locus_tag="Clocel_0448"
FT   CDS_pept        559089..559958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00312320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50224"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF7"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_00312320"
FT                   /protein_id="ADL50224.1"
FT                   /translation="MKKFIRKNTMLLIGATVLLVTLGTLLLKGGIHYYSKASMEKLENL
FT                   QADETTIEFISDEYRHKDDTFIEDPKPIDKVKQADLYNSIINSLERAQGKAINSEKEEN
FT                   ERRYQAVKDKVNVRKEDVKEIFKKKIYDAFGDILDISDIPDEQVLFIDTEYERYDWYLF
FT                   LRNEKSQKSYCGNINGISGEVTLLSRHDYKGLENPDIAGYVTWIKFELKNNKIDLYLNK
FT                   TKEIINKNNIANSQNNSIKSIAIKNTFYAGLRPFVDLEAKMQDKRKVRIAFYADTDELL
FT                   NIQVLSQY"
FT   sig_peptide     559089..559172
FT                   /locus_tag="Clocel_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.447 at
FT                   residue 28"
FT   gene            560035..560424
FT                   /locus_tag="Clocel_0449"
FT   CDS_pept        560035..560424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eat:EAT1b_0970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50225"
FT                   /db_xref="GOA:D9SQF8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF8"
FT                   /inference="similar to AA sequence:KEGG:EAT1b_0970"
FT                   /protein_id="ADL50225.1"
FT                   /translation="MKKILKDFLFGLLLMFNITICKFLVTLPFEMPMDFTNENYSYVIN
FT                   REFLVTSLPALVITLIYTRLLKTKTKADALRKSIIWTIVVILNYSLIGIGNDNFKIIFG
FT                   GWGIYSLIASVFIAPILSLYIRKHN"
FT   gene            complement(560455..561441)
FT                   /locus_tag="Clocel_0450"
FT   CDS_pept        complement(560455..561441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1992 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50226"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF9"
FT                   /inference="similar to AA sequence:KEGG:Clos_1992"
FT                   /protein_id="ADL50226.1"
FT                   /translation="MKNKKIALLITISLSIITLTSCTKDAQSSTSITAQNPKAEDSTFK
FT                   ADSSPSTKETTETTKTTENAEKITPANAVTKLDGRREEFLVRLDIIQKRLDLLPEKKNS
FT                   DAGITISMKSFYGDSYRCYDDALNEIYNLLKEQLSQDIMKNLEAEEINWITQKENAANA
FT                   AASEFKGGTFEPVAYNTSLYNSTKARCYELVNNYMTDSKFKINANKEEYLKELANIENE
FT                   LLSSQEYKDAGSGTTNSMFTYADKKYIKWDEQLNKIYSLLKQQLPSDEMSKLNKEELQW
FT                   ITQKETKAKKSEESQGVGSQLGSVAYQASLAFVTESRCYELVYKYMK"
FT   sig_peptide     complement(561370..561441)
FT                   /locus_tag="Clocel_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.858 at
FT                   residue 24"
FT   gene            561814..564501
FT                   /locus_tag="Clocel_0451"
FT   CDS_pept        561814..564501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0451"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="KEGG: hor:Hore_20540 regulatory protein LuxR; PFAM:
FT                   regulatory protein LuxR; Tetratricopeptide TPR_1
FT                   repeat-containing protein; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50227"
FT                   /db_xref="GOA:D9SQG0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADL50227.1"
FT                   /translation="MYQESSLINTKLNIPILSSKVIKRTNLFKKLNSFLDYRLILVTAP
FT                   AGYGKTTLITSWLSEKKKNKSTVAWLSLGEEDNEAECFWSYFFLSVYKKISEINHCIED
FT                   SKSFYNESATFNNLYLSHFINTIAKINEGIIIVIDDFHLITNDKIIENMKFLIKNMPDN
FT                   MHLLLISRNLPQLGLPRLRAADSVLEINQYDLCFTPEETTEFFEKVSGTKFTYDIYHKV
FT                   WSESEGWIAGIQMIGLSMKNSSRNITGDQDGKNNKFVFEYIAEEVFLSLEEDTKKFLLY
FT                   TSIIDEFSCALCDYLLDINNSSELIKEIEKANLFLVSIDNEQSCFRYHNLFRNFLRKQL
FT                   EKLGIETIHKLFNKVARWYENSNQLNKAVESYIKGKNFHKAVSIIEQLSGEIACRGEAR
FT                   VLHKWNQLLPIDIVKSNTRLIMNSAWAMVAEGDIGKVSEYIKMVQACEAVSFLKRSKGD
FT                   EERDSQVRVEILALNSSANLTIINEVEEIITDCEKAIPYLNEEEFLTQLIFFNIARAYF
FT                   LKGELGKAIHYFQKSLERSIKTKETYFRILTNKALTIYKKLQGNYKEAKQELEELISSL
FT                   KVNGDVISPVLGILYAELADIHYQWNEIDKAMELAREGLALGLAGEDSWVIAENNLILA
FT                   KLYNATNFHKEYQEIVDKTKKYLTDNKFFDTSLKFDSFNAEIMLSKGKVNPVLAWLSDI
FT                   APVISDDLIAIYPEVFIVKVKLYIYENQFDKARELISTIDKNVEKYQLNKVLVETKILS
FT                   AKVYKKLGYIAKAISEIEKAMELSWQQKITRIFLDEGSWMEDMLKKLKNRLSGDDVSLY
FT                   LDYLLVSFNSTSEIIIAVEDELLSKREIEILQSLEQGATNSEIAEKSFVSINTVKTHLL
FT                   NIYTKLDVHSRTRAVVKAKELKLI"
FT   gene            complement(564593..565087)
FT                   /locus_tag="Clocel_0452"
FT   CDS_pept        complement(564593..565087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0452"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: clo:HMPREF0868_0081
FT                   hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50228"
FT                   /db_xref="GOA:D9SQG1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL50228.1"
FT                   /translation="MNETGLLAGRTKMDWYAEMAGMICTVRAAALIIKDNNFLAAKSPD
FT                   YDCYYTVGGGVQINETSEEAIIREIYEETGYRLEIDKLAFVQERFYEVDKHRYHEIVFF
FT                   YLMIDSDDVNISDSSFTDLPKETLHWLPLDDLNKINLVPEFLKNKSFNNISNVEHIISK
FT                   E"
FT   gene            565419..566264
FT                   /locus_tag="Clocel_0453"
FT   CDS_pept        565419..566264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0453"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bbe:BBR47_51660 probable short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50229"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL50229.1"
FT                   /translation="MKVFKDKVAIITGAASGIGSAIAERCAYEGMKVVLADIDEGALRN
FT                   TEKVIKSIGVETLSVRCDVSKENDIRVLAEKTLEAFGEVCLLFNNAGVATGTLLWENTT
FT                   ADWQWVLGVNLWGLINSTKTFVPIMLKQNKECHIVNVASIAGFTACPGNGIYSVSKHAI
FT                   VNFSETLYYEMKLANAPIDVSVVCPGFVNTQLMNSERNRPSDLMNSLDSTSYGPQKQMF
FT                   EKIFHDGVLSGISPEQVVEEIFQAIPNKKFYILTHKESKDLIRKRMEDILNENNPTIYF
FT                   "
FT   gene            566417..567814
FT                   /locus_tag="Clocel_0454"
FT   CDS_pept        566417..567814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0454"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: mhu:Mhun_2065 FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50230"
FT                   /db_xref="GOA:D9SQG3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG3"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADL50230.1"
FT                   /translation="MKKIIIIGAGISGLSAGCYGQMKGYETEIFELQGTVGGLCTTWNR
FT                   KGYLIDGCIDWLIGINPDNYLYDSWKELGVFEGDGFIQHDYSMQVEDGLGKKLILYSDI
FT                   NKLEEHLLQLSPIDEPLIKELSEAIRISAFSSKTVKPVFNKKFATMSLYDFLQQFKDRF
FT                   LREALGVTLIPLQPKEYPVGTFIFRHSFYNRKDASWSIGGSLAFAQRIENKYKALGGKI
FT                   NYRVEVQEVIVKDNKAVGVRLADGSEHYADYVISTIDGYKTVFDLLKGKYLNDEIKQLF
FT                   NEEKDLPSSMQISLGIHCDLSEEPHNIVLKLKEPFVVGDKINSYLYLKQFSFDKLMCKP
FT                   GKSVITSIIETDYEYWDDLHKDIYKYNLEKERLCEIFIKIIEERFPQVKGKIEVTDVAT
FT                   PVTYNRYTGVWKGSYLGWWNMSATTLPAVLPGLENFYIAGQWAEALGGLPISMMTGKGV
FT                   ITKISEI"
FT   gene            568120..569127
FT                   /locus_tag="Clocel_0455"
FT   CDS_pept        568120..569127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0455"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cpr:CPR_0172 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50231"
FT                   /db_xref="GOA:D9SQG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50231.1"
FT                   /translation="MIHLEEVSREFKSYKKEPGFKGAVKALFSKETVVKTAVDKVSFHI
FT                   AEGEMVGYIGANGAGKSTTIKIMTGILVPTSGKCTVAGVVPYENRQKNAEKIGVVFGQR
FT                   TQLWWDLPLTETYSILKEIYNVSDEDFKERMEFLNKVLDLDEFINSAVRTLSLGQRMRA
FT                   DLAASLLHNPKVLFLDEPTIGLDVVVKENMRKAIKEINQKYKTTVILTTHDLTDIEELC
FT                   DRIIIIDKGKKIYDGSIEKIKREYGNKRILEMYVKNIKETSEIDVAKEFKLSAEECKTW
FT                   TNDNSILVEFDKNKINMPEIVAYVMSKVQIVDMKIKETDIEDIVKMIYGHEVKL"
FT   gene            569124..569951
FT                   /locus_tag="Clocel_0456"
FT   CDS_pept        569124..569951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0456"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   cpr:CPR_0171 ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50232"
FT                   /db_xref="GOA:D9SQG5"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG5"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADL50232.1"
FT                   /translation="MNPIKKIVKTYIPFTKVTIQRMMAYRVNFFLRILIDVFRMFIVYY
FT                   LWKAIFMNSENPVLSGFTADQMIIYIFISLITARIIDNNIDVGIGFEVKEGIIAMNLIK
FT                   PLNYKLTLFFNTLGGVFFNVFVISIPMWIGIVVIRFTTLGELPPNITTIFCYVVSALLG
FT                   FIIMFLFNFCFGLLSFYVTNLWGIVNLKGASIMFLSGQLIPLVFFPEWFQKLLQFIPFG
FT                   SVNYVPVMIYLQKINGSALVKALIIQMVWVFVLWFLSVAFWNKAVKRLVVLGG"
FT   gene            569954..570748
FT                   /locus_tag="Clocel_0457"
FT   CDS_pept        569954..570748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0457"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   cpf:CPF_0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50233"
FT                   /db_xref="GOA:D9SQG6"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG6"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADL50233.1"
FT                   /translation="MLRRYSRLYIKFVSQYFKSLMEYKIDFLVGCLGFFVAQASGIVFI
FT                   YLVFQNIPDLNGWDFYQIVFIYAFAQLPRGIDHLFTDNLWILGGWVILRGELDKYLLRP
FT                   INPLFHFLAEKFQLEALGELVIGIILMVIAGNKLNLHLNALDIILFIILVFAGALIYTA
FT                   IKLFAASLSFWIKNSQSLLNFIYNVSDFAKYPLSIYSLSIKIILILIVSFAFTAYFPAA
FT                   YFVNKESFVTGVLGTVAASIISFTIAYFTWIKGMKNYEGAGN"
FT   gene            570976..571359
FT                   /locus_tag="Clocel_0458"
FT   CDS_pept        570976..571359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0458"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="PFAM: Penicillinase repressor; KEGG: cbe:Cbei_1062
FT                   CopY family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50234"
FT                   /db_xref="GOA:D9SQG7"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG7"
FT                   /inference="protein motif:PFAM:PF03965"
FT                   /protein_id="ADL50234.1"
FT                   /translation="MNKLVSKITDSELEVMRVLWKAGNELPIAEIRRVLEEMSNWDTST
FT                   IKTLLRRLCEKGVVSVNKREVFYYSPLVSETEYNEYVTQSLIDRLYYGSAKKLVASLLG
FT                   SKKLRDSDIEELRTLFKVGNEDE"
FT   gene            571352..572947
FT                   /locus_tag="Clocel_0459"
FT   CDS_pept        571352..572947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0459"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="PFAM: peptidase M56 BlaR1; KEGG: cth:Cthe_3127
FT                   peptidase M56, BlaR1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50235"
FT                   /db_xref="GOA:D9SQG8"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR032250"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG8"
FT                   /inference="protein motif:PFAM:PF05569"
FT                   /protein_id="ADL50235.1"
FT                   /translation="MSDWIKLLLSMSLSGSILAIVIFAIKPFTKHKISKSIQYYIWLVV
FT                   LLRLIVPFSFEGSIMNNVFYGEQTIESAISENSSLPVKVQNEINPSIITTDQDSQVNTE
FT                   YKETYNDENNYGRQFLSVFNEVALYIWILGTVISIIVTLKGYFWFNKVLRYANKPATDE
FT                   ENKILLEVSCGKSNIRLARNKFIKTPMALGIFRPCIIIPDDDFDENQIRNILLHEVSHL
FT                   NRFDITIKWLTMIVTSIHWFNPLMYFIKKEINKACELACDENVIKGLNSQEKQAYGDTL
FT                   IAVVAESKYPLSILQATMCEEKRSLKERLVAIMNYSKKSKVTKFFSVVLLLSFISASIC
FT                   LGVGVGSNKYSIKNLFVSTKVVEFKDVNKGEYDLEEISKYKTPYVGDFSKVFAIVNQLI
FT                   IPDNAYTQRYISLETEKTPYGITIFYQTKEEKPDFSPSMLSNPNSDFNCNLRKNALILF
FT                   SMIGNVDTITFSFCDSPYSGELDKSKYNCETIFSRQQVLKDYYNFDSIKEDIGLLKEAL
FT                   ENTKKNYTLSKLES"
FT   gene            573138..574196
FT                   /locus_tag="Clocel_0460"
FT   CDS_pept        573138..574196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0460"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: cbe:Cbei_3073
FT                   D-galactose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50236"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50236.1"
FT                   /translation="MKILRMLFILIVSLLLIIMQTSNAKNNIFASENIKIANVAVVMND
FT                   FQHPQMLFIKQGLTDIQNENRDKVNFIFYDGKGNLAIQTEIINSLISNSNIDLMVIGLI
FT                   NPQSDVVEDIIRKADLRNMPIIMNDVNPETALKLSKGYSKVIFLKGKSEEVGILQGKIL
FT                   VDEWNNKGMDKNKDNILQYVMLKGETNNPVANVREKYSVSTINEAGIKTQQLALRVVNW
FT                   NKEIAKQAIEALLLKYDGNIEAIIANDDTIAIGAIEALQKYGYNKGNKSKYIDVVGATG
FT                   LQEVKDLIDKGFMTGTAIINYEAQAEAVYKIAMNLLNNESPIKDTNYTISDGFVVLTVD
FT                   YFPYTKKNNISS"
FT   sig_peptide     573138..573212
FT                   /locus_tag="Clocel_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(574932..575798)
FT                   /locus_tag="Clocel_0461"
FT   CDS_pept        complement(574932..575798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0461"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ere:EUBREC_2190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50237"
FT                   /db_xref="GOA:D9SQH0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADL50237.1"
FT                   /translation="MKENRQVSVSGMLKILGVSRSGYRAWQKHMPSDTQKRKEAVKVKI
FT                   KDIYDDSKQNYGAPKIAKKLQQDGEIISQRTVGKYMKELGIKAQWIKPWTVTTKDSDFS
FT                   NELQNILDEQFNPERPNAVWCSDITYIWTTERFVYLTSIMDLYSRKIIAWTLSKTLEAA
FT                   CVIETINKAKARRNTEQPLILHSDRGSQYVSNEYRKATETMQLSYSKKAFPWDNACIES
FT                   FHSLIKREWLNRFKICNYRQSYRLVFEYIEAFYNTQRIHSHCDYMSPDDFEKLYEKAKK
FT                   EGMLLAS"
FT   gene            complement(575843..576127)
FT                   /locus_tag="Clocel_0462"
FT   CDS_pept        complement(575843..576127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0462"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ere:EUBREC_2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50238"
FT                   /db_xref="GOA:D9SM09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SM09"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADL50238.1"
FT                   /translation="MAKHLDKQFKIDAIQYYQDHKELGLVGCAKNLGISQQTLSRWQKE
FT                   LRETGDIESRGSGNYSSDEAKEIARLKRELRDTQDALDVLKKAISILGK"
FT   gene            576282..577487
FT                   /locus_tag="Clocel_0463"
FT   CDS_pept        576282..577487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0463"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA-binding S4 domain
FT                   protein; KEGG: cdl:CDR20291_1370 tyrosyl-tRNA synthetase;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50239"
FT                   /db_xref="GOA:D9SQH3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH3"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADL50239.1"
FT                   /translation="MVNIDEQIKIIMKGVDEIIGLDSLKEKIEKANENGKPLIVKLGLD
FT                   PSAPDIHLGHTVVLRKMKQLQDLGHKVIVIIGDFTGKIGDPTGKTKGRKALTTEQVLEN
FT                   ARTYETQIFKVLDKDKTEVRFNSEWLSQLSFEETIKLAATMTVARMLEREEFKKRYENQ
FT                   VPISVHEFFYPLMQGYDSVAIHADIELGGTDQRFNVLMGRMLQKEYGQEPQTTIFMPLL
FT                   EGLDGKEKMSKSLGNYIGIDEKAEVMYEKAMTVPDNLIIKYFNLVTDMHPDKVKELEST
FT                   LRDEKVNPRDIKMRLAKEIVRLYHGEKEAEKAEERFMLIFQKGKIPTDIETVNVSENNF
FT                   DIGEILVSEKFVASKSDLRRLIDQGGVKINNNILKDLAEIKIEKEMIVQVGKKKFIHIS
FT                   IA"
FT   gene            577645..578463
FT                   /locus_tag="Clocel_0464"
FT   CDS_pept        577645..578463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0464"
FT                   /product="transcriptional activator ligand binding domain
FT                   protein"
FT                   /note="KEGG: dhd:Dhaf_2598 transcriptional regulator, MerR
FT                   family; PFAM: transcription activator effector binding;
FT                   regulatory protein MerR; SMART: transcription activator
FT                   effector binding; regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50240"
FT                   /db_xref="GOA:D9SQH2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH2"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL50240.1"
FT                   /translation="MFKIGDFSRLTRVSVRMLRHYDELGILKPEATDDFTGYRFYSIEQ
FT                   IPKVNRIQVLREMGFSLSEISGLMEQDLGSKQLLSLLDNRKRAISETIEKEQEKLLRVE
FT                   NLIKFIHREDSRMNYDITIKSIPSYKVIAVRDIIPTYEGEGKLWDELCAFAGKNNIKAI
FT                   GPSYAIYYDTGYKESDVDVEVVMTISGDIAETVRVKVKELEAVDEMAVVFHKGHFHEMT
FT                   SAYRALAIWLSANEYEMNGPIRAIYHKGPWSEQNPEEYLTEIQAPVVKKK"
FT   gene            578669..579640
FT                   /locus_tag="Clocel_0465"
FT   CDS_pept        578669..579640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0465"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   chl:Chy400_0405 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50241"
FT                   /db_xref="GOA:D9SQH4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH4"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADL50241.1"
FT                   /translation="MESLTKNKQTRETIKSMVEKAFDGVSILKVEELKEGFFNVAYSLE
FT                   LSDGREVILKIAPPKDSIIMTHEKNIMYSEVKSMKMIAENTDVPVANIIYYDDTHTLCE
FT                   SDYFFMNKLSGKSYSTIMNELTDEEKRKIDYQIGKLNAKINSITGNKFGYYGQPEKQGY
FT                   KWFETFVTIMKDAIEDANSMDIELGVEAKFILDLLEKDKEYFDEVKIPKFIHWDLWAGN
FT                   IFIENGAVTGLIDFERCLWADELMEVGFRTYGYNENFFSGYGIDELTESQKVRAKWYDM
FT                   YLFLIVTLECDYRHYGDRGAYQWGTDMTREWVKDNYNHRTHD"
FT   gene            579915..582434
FT                   /locus_tag="Clocel_0466"
FT   CDS_pept        579915..582434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0466"
FT                   /product="Dockerin type 1"
FT                   /note="PFAM: Dockerin type 1; FG-GAP repeat protein; KEGG:
FT                   cth:Cthe_0246 carbohydrate-binding family 6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50242"
FT                   /db_xref="GOA:D9SQH5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH5"
FT                   /inference="protein motif:PFAM:PF00404"
FT                   /protein_id="ADL50242.1"
FT                   /translation="MLKKALLSVFMGAAVLLGSIAPQTITTTAATARQMENLDRGVVAV
FT                   KVSNGVFVSWRVLGTEATNVSYNLYRDSVKVANITGASNYIDASGTTTSKYSVSAVVNG
FT                   VEQSKSTAVSVLGNNYMQLPLQIPAGGKTPDGVAYTYNANDCSVGDLDGDGQYEIVLKW
FT                   DPSNSKDNSQKGYTGNVFLDAYEMNGTRLWRIDLGKNIRAGAHYTQFMVYDLNGDGKAE
FT                   VACKTSDGTKDGVGTVIGNASADYRNSSGYILSGPEYLTIFQGSNGKALNTINYEPGRG
FT                   NVSSWGDSYGNRVDRFLGCIAYLDGVHPSLVMCRGYYTRAVLVAYDWNGSTLTKRWTFD
FT                   SNTSGNSGYAGQGNHNLSVADVDSDGKDEIIYGGCTIDDSGKGLYTTGLRHGDALHVSD
FT                   LDPSRPGLEVWSCHEDTSGNGGIGGSFRDAKTGQVLWSFKAANDTGRACSADVTAAYPG
FT                   EEVWASGSSLYSSKGENIGNRPGPVNFAIWWDGDELRELLDDTTISKYGGGNLLSVSDC
FT                   DSNNTTKATPCLQADILGDWREEVIWRTTDNKYLRIYTTTATTSRRIYTLMHDPVYRMG
FT                   VAWQNVAYNQPPHTGFFLGSGMSTPPTPAIYLAGAVAPVPIPEPIPDGQHIKTLTVKDT
FT                   DNAADWSIQSNLQVGDIVYGDRTNKFSVIPSKLLGAEWIRTACDSKLYTSDLAAFTTKS
FT                   DVSVYVGLDARITSIPSWISSWINTGEVLTNDSAVTFNLYKKDFSANSNVVLGTNGASS
FT                   SSVNYTVIVVPNTAPTLIYGDVNGDGVANAIDYAVMKKYLLGTITSMPSANWQKVGDLN
FT                   SDGVINAIDYAYFKKYLLGSITKLPVS"
FT   gene            582826..583035
FT                   /locus_tag="Clocel_0467"
FT   CDS_pept        582826..583035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0467"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: cbe:Cbei_0704 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50243"
FT                   /db_xref="GOA:D9SQH6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL50243.1"
FT                   /translation="MKNKIQELRKERKVTQSELADAVDVTRQTIISLENGKYNASLILA
FT                   HKIAQYFQLQIEEIFIFDLEEENI"
FT   gene            583032..583499
FT                   /locus_tag="Clocel_0468"
FT   CDS_pept        583032..583499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50244"
FT                   /db_xref="GOA:D9SQH7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH7"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0703"
FT                   /protein_id="ADL50244.1"
FT                   /translation="MILKMLMSQTGTDKDYKEVLKKRIGLCYVVVVLGLSTLGLALFFS
FT                   SHLSSFLSGVYTGIGAGLIGAGIALIIKMKRVLKDEKKIKQKRLSEQDERNIMINQKAV
FT                   QASTIVILVLAYLGLMVSGIFNLIVFWTLWVVVAVFMVVFVIFSFYYNKKY"
FT   gene            583651..583851
FT                   /locus_tag="Clocel_0469"
FT   CDS_pept        583651..583851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50245"
FT                   /db_xref="GOA:D9SQH8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH8"
FT                   /inference="similar to AA sequence:KEGG:CLK_0825"
FT                   /protein_id="ADL50245.1"
FT                   /translation="MKKRKLVKGNIILSMGLLTLSATLILEQTLNLPHFVSGVGLGIAI
FT                   GLEIFGLYLMGKNKKQATGEK"
FT   sig_peptide     583651..583734
FT                   /locus_tag="Clocel_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.625 at
FT                   residue 28"
FT   gene            complement(584103..584903)
FT                   /locus_tag="Clocel_0470"
FT   CDS_pept        complement(584103..584903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50246"
FT                   /db_xref="GOA:D9SQH9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH9"
FT                   /inference="similar to AA sequence:KEGG:Cphy_1635"
FT                   /protein_id="ADL50246.1"
FT                   /translation="MISFPLLKREIKANYKLLLIFMGVLTMYVSMIVYMFDPKIGETLQ
FT                   AFEESMPGVMAAFGMSNMGTTLTEFLTSYLFGFLLLIFPMIFEIILSNKLIARYVDRGS
FT                   MAYILASPNSRKKIAFTQGLFLIKSIAILLTYTMIVGIVTSEIAFPGSLDIPKYILLHV
FT                   GLLCLHIAISGLGFLTSCLFNDTKFSYAISAGVPIGFYLIQMLANMGGHLENLKYITIF
FT                   TLFDTDKLIAGDANGIFMILILLVSGLILYAAGIWQFNKRDLPL"
FT   gene            complement(584896..585795)
FT                   /locus_tag="Clocel_0471"
FT   CDS_pept        complement(584896..585795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0471"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cpy:Cphy_1634 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50247"
FT                   /db_xref="GOA:D9SQI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQI0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50247.1"
FT                   /translation="MKIIELNHITKDYGDGKGVFDISFSVEKGEVLGFLGPNGAGKTTT
FT                   IRHLMGFSHPDKGSCSIDGLNCTTESAEIQKKLGYLPGEIAFMDDITGMEFIKFVGSMK
FT                   GMKDYSRAEALIKKFELNPKGRIKKMSKGMKQKIGIVCAFMAEPEILILDEPTSGLDPL
FT                   MQNKFVELILEEKAKGTTILMSSHMFEEIERTCDRAAIIKSGKIVAVENISTLKESRCK
FT                   TYMITLETPQMAETFSEEPSISDKVTKVENNLVTLSIQGDIMPFIETMTRYKVVSLNIA
FT                   TLSLEELFMHYYGGAKND"
FT   gene            complement(585795..586412)
FT                   /locus_tag="Clocel_0472"
FT   CDS_pept        complement(585795..586412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0472"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cpy:Cphy_1633
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50248"
FT                   /db_xref="GOA:D9SQI1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQI1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL50248.1"
FT                   /translation="MNEKFLALPEEKKQRIINSAMQVFSKNEYKRASTDDISALAGISK
FT                   GLLFYYFHNKKSLYLYIYEYSAEIARTNICNENYEKIDDFFELLFHSMNAKMKILKTNP
FT                   YIYDFSLRAYFETDKTVREDISMYNETAINSSFEKYFKNINFNKFKTEVNPEHILKMVY
FT                   YMFDGYMREQARTGMKDLEIIKADITSWLQIIKNSVYKEAYL"
FT   gene            586633..587391
FT                   /locus_tag="Clocel_0473"
FT   CDS_pept        586633..587391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0473"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   cyc:PCC7424_1357 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50249"
FT                   /db_xref="GOA:D9SQI2"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQI2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50249.1"
FT                   /translation="MIHLKRFIPDSDIRNWVGPFQDKDDYFNLGKSQAEEIINWLNIKP
FT                   VDKILDLGCGCGRIAIHFLDYLNEEGKYIGIDNNKELLSYCSENISAVKENFYFQFLDV
FT                   YNGAYAKEGKLKVQEIKLPIERSSIDSVILWSVFTHMYIDDINSYLKESNRVLKENGTI
FT                   IVALNIINDFSKKQMEEGKAVLKMKYSVDDYSCTLDRDTPESGFGHSEDKIKELFWNNN
FT                   FIIREIKYGSWCCGQIGGEFHDCIIAQKSL"
FT   gene            587591..588616
FT                   /locus_tag="Clocel_0474"
FT   CDS_pept        587591..588616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_3396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50250"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQI3"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_3396"
FT                   /protein_id="ADL50250.1"
FT                   /translation="MRKILIGSYTNKEKSGIYQYDFDEHNVKAKLVKTYDELENPSYLI
FT                   VDYPSSSVYVVSETKAGAVGRYFLDDDIKLHYKESQLTKGDDPCHLARYNEELIVCNYS
FT                   SGDMSIHSVKMAGKVSEEKQTIKHQGYGVNPKRQEAAHIHFVSPTPDNALISVVDLGID
FT                   AVIFYEKHQDKYIEYSRLLCEAGSGPRHLVFHKDLNLIYVVNELSSTVSVYKHEGDYKV
FT                   FTLIQNISTIPDSFVENNQCAAIVMSKDFYYLYITNRGHNSVAYFSIDDVSGKLTLVNI
FT                   ISTEGKWPRDCALAPTQDYLFVANEHSDSVSIFKRNIFDGSIKFHSAIAVSEPTCIAFI
FT                   K"
FT   gene            589032..590309
FT                   /locus_tag="Clocel_0475"
FT   CDS_pept        589032..590309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0475"
FT                   /product="Guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="KEGG: cbe:Cbei_1972 guanine deaminase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50251"
FT                   /db_xref="GOA:D9SQI4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQI4"
FT                   /inference="protein motif:PRIAM:3.5.4.3"
FT                   /protein_id="ADL50251.1"
FT                   /translation="METTEEIIKILKGNIVYTETCNSFEMVENGYIVVDGNYVEGVYKD
FT                   LPDKYKHFNIKNYGDRLIIPGFIDLHTHGAQFAIRGIGYDKELLPWLETYTFPEEAKFS
FT                   NKDYAEKVYREFVNELYTEGTTRAVIFGTIHQEATEILMELLEGKEIISYVGKVNMDRN
FT                   CPDFLKENADESIRTTIQWIESCHNKYKFVKPIITPRFVPTCSDSLMKALGDIAINNSI
FT                   PVQSHLSENTDEIKWVGELHPDCESYGAVYDKYNLFGKTKTIMAHCVHLTEEEISKIIK
FT                   NQVFIAHCPSSNINLSSGISPISKLLKNNAPLGLGSDIAGGETLSMLSVMSCAVKVSKL
FT                   RKVCYGEDEMSLTIPEVFYLATKGGGKFFGKVGSFEGGYEFDALVIDDDNLWKVRKGKI
FT                   EERIERLIYLGSSKNIMSRYVFGKEV"
FT   gene            590890..592980
FT                   /locus_tag="Clocel_0476"
FT   CDS_pept        590890..592980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0476"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: cac:CAC3352 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50252"
FT                   /db_xref="GOA:D9SQW4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50252.1"
FT                   /translation="MKSIKFKIFFAIVISSVLIALLIGSISITNSTNVAETNSKEKLTL
FT                   ICEKKTNELNGTISNIEQSVNTLGDIVVENLDDVNKFSTDLNYLQNYQNGIEEIAKAFG
FT                   KNTEGAMTFYIRFNPKLTPPTSGVFYSKPNANSEFEKLVPTDFSKYDPSDTAHVGWYYI
FT                   PVNAGKPVWLDPYLNSNINVQMISYVVPIYKDGKSIGIVGMDIDFKSIQGIVQDTKAYD
FT                   TGYAFLLNEKHNVLSHPEFSMNENFGTIENGIFKSITEDMNKSSVSEKLSSYKYKNINK
FT                   NLTFTHLSNGWIFAVAAPSSEILAQSNKLMKIIGLFSILGMVLSGVVAFGLGNIIAKPI
FT                   VKITAIMKKLENLDLTHDKELDSLLKSKDEIGQLSKAFDNMRGEFVGLIKQILEKSKSI
FT                   SDSSEELSATVEELTVKADKIENAVEHIAYNVQETSSASEEISASIQEVDFSVNLLADK
FT                   ATDGNNSANQSKERAQEVQKQGKISAEETRNLYNEKKENGLKAIKDGKIVEDIKLMAET
FT                   IAGISGQTNLLALNASIEAARAGDQGKGFAVVADEVRNLAEQSAEAVSNIQSTITKVQA
FT                   AFRNLSDNSKEVLDFIHENVDPQLETMEKIGQQYYCDSEFVTRMSDEIAVMSKELTSTI
FT                   GQVNEAVQNTAQIAQKSALEAETIKDSISETTKAIEQVATTAQNQAALAEKLNEMVNRF
FT                   KI"
FT   sig_peptide     590890..590994
FT                   /locus_tag="Clocel_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.444 at
FT                   residue 35"
FT   gene            complement(593153..593800)
FT                   /locus_tag="Clocel_0477"
FT   CDS_pept        complement(593153..593800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0477"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cbe:Cbei_0359
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50253"
FT                   /db_xref="GOA:D9SQW5"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50253.1"
FT                   /translation="MSLEEMSSFFTKRVEDYDNHMINEVEGCRDGYEKIAEFVPSTTNN
FT                   LLDLGCGTGLQLEKIFNKLPNLKVTGIDITKAMLDKLKEKYETKDLYLINASYFDYDFG
FT                   IEVYDTAISFQTLHHFSHKDKRTLFEKIYTTLKTNGFYIEGDYMVQSQEEEDFYYAENK
FT                   RLREEMGVMDGFFHYDTPCTIENEINLLKSVGFSQVKKLWQKDNTVILVAKK"
FT   gene            complement(593927..594196)
FT                   /locus_tag="Clocel_0478"
FT   CDS_pept        complement(593927..594196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0478"
FT                   /product="Mor transcription activator domain protein"
FT                   /note="PFAM: Mor transcription activator domain protein;
FT                   KEGG: cbe:Cbei_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50254"
FT                   /db_xref="GOA:D9SQW6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW6"
FT                   /inference="protein motif:PFAM:PF08765"
FT                   /protein_id="ADL50254.1"
FT                   /translation="MSYIKATDVLPEEILLLIQQYVDGEYLYIPRKETNKKSWGENTNS
FT                   RKELSLRNSNIYNDYRKGLNIKNLSSKYFLSEKSIQRIIRQSNR"
FT   gene            594813..596486
FT                   /locus_tag="Clocel_0479"
FT   CDS_pept        594813..596486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0479"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory transducer
FT                   with cache sensor; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50255"
FT                   /db_xref="GOA:D9SQW7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50255.1"
FT                   /translation="MKIKTKLILSISLIVVLSLISISSSFFVSRLQKNDALLINVAGRE
FT                   RMLSQRISKNVFLLFSKDKLEGTEIEAVKKELSASVALYDETLSGFLYGGEITSASGEK
FT                   VTISDIGDDKVYAADINEIWIEFKKATDKVLLNQDESALQYIKENSNELLKRSNDVTVA
FT                   LEKTSEKKLQLQHDIQLASAIVIVILFTFVVLIISKDVVKPINDLVVLTQRVAQGNLNI
FT                   KFDDRYKGEFKVLFRNFSIMVNNLRDSIKDTVKICDDVMYESQQLTSYSEMIANSSKEV
FT                   TKAIEEVANGATDQANEVATSLKITQDLSSLLDKMIDYVSRTKQSVVLMQDSSNNCISQ
FT                   IQQLEGAIEGNLCENKKINSDIFVLSEKSSDISSILTTITTIAEQTNLLALNAAIEAAR
FT                   AGEQGKGFAVVAEEIRKLAEASGVAANQIQLIVSDIVDVIMTTRNAMDAMDKTMRITTE
FT                   TMDDTKQSLRVIENSIDSVIDNTDTEAKAINEISYHKEEVLQNIQHISSIIEMSAAAVE
FT                   EISATTVQELQDIENLNRSIFNLNDKVKKFEETNKHFNLE"
FT   sig_peptide     594813..594914
FT                   /locus_tag="Clocel_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.541 at
FT                   residue 34"
FT   gene            complement(596634..598100)
FT                   /locus_tag="Clocel_0480"
FT   CDS_pept        complement(596634..598100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0480"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cno:NT01CX_0592 methyl-accepting chemotaxis
FT                   protein, putative; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50256"
FT                   /db_xref="GOA:D9SQW8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50256.1"
FT                   /translation="MFHKKNKVVNVLKVINNVQVSDNTTDDNLQTKDITGGNGFNTFFK
FT                   HFKKYYSFIIEIGKNNFSLASKLSSFNVILHHRSQLIKEKSKVVAEAAQSTLAATEETN
FT                   ASINEVTNVLAKYTTTSEKVAEETKKLLELNAQNTCNLDDAISTSSKTILKSEELVETM
FT                   ENLQLALREINFIVNGVHQIAEQTNLLSLNASIEAAKAGDAGKGFAVVADEIRKLAENT
FT                   KEKLQAMNEFTNKISLTTKESLAKVQDTISSVTIANKKITAVHKSFDSSNAKLIKVASD
FT                   VDEFSTSITDIMASVEQINAAMSMIGSDAEKLTIESNTLEYEANQLNSLGEQANDAIDL
FT                   AKQITASTGNLFSHSLYQLTNEDFKAYLLSSISNHKKWVNELHRMSQTNTIEPLQLDGT
FT                   QCAFGHFYNSIKPYNKEIHPIWDSINKDHLDLHDIGHDVINAIKKKDDADKEKKLQLAD
FT                   KLSNSVIYKLQQILRILRDNPDIIIFSELN"
FT   gene            598455..599900
FT                   /locus_tag="Clocel_0481"
FT   CDS_pept        598455..599900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0481"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: cbe:Cbei_2435 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50257"
FT                   /db_xref="GOA:D9SQW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50257.1"
FT                   /translation="MLRKIKKFIFIIENSGLTKEEIIEFEKKRINLNVSRTNKPIVAVF
FT                   IFSSIQIVIDIFDIVLGKNDIKQLSNIFLLHVFAVIFSLLWVLFYKFKDKYNIFRMLEK
FT                   TYYLFNVIFVVICANNSVNNLAVSGQISPYIISCFVFAWVLLIPPKISVTTLIAGAIGF
FT                   LIRVRFEGLPHNAWMGVLISVVICTIFSVIMSINSYSNFLGQYINNKMLVEINRKLEAL
FT                   EKDRLEFFANISHELRTPINIIYTANQMINVTNKNSSCPIKALSKYSNMIQQNCNRLIR
FT                   LVENVIDITKIDSLSFEVRLINADIINILEETYFSIRDYVEKKGLKIYFNTNIDKKIIA
FT                   CDPYNIERIILNILSNSIKFTKPGGEIKISITSDENFVYISVSDTGIGIPENMIDRIFE
FT                   RFVQVDKSTMRQNEGSGIGLSLVKGLVELHNGTISVNSVLGKGSEFIIKLPNKITEKEN
FT                   NISQLGLISDSTEKVSIQFSDIY"
FT   gene            complement(600303..600722)
FT                   /pseudo
FT                   /locus_tag="Clocel_0482"
FT   gene            complement(600744..601010)
FT                   /locus_tag="Clocel_0483"
FT   CDS_pept        complement(600744..601010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50258"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX0"
FT                   /inference="similar to AA sequence:KEGG:BF4188"
FT                   /protein_id="ADL50258.1"
FT                   /translation="MKKRIIYLLMAFSTYISILSTTVFAETTPLPEVQNTFSENIRTNG
FT                   SFGTSTLLTLRNKLIKKVRYVDTLFDNYILDKDITYKTAINYL"
FT   sig_peptide     complement(600933..601010)
FT                   /locus_tag="Clocel_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            601439..603190
FT                   /locus_tag="Clocel_0484"
FT   CDS_pept        601439..603190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0484"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cbe:Cbei_3356 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50259"
FT                   /db_xref="GOA:D9SQX1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50259.1"
FT                   /translation="MIKFYKKFKISTKLIALVILLAFFIAITGLIGIFNMSLINMNTAT
FT                   LHDYNIATIKEVNKLRESYSGIKTDLIELAHDESKTDSRNEQLINEVGELSKRGNEAFD
FT                   KIKTANEMARAFKSPEDAQKDIDTLEKIDRSAKEFLTMSDRLADSVKKGDYPLAAIQLS
FT                   KASQTIERLFSALDDLSLIIDGEADGVYEFNKSIFNTTKNIIIIISVGAFIISLILGLL
FT                   ISIRLSKNLKKVGKFAENLGNGDLTKDIDINSKDEIGNIAEALNKSKDNMKLLISEAIR
FT                   SSNDIGAVSEELSATTEEVSSKMYMVNQATEQINKGIQELSATTQEVSASTEEIGNTTE
FT                   KLNDKANESFKSAVEIKNRASDIKKKATKNIEEGNAIYERTRGNILKAIDDGKVVKEIT
FT                   IMADSIGSIAEQTNLLALNAAIEAARAGEAGKGFAVVAEEVRKLAEQSSEAVSGIQSMV
FT                   DKIEDAFRNLSNGGQEVLDYLETGVKPSYQLLMTTGVQYEKDAEFINEMASDIANSSKQ
FT                   MKLVIDQVAHAIENLSSTATQSATNSEEILNSINEMTGAIGDVAKSAQGQAETSHKLTE
FT                   VISNFNV"
FT   gene            603551..603964
FT                   /locus_tag="Clocel_0485"
FT   CDS_pept        603551..603964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0485"
FT                   /product="protein of unknown function CGGC region"
FT                   /note="PFAM: protein of unknown function CGGC region; KEGG:
FT                   cbe:Cbei_5051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50260"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX2"
FT                   /inference="protein motif:PFAM:PF08821"
FT                   /protein_id="ADL50260.1"
FT                   /translation="MDFKYVVIIQCEIAHKRCSGFACTNAFYNRDEVFAGYGENTRYIS
FT                   FTCGGCCGKGIASKLEHFSKKLKSKTSIEKNEVVIHLSSCMATDNYHYDRCPHLEYLKN
FT                   IIAKKGYTNVVEGSYISKGAARKREEEIYKTYE"
FT   gene            complement(604091..604801)
FT                   /locus_tag="Clocel_0486"
FT   CDS_pept        complement(604091..604801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0486"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   cpy:Cphy_0405 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50261"
FT                   /db_xref="GOA:D9SQX3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX3"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADL50261.1"
FT                   /translation="MSKAYLTIDDGPTKNTKGIIDFLNSKNIKPLMFFVGENICKNRDI
FT                   GIYAIQNGAIIGNHSYSHPEFSNLSLDECISEIERQEEQVNLLYKDAGVTREYKLFRFP
FT                   YGDKGGKNKDALQKYFREHGFSRIDDSEIKYDWYHENNLNTDYDVLWTFDFAEYMLEYE
FT                   PGFTYDTILSRINDVNPKIGGSLFASNVHNIILIHDHEETDAVCPNYFYNLINYVLEKG
FT                   VEFVNPKFIISSSN"
FT   gene            complement(604973..606550)
FT                   /locus_tag="Clocel_0487"
FT   CDS_pept        complement(604973..606550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50262"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX4"
FT                   /inference="similar to AA sequence:KEGG:CLH_1048"
FT                   /protein_id="ADL50262.1"
FT                   /translation="MKNFKLKTLILSTLSTLLITSIPVTAETLPSLFYHSNSQPMVYVE
FT                   PSVNSLSIVGYSDSIRFDRTSDDLSSFFRPNLDKLPNNIYHWANSKGAIAYIGTVQSGF
FT                   GAGKPGTFLDGSDWSYNDFYFGGTIDTQMNIRSFSDIPDGYHTLKFVVVNPDFKATTSV
FT                   ITSSINLRVCRLSKHISNTILPVNSKLIIKLPKPIDPNTDLYNYVDVYFKDSGNKTVIL
FT                   PTLGADNQTLTITPITSKFIQNTNYELFISPGFRFADSTESFDGTIFDFTTSDKEELAT
FT                   TNFDISSELDKANILINSGNAKISDYNLFGINGITEINLADVNEYVQGKDNSTIANLQS
FT                   NVTAIRLPMNHVNMGSKVISYYTALGATAVTSENVKPISSAIKNAVQLKGSNLTKTEIF
FT                   KVINDTLIQINNSTIRINNGQGTLADYTLLDITKVTDFNLSDINEYVKGKDNTTNSKLQ
FT                   SNVTTVVTALNSINSGSSTVKYYTTLGITSVNASNIKSISKAVKNAAKLKGSNLSKSEI
FT                   LQVINSTR"
FT   sig_peptide     complement(606470..606550)
FT                   /locus_tag="Clocel_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            607125..607751
FT                   /locus_tag="Clocel_0488"
FT   CDS_pept        607125..607751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbf:LBF_3233 serine phosphatase RsbU,
FT                   regulator of sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50263"
FT                   /db_xref="GOA:D9SQX5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX5"
FT                   /inference="similar to AA sequence:KEGG:LBF_3233"
FT                   /protein_id="ADL50263.1"
FT                   /translation="MKLKGILRKFLKDKNTRFITIDLSTTILMFSIVILATLIFIATML
FT                   SGLLVLIIGPIYTHVFQILLIGLIVALSVIFIILLAIKMFFIFSTVRTKNLMEVFCSGG
FT                   IKKMMQRIAMIFLIICSITFVLFKGSEKTVNTIRDIPHLIKNDYISIDGIIEIKDDTDG
FT                   TGYVRVDDTYFYEGFAYEPGVINGNKYHVEYLPHSKYIVNFTLIE"
FT   sig_peptide     607125..607301
FT                   /locus_tag="Clocel_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.359 at
FT                   residue 59"
FT   gene            607973..608545
FT                   /locus_tag="Clocel_0489"
FT   CDS_pept        607973..608545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0489"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ckr:CKR_0849 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50264"
FT                   /db_xref="GOA:D9SQX6"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX6"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADL50264.1"
FT                   /translation="MKNTRDLILVALFAALTAVGAFIKIPIPYVPFTLQYFFCALAGII
FT                   LGSKLGALSQIIYVAVGLVGAPVFTDGGGITYIFKPTFGYLIGFIVAAYVIGKIREKII
FT                   ELTFIKTVLAFLSGLFFIYLFGVIYLYISYNLYLGKSISFYFAFFYGFITCIGGDLVLT
FT                   VLASYIAIRVLPILKKAGYISKISTSL"
FT   sig_peptide     607973..608038
FT                   /locus_tag="Clocel_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.574 at
FT                   residue 22"
FT   gene            608734..609717
FT                   /locus_tag="Clocel_0490"
FT   CDS_pept        608734..609717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0490"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="SMART: biotin and thiamin synthesis associated;
FT                   Elongator protein 3/MiaB/NifB; TIGRFAM: biotin synthase;
FT                   KEGG: ckr:CKR_1576 hypothetical protein; PFAM: biotin and
FT                   thiamin synthesis associated; Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50265"
FT                   /db_xref="GOA:D9SQX7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX7"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADL50265.1"
FT                   /translation="MINLIKDLEKKVLEGETINFQEAMDLASIEGKAEIKELCNSANNI
FT                   RKFFCGNEVDLCSIMNAKSGQCSEDCKFCAQSAHYKTKVEVYSLVSKEAAVKLAKENES
FT                   EGVNRFSLVTSGKGLSKNDFPKVLEIYKALNEKIKIDLCVSLGILEYQEFLKLKDVGIT
FT                   MYHHNLETSEEFYSKICTTHSYQERIDTINAAKKAGVDICSGGIIGLGETFEDRISLAL
FT                   KLRELEVKSIPINILNPIEGTPLENNEALSQEEILKTVAIFRFINPKVLIRLAGGRNLI
FT                   NQYGKECFNAGVNATITGNYLTTSGNKICDDKAMIRELNLEVRKNV"
FT   gene            609710..610507
FT                   /locus_tag="Clocel_0491"
FT   CDS_pept        609710..610507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0491"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="KEGG: ckr:CKR_0850 hypothetical protein; TIGRFAM:
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50266"
FT                   /db_xref="GOA:D9SQX8"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX8"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADL50266.1"
FT                   /translation="MSKGIFIVGTDTDVGKTIVTAGLLYALRSRGYNATYFKAALSGAI
FT                   EEGDKLIPGDTKIVSDVSNLSEVYENMTPYIYKTEVSPHLAAIIEKKPMDLKVIKEKYQ
FT                   YLKEKYDYIIAEGSGGIICPLIDDEKGIYTLDNLIKDLNFSVIIVARAGVGTINHTVLT
FT                   VKYIENLGIKIKGIIINNYEENHIADDNIRIIEKLTRIPVIAKLKGINILNEYITEGVK
FT                   DLDKDEVMETINGTAYGDRIQAIREAAELAFDSEKIISLMETL"
FT   gene            610528..611892
FT                   /locus_tag="Clocel_0492"
FT   CDS_pept        610528..611892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0492"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="KEGG: ckr:CKR_0851 hypothetical protein; TIGRFAM:
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase;
FT                   PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50267"
FT                   /db_xref="GOA:D9SQX9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX9"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADL50267.1"
FT                   /translation="MTDIYDNDYVKKDLKYIWHPCSQMKDYEELKPIVIEKGEGVWLYD
FT                   IHGNKYLDCISSWWTNTLGHSNKRINEAIKKQIDSLEHVIFANFSNKPAIELAEKLVAI
FT                   TPEKLSKVFFSDNGSSAVEIALKMSFHYNMQKGRKKKKRFVAISDAYHGETLGALSVCD
FT                   LDDFNTIYRPLLLDTIRAQGPDCYRCQYNCSRESCDAPCFENMEKAIGENYQEISAVII
FT                   EPMVQGAAGMKIYSPIYLKKLRNLCNEYDIHLILDEIAMGFGRTGEMFACNHARISPDF
FT                   MCLSKGISAGYMPMSVVITTDEVYDCFYGDYSERKAFIHSHTYSGNAMACAIALESLKI
FT                   FEEDKILENNKKKGQFIKNLTIKKAETSQHVGDVRSIGMITAIEIVKDNITKEPYTADQ
FT                   RVGYEIYKIALSKGLLLRPIGNVLYFIPPYIITEEEIEFMVDTCFDSIDEYFLDS"
FT   gene            complement(612012..613670)
FT                   /locus_tag="Clocel_0493"
FT   CDS_pept        complement(612012..613670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0493"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   ckr:CKR_1573 hypothetical protein; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50268"
FT                   /db_xref="GOA:D9SQY0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY0"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADL50268.1"
FT                   /translation="MNSDSLTKDTPKRALLHALGLTNEEMEKPLIGIVSSKNDIVPGHM
FT                   NLDKIVDAVKLGVAMAGGTPLVFPAIAVCDGLAMGHKGMKYSLATRELIADSTEAMTLA
FT                   HSFDALVMVPNCDKNVPGLLMAAARLNIPTIFVSGGPMLAGRVDGEKTSFSSICEADSA
FT                   FKAGKMTKEKLLEFENKACPTCGSCSGMYTANSMNCLTEVLGMGLKGNGTIPAVYSERI
FT                   QLAKHAGMKVMELLKKDIKPRDIMTEAAFKNALTLDMALGCSTNSMLHLPAIAHECGIN
FT                   LDVAIANEISDKTPNLCHLAPAGHTYIEDLNEAGGIYAVMNEVNKLGLLNTDLITCTGK
FT                   TVGENIEGCINKNPEVIRPVENPYSTTGGIAVLKGNLAPDTCVVKRSAVSPEMMKHQGP
FT                   AKVFDCEEDAMAAINSGKIVPGDVVVIRYEGPKGGPGMREMLNPTSAIVGRGLGDTVAL
FT                   ITDGRFSGATRGAAIGHVSPEAAVGGNIALVQDGDIIEIDIMANKIDFVVSDEELEKRR
FT                   ANWKPREPKITSGYLSKYASLVTSGNRGAILELKK"
FT   gene            complement(613885..614571)
FT                   /locus_tag="Clocel_0494"
FT   CDS_pept        complement(613885..614571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0494"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: cbe:Cbei_1511 GntR domain-containing protein;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH; GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50269"
FT                   /db_xref="GOA:D9SQY1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY1"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADL50269.1"
FT                   /translation="MIKKDKSLAENVADDIVSMITIDKKYKIGDKLPNENELSSSLHIS
FT                   RTTLREAIRILVTHNVLEIHRGKGTYVKNNQGLSEGFNLDEISSLKVDIKDLYEMRLIF
FT                   EPESAYYAAKRATDKELERILYYGRLEEELILKKEHRTEVELAFHKAIAKATHNEFMNR
FT                   LMPILYRAIDKGVTLSDQNEEMVQNTLNDHRMIMEFLSKRDAEGAKTAMKLHIIHAMRG
FT                   FGITKD"
FT   gene            614875..615774
FT                   /locus_tag="Clocel_0495"
FT   CDS_pept        614875..615774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0495"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cth:Cthe_2323 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50270"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADL50270.1"
FT                   /translation="MPEFNKDSTITINDLKDFIVVTYVIIDDFYQKVTPTFIKNRRNIA
FT                   KSVMTDSEIITISLVGELLTIDSEKAWFGFCSKNLRDLFPNFCSRPRFHRVRKSLFRVI
FT                   DEIRKELTKFLNYQYDRMRIADSMPIPVCKFGRAHFHKAFKPEAAYGRCASKKETYYGF
FT                   KLHALVALDGYITDFTVTAANIDDRDVVWELTANSEIDILIGDKGYIGQKVASQLKETR
FT                   YIRLLTINRNNSKTKLLKPFRQLIFKARRRVETTFSQLSEQLNMQRVLTKSTWGFATRI
FT                   SNKILAHNLCYFINKFLI"
FT   gene            616069..617274
FT                   /locus_tag="Clocel_0496"
FT   CDS_pept        616069..617274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmq:BMQ_3951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50271"
FT                   /db_xref="GOA:D9SQY3"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY3"
FT                   /inference="similar to AA sequence:KEGG:BMQ_3951"
FT                   /protein_id="ADL50271.1"
FT                   /translation="MKKINYLKFILSTVMVIIFTLLFNKMILGMTFHEVAGLIVGVLVL
FT                   VHCGLNWRWIKAVTLKVFSNETTIKTKITYITDLLLLICVGVIIVTGIFISKVVFSGLG
FT                   LGGGRALQGIHITAAYFALMLIGVHLGLHWNWVMNVFKKAFRIPEKKVLVYVSRVVVAV
FT                   VFVFGVYSTYSVGFLSKISFANTEGRGNGQFGPGSRSEGRKSEREEFAPGQMPGGERKE
FT                   YNSREVPQGGNQGLDQSQIPQTEDGSLEGFNQGNAIDGYENGSSSNSEIQEESSGIAIQ
FT                   KLSAQTKSSEDTQIQGRNKGGTQRSNGGQSENNSGEQGSDNGQEGFPPNGMNGEFKGNF
FT                   PGGNRGNMGSTSVLGVIFSYLGVISMFAIATYYIEKLVRLRKKKMLLLPATTLALEESS
FT                   KN"
FT   gene            617581..618765
FT                   /locus_tag="Clocel_0497"
FT   CDS_pept        617581..618765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0497"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cac:CAC2536 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50272"
FT                   /db_xref="GOA:D9SQY4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADL50272.1"
FT                   /translation="MKILITTDAYHPMTNGVVISIDILYKQLKKLGYDVKILSLSADGR
FT                   ERIVGDIFYFSSYNVNIYPNAKVIKPTKNKIIREIIKWSPDIIHSQSEFSTMIIAKYIK
FT                   RKLGIPQVHTYHTMYEEYLHYFLGGKILGKKALSKIIRVLLNTFDTVVAPTEKVQESLK
FT                   NYKVATNIEIIPTGINLKRFQSSLSRNERDEILSNYNLKLTDNVIIYVGRIAEEKNIEE
FT                   IISFYNKGISHLKNTKLLIVGGGPYLSKLQDLVREYEIEEYVKFTGMIPSEEIHKYYKL
FT                   GDVFVTASTSETQGITYIEALASGVPVLCRWDMCIKDLVIDEKTGFTYKNEDEFTNKLT
FT                   KLIQDEEIKKEMALEIKYKVQDYSDIVFGERISNLYEELVEAKKDYYLTKLIHN"
FT   gene            618978..619493
FT                   /locus_tag="Clocel_0498"
FT   CDS_pept        618978..619493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50273"
FT                   /db_xref="GOA:D9SQY5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY5"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3727"
FT                   /protein_id="ADL50273.1"
FT                   /translation="MMQLFLFKAKTWGGIVKKFTLITILLIFDLGLLGFTGDKKVEYKE
FT                   FYSQVIGFDKEDEKYKTIEQDAILMMNNEEFQKFMDEYFVPREIPVGAHDEDKAVIYLQ
FT                   IPFKTSRVMYYSVDIITVKNHTITVNLKQDSVAEVDGSSKIDTWNWVMLIQVDKNDLKE
FT                   DMNIVVKK"
FT   gene            619530..620306
FT                   /locus_tag="Clocel_0499"
FT   CDS_pept        619530..620306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0499"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: aoe:Clos_2442
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50274"
FT                   /db_xref="GOA:D9SQY6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY6"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ADL50274.1"
FT                   /translation="MKKFIDLSIAIENNIPSDPPEMIPQINYVDHDLGAKQMTVFFPGI
FT                   DTEKDLPNGKGWAMELINLSSHSGTHLDAPWHYSPTMNKGEKAATIDEIPLEWCMGDGV
FT                   KLDFRNFEDGYLVTAKDMEEAFEKIGYELKAGDIVLVNTGADKYWGTPQYLIKGCGMGR
FT                   EATLWLCEKGVHVVGTDAWSWDRPLPIIAKDFNENRDSSVIWEGHFAGIEHGYCHIEKL
FT                   TNLEQLPSYGFTVSCFPIKIKDASAGWIRAVAIVEE"
FT   gene            620329..621246
FT                   /locus_tag="Clocel_0500"
FT   CDS_pept        620329..621246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0500"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: gym:GYMC10_4684
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50275"
FT                   /db_xref="GOA:D9SQY7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY7"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADL50275.1"
FT                   /translation="MTLQQLKYAIEIAKYGSMNIAAKKLFITQPSLSNAIKDLEEEMNI
FT                   TIFERTNRGINITVQGAEFLGYARQVIEQTELLEKKYLNAKPSIQHFSVSTQHYAFAVN
FT                   AFVELIKEYGIDEYEFNLRETKTYEIIDDVKNLRSEIGILYLNEFNSKVLKKIFKENNL
FT                   RFTKLFVAKPHVFISSNNPLSKKNLVTLKDLEYYPYLSFEQGEYNSFHFSEEILSTLSH
FT                   KKSIKVTDRATLFNLLIGLNGYTISTGILSEDLNGEHIISIPLDVKEEIKVGWISHKNM
FT                   TLSKLGTIYISALEDIISKSLKGM"
FT   gene            621343..621843
FT                   /locus_tag="Clocel_0501"
FT   CDS_pept        621343..621843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0501"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bhy:BHWA1_01604 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50276"
FT                   /db_xref="GOA:D9SQY8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL50276.1"
FT                   /translation="MNELWDLYDKNRKPLNKTQVRGVPLSKGEYHLVVDIWTINSDGKI
FT                   LIDKRHSSKKFGGLWECTGGSVIKGEDSVIGALRELEEELGIKATAEELILIHSILLED
FT                   RFVDTYILKKDIDLNSLVLQADEVTEVRFVTLNQLDELCHNNMIVIKERYGMYRDKIAV
FT                   YAK"
FT   gene            complement(621944..623065)
FT                   /locus_tag="Clocel_0502"
FT   CDS_pept        complement(621944..623065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mru:mru_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50277"
FT                   /db_xref="GOA:D9SQY9"
FT                   /db_xref="InterPro:IPR025893"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY9"
FT                   /inference="similar to AA sequence:KEGG:mru_0432"
FT                   /protein_id="ADL50277.1"
FT                   /translation="MNKSDLSRNLFMLKGPLAKKGYDWWWHNFTGYNRETGEAKAFFIE
FT                   YFICNPALGDKEAILGQLPINQEKNIKPSYALIKVGAWGKNAKQIHNFYPISAFSCPTD
FT                   SLNVKIGDCQLSETHMKGNCAVTTKEASEHPEFMCNAGEMSWNLKIHKKIAFNVGYGAS
FT                   KFFRKLNAFEMFWHAEGIKTEYSGEVILDGITYNIIPEKSFGYSDKNWGSDFTSPWLWI
FT                   SSCNMKSLITGKTLSNSAVEIGGGRPKVLGVPLDRKLLIGLFYEGEMYEYNFSKFWTNS
FT                   KVDFNFHEGDKINTWKVNAKNKTSIMELILECPKDEMLLINYEAPNGKKLHNRLWNGGT
FT                   GYGEIKLYKKQGSSTVLIDHIEIKNTGCEYGEY"
FT   gene            complement(623071..623466)
FT                   /locus_tag="Clocel_0503"
FT   CDS_pept        complement(623071..623466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50278"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ0"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3202"
FT                   /protein_id="ADL50278.1"
FT                   /translation="MNSIKEVIFQLENQLLKSEVRKSSKRINEILTNNFVEFTSSGTEY
FT                   HYKNGDIFQDQNDTDSLNWQIINFEIKELSEDCVLALYKVIKHDEIDENKKYSLRSSVW
FT                   KCSDGIWKMVFHQGTLSSKHEINITGG"
FT   gene            623676..625505
FT                   /locus_tag="Clocel_0504"
FT   CDS_pept        623676..625505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0504"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase;
FT                   methylenetetrahydrofolate reductase; KEGG: ckr:CKR_1635
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50279"
FT                   /db_xref="GOA:D9SQZ1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ1"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADL50279.1"
FT                   /translation="MNLNERLLIFDGAMGTYYASSCNNPLPKCELANIHDKKTILNIHK
FT                   EYIKAGAGAIKTNTFGANKISLECDFDVMKEAIVSGYEIAKEATEGTDVLVFADIGPIP
FT                   FLEKVDLWVGYKEIIDIFLSLGASNFIFETFSSDEYLIEISEYIKEKNSKAFILTEFAV
FT                   SPEGVTRLGKSGKKLLNTMLKAKTIDACGFNCFSGPYHLLQYSKTLDIKDKTISMMPNS
FT                   GYPSMINNRVFFDNTKEYFAEQMLEIARQGVTILGGCCGTTPEYIKEMVDKLKGLEVHN
FT                   ILNDGRQIETTEGLKQEKLQEKKALTEEVKDEKRVNKNPLLEKLERGEKIIAVELDPPI
FT                   NTEIDFFISGAKRLKGQGIDAITIADCPIARARVDSSLLACKLKRELDITAIPHMTCRD
FT                   RNINATKALLLGLNVEGINNVLVVTGDPIPSADREEIKGVFSFNSSILSSYIRELNETT
FT                   FSSPFNVCGALNLNVRNFSNELEKAQKKIDNGITMFLTQPVLTEEAMENLKLARKKLNA
FT                   KILGGIIPVVSYRNACFMNNEISGINVSEEIIERYKDVSKEEATRLAVEISTGIATEMS
FT                   SYVDGFYIITPFKRIDIVSEIVSNIKNNIFTYN"
FT   gene            625536..626084
FT                   /locus_tag="Clocel_0505"
FT   CDS_pept        625536..626084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0505"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="KEGG: cpr:CPR_1102 phosphatase; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50280"
FT                   /db_xref="GOA:D9SQZ2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ2"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADL50280.1"
FT                   /translation="MLQAINQFDNSILWFIRDHLQSAVMDKLMIAISALGNVGIIWIVI
FT                   GILLAISKKYRKIGLVMLSALLLGALLGEGLLKNLVQRPRPSGFELIVKKPSSYSFPSG
FT                   HTTAAFASAMILSHYFKKYQIGIYTFAVLIAFSRLYLCVHYPTDVLGGMILGTTAALIV
FT                   LTVVKNLDKKKNIGLSSNL"
FT   gene            626252..626458
FT                   /locus_tag="Clocel_0506"
FT   CDS_pept        626252..626458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A1795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50281"
FT                   /db_xref="GOA:D9SQZ3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ3"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1795"
FT                   /protein_id="ADL50281.1"
FT                   /translation="MQREHYLVKGLANENMKTQVRNALEDLDGVNKVCIDAARGSIEVI
FT                   YKNPATTDEIRNAIERTGNIIES"
FT   gene            626990..627247
FT                   /locus_tag="Clocel_0507"
FT   CDS_pept        626990..627247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50282"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ4"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1345"
FT                   /protein_id="ADL50282.1"
FT                   /translation="MVSSWVNTTSNPGVTTPISIAQTGNKPDSVFDAYYETSRFANDQD
FT                   TLGLTSFYVYGNNVQSPAEWGPPNQNWGWTTIRLNPNGFN"
FT   gene            627508..627801
FT                   /locus_tag="Clocel_0508"
FT   CDS_pept        627508..627801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfs:MFS40622_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50283"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ5"
FT                   /inference="similar to AA sequence:KEGG:MFS40622_0260"
FT                   /protein_id="ADL50283.1"
FT                   /translation="MKKALTISLGSILIFSLMGCSNGEKKEAQSNNTVVENEVSKSEPL
FT                   EIGNDDDKVNNDKNYDSLIIKTTQDVIRTFESFDELVKDSNVIIEGDIKRLA"
FT   sig_peptide     627508..627567
FT                   /locus_tag="Clocel_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.445 at
FT                   residue 20"
FT   gene            complement(627840..628418)
FT                   /locus_tag="Clocel_0509"
FT   CDS_pept        complement(627840..628418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0509"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="KEGG: cth:Cthe_2996 PfpI family intracellular
FT                   peptidase; TIGRFAM: intracellular protease, PfpI family;
FT                   PFAM: ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50284"
FT                   /db_xref="GOA:D9SQZ6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ6"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADL50284.1"
FT                   /translation="MSMKILMLLGDYVEDYEVMVPFQALQMVGFTVDTVCPDKKAGDII
FT                   RTAIHDFEGDQTYSEKRGHNFALNTDFNSINLSDYVALVIPGGRAPEYIRLNKRVIEIV
FT                   KTFANDNKPIAAICHGIQVLTAADVIKGKTISAYPALEPDVLMVGGTYINLEFDQAHVD
FT                   GNFITAPAWPAHPQWLAKFLEVLGVKISL"
FT   gene            628910..630790
FT                   /locus_tag="Clocel_0510"
FT   CDS_pept        628910..630790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0510"
FT                   /product="Heat shock protein Hsp90-like"
FT                   /note="KEGG: cbh:CLC_1931 heat shock protein 90; PFAM: Heat
FT                   shock protein Hsp90-like; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50285"
FT                   /db_xref="GOA:D9SQZ7"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ7"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ADL50285.1"
FT                   /translation="METKQFKAESKRLLDLMINSIYTHREIFLRELISNASDAIDKIYY
FT                   KALTDESVSFDKENYYIRVEADRENRILKISDTGIGMTKEDLDENLGVIAKSGSLKFKK
FT                   ENELKDGYDIIGQFGVGFYSAFMVAETVTVVSKAFGSDSAYKWESQGVDGYTIEACEKD
FT                   TVGTEITLKIKANTEDENYDEYLEEYRLKSIIKKYSDFIRYPIKMEVTKNRLKEGSDKE
FT                   YEEYKEEQTVNSMVPIWKKNKNELKDEDYDSFYSEKHYGFDKPLKHIHISVDGAVSYNA
FT                   ILYIPEKMPYDFYTKEYEKGLELYSNGVMIMNKCGELIPDYFGFVKGIVDSEDLSLNIS
FT                   REILQHDRQLKLIAKNIKTKIKNELEDMIKNERESYEKFFESFGRQLKYGIYSDFGSNK
FT                   EVLQDLLLFYSSKEKKMVSLEEYVSRMPEDQKYIYYATGESVERIEKLPQTEVVLDKGY
FT                   EILYFTDDVDEFAIKMIMQYKEKEFKSVSSGDLGIEPEENDKTSEAEEKESKELFDSMK
FT                   EILSDKIKAVRSSKRLKNHPVCLTNDGDLSIEMEKVLNAMPNSEHVKADKILEININHD
FT                   VFKALKEANENDKDKLELYTNLLYNQALLIEGLPINDPVEFTNNICKIMK"
FT   gene            631233..633044
FT                   /locus_tag="Clocel_0511"
FT   CDS_pept        631233..633044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0511"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   bph:Bphy_0391 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50286"
FT                   /db_xref="GOA:D9SQZ8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL50286.1"
FT                   /translation="MEQNSTNMIERYLDDKTIQLESKKYRKLKIFISIILFLTFSFLQR
FT                   KVNGVPTISGIFAQLQVLVSIYLAIKASKASYITAVLLNLFGISQVMIAIFLLGNVSAV
FT                   TGVIVYSFNIISITIIWALSNRNVKQFKRVLDQREDIIALYEELSASEEELRDQNRQLM
FT                   DYNEKLVKQEEELTFLAHYDTLSGLPNRKMIKDTLEKIRKNALENESSFAVVLIDLDDF
FT                   KKINDTMGHHIGDTLLQAVAERLIPFVKEEDILGRMGGDEFALVIQSQYKEDIFQYLEQ
FT                   LRNNLNQDFNIDGNRVRTCASFGVALFPQDSTDDDELMKYADTAMYKVKATGKNNICFF
FT                   KKEMNDEVLERTEFEKRLLTAMEEDELFLVFQPQYRLDPLELRGFEVLVRWKSPDMGMV
FT                   SPMKFIPLAEEMGLIVKMGEWILRTACKKFKALKDKYSLDSMISVNISAVQIQDEFFVD
FT                   IVKSALEESGLEGKYLELEITESVLIESIDKVIGVFEELKKLGVHIALDDFGTGYSSLS
FT                   YLQRLPIDTLKIDKSFLNHQNTSDENKDIIGGIIFLMHRMGIYVIMEGVEEEFQLNYLK
FT                   HRQCDCIQGFLLGKPLDEPTVEELLKK"
FT   gene            633218..633685
FT                   /locus_tag="Clocel_0512"
FT   CDS_pept        633218..633685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0512"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ctc:CTC01413 methylated-DNA--protein-cysteine
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; methylguanine DNA
FT                   methyltransferase ribonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50287"
FT                   /db_xref="GOA:D9SQZ9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ9"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADL50287.1"
FT                   /translation="MRSSVVIETIIGKIVITEENHTITNVDLYRDAVIENFFQKETPLL
FT                   KKAVKQLEDYFKGTLKEFDLPLAPNGTKFQQSVWRALQDIPYGETKSYGEVARSIGNPK
FT                   AARAVGMANNRNPIAIFIPCHRVIGVNGKLVGYGGGIDIKEILLGLEKSVK"
FT   gene            634039..635385
FT                   /locus_tag="Clocel_0513"
FT   CDS_pept        634039..635385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0513"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cpy:Cphy_1074 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50288"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR00"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL50288.1"
FT                   /translation="MKKKLLSVVLSLSMISTFMVGCGSKEKASNNNEIYFLNFKPEIAE
FT                   TYKAIAKDYEAETGVKVKVVTAASGTYETTLKSEIAKSDAPTIFQINGPVGYESWKDYC
FT                   ADLSSSKLYSYLSDKSLAIKSGDGVYGIPYVVEGYGIIYNDAIMKKYFELSDKAVSIKS
FT                   TSEINNFDILKKVIEDMTAKKDKLGIKGVFASTSLGAGEQWRWQTHLANMPLYYEFKDN
FT                   KNFDNTILAGLDSKEIKFSYEENYKNIFDLYINNSATDKPLLGSKSVSDSMAEFALGNV
FT                   AMVQNGNWAWSQIKGVSGNTVQENDIKYLPIYTGVKGEEKQGLCIGTENYFAINSKVSK
FT                   EKQDASVAFLEWLFSSEKGKKYITKDLGFIAPFNTFTDAERPEDPLAKEVSAWMQKDVT
FT                   SVPWTFAAFPSEDFKNRFGDALLEYAQGSKSWDDVVKTVQETWKSEKSK"
FT   sig_peptide     634039..634113
FT                   /locus_tag="Clocel_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.778 at
FT                   residue 25"
FT   gene            635502..636344
FT                   /locus_tag="Clocel_0514"
FT   CDS_pept        635502..636344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0514"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1075
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50289"
FT                   /db_xref="GOA:D9SR01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR01"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL50289.1"
FT                   /translation="MEKKLKRYFPIFALPTIVAFSIAFFIPFVLGIYLSFTEFTTVVDA
FT                   KWVGFENYYKAFVDKDFLNALWFTVKFTVISVIAINVLAFSLALLLTRGKKGTNVFRTV
FT                   FFMPNLIGGIVLGYIWQLIINGVLYKFGVTLTYDAKYGFWGLVILMNWQLIGYMMIIYI
FT                   AGIQNIPKDLIEAAKIDGANLFTVLKSVIVPLVMPSITICLFLTLSNSFKLFDQNLALT
FT                   AGAPSKQTAMLALDIYNTFYGKVGYEGVGQAKAVIFFILVAIIAFVQLIITRSKEVEN"
FT   gene            636344..637177
FT                   /locus_tag="Clocel_0515"
FT   CDS_pept        636344..637177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0515"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1076
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50290"
FT                   /db_xref="GOA:D9SR02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR02"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL50290.1"
FT                   /translation="MKSEKLRDNLIFVTLSILTIVFLLPILIVIMNSFKGKFYISETPF
FT                   LLPNSSTFVGFSNYIEGVTKTGFVQAFGWSVFITVFSVAVIILFTSMTAWFITRVKSKF
FT                   TSFLYYLFAFSMIVPFQMVMFTMTKVANVTHLDNPVGIIVIYLGFASGLSVFMFSGFVK
FT                   SIPLEIEEAAVIDGCNPIQTFFMIVFPVLKPTAITVAILNAMWIWNDYLLPYLIIGNEY
FT                   KTIPIAIQYLKGGYGSIDMGAMMAVLVLAIIPIVIFYFVCQKHIIEGVVAGAVKG"
FT   gene            637215..638693
FT                   /locus_tag="Clocel_0516"
FT   CDS_pept        637215..638693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0516"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; KEGG:
FT                   lba:Lebu_1529 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50291"
FT                   /db_xref="GOA:D9SR03"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR03"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ADL50291.1"
FT                   /translation="MRKSGVLLPVASLPSKYGIGAFSKNAYKFIDQLKAAGQSYWQILP
FT                   LGPTGYGDSPYQSFSTFAGNPYFIDLEELIAEGYLTEEECESYDFGDNERYIDYEKIYL
FT                   SRFKILKIAFGRSNIKETEEFQKFIANNAYWLEDYALYMAVKNYFDGVSWIKWDDDIRL
FT                   RKKSALEKYKSKLEDEIAFYQFQQFLFNKQWEALKEYANEADIKIIGDIPIYVAFDSAD
FT                   SWAHPELFQFDENGEPIAVAGCPPDGFSATGQLWGNPLYNWDYHEKTEYKWWVERIAYS
FT                   FKLYDVVRVDHFRGFDEYYSIPYGSETAEIGSWEKGPGYEIFKEVRKQLGEVNIIAEDL
FT                   GFLTESVLKLVEETGYPGMKVLEFAFDSREESDYLPHNYVKNCIVYTGTHDNETIVGWY
FT                   KNLNPDDKKLAIDYLDIKDKTDEDIHWKFIKLALSSVANLAIIPLQDYLGLGNEARINT
FT                   PSTVGGNWKWRLLEDEITEELVEKINKVTKLYGR"
FT   gene            638953..639984
FT                   /locus_tag="Clocel_0517"
FT   CDS_pept        638953..639984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0517"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: cpy:Cphy_1077 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50292"
FT                   /db_xref="GOA:D9SR04"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR04"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADL50292.1"
FT                   /translation="MESITIKDIAKICGVGVSTVSRAINNHPDINKETKAMIMDVIKQH
FT                   NYIPNNSARNLKRLDSNAIAVLIKGISNPFFSNMIKIFEREIKEKKYSFILQHVDDKED
FT                   EIDVAIELIKEKKLKGIVFLGGHFSHPIEKLEQLKVPFVLSTIGTTQKLDKTICSSVSV
FT                   DDFEESYKMVNYLCSLGHTKIATITAPMDDESIGNLRYNGYISALKNNGIEIQENLIRI
FT                   MKAELYSYSMENGYAVTKELLESGEDFTAIYAISDSIAIGACKAIFDSGKRVPEDYSVV
FT                   GFDGLDIAHYYNPSITTIRQPVEEMAEATIKILFDVIRKKKSAQHRTFQGELVIGNSVK
FT                   SLK"
FT   gene            complement(640164..641159)
FT                   /locus_tag="Clocel_0518"
FT   CDS_pept        complement(640164..641159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0518"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; KEGG:
FT                   cpy:Cphy_2353 LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50293"
FT                   /db_xref="GOA:D9SR05"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR05"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50293.1"
FT                   /translation="MATIRDIAKKLGISPGTVSKGLNGASDISEAMRQAVLDAAVELGY
FT                   KPKNMQNEINPKICIMLENMNYENIDQFGYEIISGFEQAALRKGYNVTIVPMDLRKQTQ
FT                   TKYDTYMLKNGYSGAFLLGFELHDDYVQQLDTTKVPTVLLDNYISGNNYVGYVGTDNYE
FT                   GIKDLINYLKELGHKNIAFLNGTKNSMITQKRLEAFIQSMNENNLPVNDALIAFGHYIT
FT                   DCAKDYVPGFVKNGATAIVCASDFIASGVIRELHSMGLKIPEDISVTGYDDMPIAQYLN
FT                   PPLTTIRQDRISLGKSALTLLDDLMHNVSISRIELRPKFIKRDSTDKCKI"
FT   gene            641319..643580
FT                   /locus_tag="Clocel_0519"
FT   CDS_pept        641319..643580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0519"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /note="KEGG: cbe:Cbei_0285 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50294"
FT                   /db_xref="GOA:D9SR06"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR06"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADL50294.1"
FT                   /translation="MLEKDLQSIVDRKFRKTVEVCSNEEIYLALLELTKERIKATGNNE
FT                   GKKKLYYISAEFLIGKLLSNNLINLGIYDEVQMILEKNHKSLSEIEDVELEPSLGNGGL
FT                   GRLAACFLDSIATLGLNGDGVGLNYHYGLFKQIFESNTQVETKNPWITKEGWLEKSDIS
FT                   FEVPFKDFTLKSVLYDIDVTGYESNSNKLRLFDIDTLDETMVKDGITFDKEDVIHNLTL
FT                   FLYPDDSDKAGHLLRIYQQYFMVSNAAQLIIKETLEKGHDLRKLYEYVVVQINDTHPTM
FT                   VIPELIRLLLAQGIAMDEAIEIVTKTCAYTNHTILAEALEKWPMEYLEKVVPQLLPIII
FT                   ELDKRVRDKYDNEKVYIIDKDQRVHMAHIDIHYGFSVNGVAALHTDILKNTEIKHFYEI
FT                   YPEKFNNKTNGITFRRWLIHCNPLLSRFVTELIDEDYKRDANKLEDLFKYIDDDIVLQR
FT                   LLEIKHKNKVTLKNYLKETQNVDIDENSIFDIQVKRLHEYKRQQMNALYVIHKYLDIKK
FT                   GNIPTTPITMIFGAKAAPAYIIAKDIIHLILCLQELINNDPEVSPYLKIVMVENYNVTK
FT                   ASKLVPACDVSEQISLASKEASGTGNMKFMLNGAVTLGTMDGANVEIHDLVGKDNIYIF
FT                   GKSSEVVTKLYEDKGYRPTDYYEKDEKIEELVDFIINKKMIKIGDPVKLARLYKELISK
FT                   DWFMTLLDIKEYIETKDDMFKDYEDRKAWSQKMLTNISKAGFFSSDRTIKQYNEDIWKL
FT                   "
FT   gene            643778..644692
FT                   /locus_tag="Clocel_0520"
FT   CDS_pept        643778..644692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mru:mru_1755 peptidase M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50295"
FT                   /db_xref="GOA:D9SR07"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR07"
FT                   /inference="similar to AA sequence:KEGG:mru_1755"
FT                   /protein_id="ADL50295.1"
FT                   /translation="MFKKHVSTIVVAVLFILLIGYPKSVMAIDRANPIFTNEELFNIKA
FT                   SDTKWIEDEKIYSDPGQWELMEEYRPNTSYIIKSSIERYGGIEYDDIETVETTVISGSA
FT                   VELFYKESCPTLEKVKQTMYDNYFSEYIGEPITVTDCSDKGYSQLYYSKGKSNQSGYFD
FT                   STQVFYGKAKGYFIAVTYTASMEKSDSVSEEWFTKMFYSWLDKIPSQEPPGLSAIRNLS
FT                   YFKVKVIIAVSLIAIGGVAVGIILITQKSKKRKNKVNDSVPQVTKLTDGLQGIDNQVKF
FT                   CTSCGYKTESDSKFCSKCGKQLD"
FT   sig_peptide     643778..643861
FT                   /locus_tag="Clocel_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.654) with cleavage site probability 0.649 at
FT                   residue 28"
FT   gene            645487..646530
FT                   /locus_tag="Clocel_0521"
FT   CDS_pept        645487..646530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0521"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="KEGG: ckr:CKR_1675 hypothetical protein; TIGRFAM:
FT                   sulfate ABC transporter, periplasmic sulfate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50296"
FT                   /db_xref="GOA:D9SR08"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR08"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ADL50296.1"
FT                   /translation="MRKNRFLSIALSAILLGAILTGCGSSSSGSDKQNSSSGVELLNVS
FT                   YDPTREFYTEYNRAFIKYWGEKTGQDITINQSHGGSGKQGRSVIEGLEGDVVTLALAYD
FT                   IDEISNAGLINKDWQGEFQNNSTPYTSTIVFLVRKGNPKGIKDWDDLVKEGVSVITPNP
FT                   KTSGGARWNYLAAWAYALNKNNGSEDDAKSFVGDLYKNVEVLDSGARGATTTFVERGIG
FT                   DVLIAWENEAYLSLNELGSDKFEIVVPSISILAEPPVAIVDEVAEKKGTTEVAKAYLEY
FT                   LYSDEGQEIIAKNYYRPRNSKIAEKYKNTFKDVKLFTVDDTFGGWTKAQATHFADGGVF
FT                   DEIYSPK"
FT   sig_peptide     645487..645573
FT                   /locus_tag="Clocel_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.416 at
FT                   residue 29"
FT   gene            646558..647382
FT                   /locus_tag="Clocel_0522"
FT   CDS_pept        646558..647382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0522"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="KEGG: cbe:Cbei_4192 sulfate ABC transporter, inner
FT                   membrane subunit CysT; TIGRFAM: sulfate ABC transporter,
FT                   inner membrane subunit CysT; sulfate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50297"
FT                   /db_xref="GOA:D9SR09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR09"
FT                   /inference="protein motif:TFAM:TIGR02139"
FT                   /protein_id="ADL50297.1"
FT                   /translation="MKKQKRVIPGFGLSLGVTLTFLSLIVLIPIASVIIKGTDMGFGGF
FT                   LKIVFDERVLASYKVSMLSALVAALINSVFGLILAWVLVRYNFPLKRIMDGVIDLPFAL
FT                   PTAVAGIALTTLYSQNGLLGSFFYKFGIKIAFTPLGIIIAMTFIGIPFVVRTVQPVLEE
FT                   LDFQFEEAARMLGASRRTTFFKVIFPEVFPALLTGFGLAFARALGEYGSVVFISGNKPM
FT                   KTEIPPFLIMSKLEQYDYSGATAIAIVMLLISFLVLFLMNVVQVRANKFSKS"
FT   gene            647393..648220
FT                   /locus_tag="Clocel_0523"
FT   CDS_pept        647393..648220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0523"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="KEGG: cbe:Cbei_4191 sulfate ABC transporter, inner
FT                   membrane subunit CysW; TIGRFAM: sulfate ABC transporter,
FT                   inner membrane subunit CysW; sulfate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50298"
FT                   /db_xref="GOA:D9SR10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR10"
FT                   /inference="protein motif:TFAM:TIGR02140"
FT                   /protein_id="ADL50298.1"
FT                   /translation="MKKELKTENTITKWILIFISVAFLILMLGFPLAVVMIEALKKGFG
FT                   AYVKAITDNYTLKAVSLTLLATLVATIVNTIFGIFAAWAITKFKFKNKNILTTLIDIPF
FT                   AISPVIAGLIFILTFGRIGWLNGLLSAIDAKIVFAIPGIILATIFVTFPFVSREIIPLM
FT                   NSQGTDEEEAAAMMGASGFKIFTKITLPNIKWGLIYGIILCTARAMGEFGAVSVVSGHI
FT                   RGKTNTLPLHVEILYNEYQFSAAFAVSSLLVIIAIVVLILRNIVEWKAKKGDL"
FT   sig_peptide     647393..647494
FT                   /locus_tag="Clocel_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.762 at
FT                   residue 34"
FT   gene            648220..649278
FT                   /locus_tag="Clocel_0524"
FT   CDS_pept        648220..649278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0524"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain-containing protein; KEGG: cbe:Cbei_4190 sulfate ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50299"
FT                   /db_xref="GOA:D9SR11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR11"
FT                   /inference="protein motif:TFAM:TIGR00968"
FT                   /protein_id="ADL50299.1"
FT                   /translation="MYVELKNIKKTFKDFKASDDVSFGIEKGKLIGLLGPSGSGKTTIL
FT                   RMIAGLETPDSGDIIIDGVRVNDIEAGKRGIGFVFQSYALFRHMTVFDNIAFGLNVQKQ
FT                   DKKKIKARVEELIKLIGLEGMEKRYPHQLSGGQRQRVAFARALAPNPHLLLLDEPFAAI
FT                   DAKVRQELRTWLKKTISELNITSIFVTHDQDEAIEVADEIIVTNKGRIEQKGTPMEIYK
FT                   NPKTPFVAQFIGESAVIEDYSKLKGFGDSKFTKAIVRPEFIQLAKNKAELKYIHPVEEG
FT                   IVEDVAFRGSSIQITFKVGDITLTAYRSLEHDPIKVGDKVFALIFRLYVFNDTEAYILE
FT                   NNAMTDPMPVFI"
FT   gene            649410..651086
FT                   /locus_tag="Clocel_0525"
FT   CDS_pept        649410..651086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0525"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: cbe:Cbei_4189
FT                   adenylylsulfate reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50300"
FT                   /db_xref="GOA:D9SR12"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR12"
FT                   /inference="protein motif:PFAM:PF02910"
FT                   /protein_id="ADL50300.1"
FT                   /translation="MKINKLSTDILIIGGGTAGCYAAITISESSDAKVIIAEKANIKRS
FT                   GCLAAGVNAINAYIVKGNKPEDYVDYAKKDADNIVREDLLLTMAERLNDVTKKLEDLGL
FT                   VILKDENGQYVARGNRNIKINGENIKPILADAVNKLHNVAVINKINIIDFILEDGKVVG
FT                   AYGIGVNEEVFYVIEAKAVICATGGASGLYRPNNPGFSRHKMWYSPFNTGAGYAMGIRA
FT                   GAEMTTFEMRFIALRCKDTIAPTGTIAQGVGAKQVNSLGEEYESKYGITTSQRVYGTVQ
FT                   ENLAGRGPCYLKTEGISAVQDDQLLKAYLNMAPSQTLKWIEENKKPSEQNVEIEGTEPY
FT                   IVGGHTASGYWIDTKRATTIKGLYAAGDVAGGCPQKYVTGALVEGEIAANSALEYINGY
FT                   EKIEIKENIIDKRFNEVTAMFSKEDSIYDVEKLEDAMQKVMDNYAGGIKTNYQYNEKQL
FT                   NLADEKIDNIIRLSEGIKAKDIDDLVQIFELKDRLVVCKSVIAHLRARKETRWHSFAEN
FT                   LDYPEKDDSWLKYVNSKVVDGNLEIIYRDLVYRGEIYEHID"
FT   gene            651070..651384
FT                   /locus_tag="Clocel_0526"
FT   CDS_pept        651070..651384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0526"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: fsu:Fisuc_0145 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50301"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR13"
FT                   /inference="similar to AA sequence:KEGG:Fisuc_0145"
FT                   /protein_id="ADL50301.1"
FT                   /translation="MSISIDKSLCVGCKQCSEVCPGNLIRIDENNKAFIKYPKDCWGCV
FT                   SCVKECKVNAIKFYLGADIGGRGSLAYTKEEKDITHWVIEEKYGTVKTIDVNKKSANAY
FT                   "
FT   gene            651458..652258
FT                   /locus_tag="Clocel_0527"
FT   CDS_pept        651458..652258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0527"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: csc:Csac_1642 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50302"
FT                   /db_xref="GOA:D9SR14"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR14"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADL50302.1"
FT                   /translation="MDHLDLLEAQSIFILREAYKKLGKLGMLWSIGKDSTVLLWLAKKA
FT                   FYGHCPFPFIHVDTTYKIPEMIQYRDRVAKELNLDLIVHTNKEAIEAGMGPDQGRLVCC
FT                   KALKTEALQDVVRVYGFEGLIVGVRRDEEGSRSKERVFSERNKEYEWDYSNQPPELWDQ
FT                   FKTDFPKGNHIRVHPLLHWNELDIWEYIKRENIPIIDLYFSKNGERYRSLGCAPCTGRI
FT                   KSEAKNLDEIIEELRHTTTGERAGRAQDQEDSYAMQKLRKDGYM"
FT   gene            652312..654009
FT                   /locus_tag="Clocel_0528"
FT   CDS_pept        652312..654009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0528"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, large subunit;
FT                   small GTP-binding protein; KEGG: csc:Csac_1643 sulfate
FT                   adenylyltransferase, large subunit; PFAM: protein synthesis
FT                   factor GTP-binding; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50303"
FT                   /db_xref="GOA:D9SR15"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR15"
FT                   /inference="protein motif:TFAM:TIGR02034"
FT                   /protein_id="ADL50303.1"
FT                   /translation="MSEKQNTLKIVVVGHVDHGKSTVIGRLLHDTQSLPEGTINKVKRI
FT                   AKETGKPFEYAYLLDAFEEEQKQGITIDTTQIQFQTKKRDYVIIDAPGHKEFLKNMISG
FT                   AANAEAALLVIDVKEGVQEQSKRHAYILSLLGIKKVYVVLNKMDLVDYSEEVFNDVSTA
FT                   MNKFLGELDVYPLAYIPVSAYYGENILDDSTKMPWYKGQSIINAIDSLENEKGIEERSL
FT                   RFPIQDVYKFDDRRIIAGRIESGKLKVGDEIVIYPEGKKTQVKTIEYWVEKDKKDEIKA
FT                   GESVGITVTDEFFNKRGEIITKAENPPFISNSFRANIFWMGKNDLVKNKKYKIKLTTQE
FT                   VEGEIDKIIKVIDASSLNSNEEVSKVVLNDVAEVIIKTKEPVVFDAFKDSQITGRFVIV
FT                   DGYDVAGGGIVVKSEEGEVVQGLETFKFQGVKARGDIFEEFYYDVESQTVNKEIATTNT
FT                   YTVGDSLPLKGESYEYPSYFDILVIRDKVAIAVRDGKVNNIVALEDYQYSGYPLTNGRG
FT                   FEIKAKTSEEIKDFVEGYSNIDEKTEAEYLNKWVNFDTYRKVVFRFDK"
FT   gene            654190..654621
FT                   /locus_tag="Clocel_0529"
FT   CDS_pept        654190..654621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0529"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: cce:Ccel_1609 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50304"
FT                   /db_xref="GOA:D9SR16"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR16"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL50304.1"
FT                   /translation="MNNQGSGYLRELIRILARHLGVLEKEDSNCSGVTTSQCHAIVEVG
FT                   RAGEISLNELADILTLDKSTMSRTINNLVDKKLVIREIDPTDRRYVMIKLTDEGMKIFN
FT                   DIESSMNQYYGIVFNNLPENKREQVLESLNLLIDAVDKK"
FT   gene            654780..655280
FT                   /locus_tag="Clocel_0530"
FT   CDS_pept        654780..655280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0530"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpf:BpOF4_18205 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50305"
FT                   /db_xref="GOA:D9SR17"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR17"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50305.1"
FT                   /translation="MNYTIENIVQEDWESIANIYLEGISTGKATFQTDVPTWEQWDSSH
FT                   TRTCRLVARLDDKILGWSALSPTSSRCVYAGVAEVSIYIGKEFRGQGIGTSLLNRLISL
FT                   SEENGFWTLQSGIIRENVESIELHKNCGFREIGVREKLGKMSNGKWHDVVLMERRSKIT
FT                   GIS"
FT   gene            655340..656242
FT                   /locus_tag="Clocel_0531"
FT   CDS_pept        655340..656242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0531"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cbe:Cbei_4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50306"
FT                   /db_xref="GOA:D9SR18"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR18"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADL50306.1"
FT                   /translation="MDNKRKALPYLTAFMSSIIFGLSFLFTKRALDVSSPITLVAFRFL
FT                   IATIVMTALILFKVIKVNYKNKPLGWLFLLAMFEPVIYFIFETYGLQYTASSIGGLMIS
FT                   LIPIAVTILGVYFLKEKPTVKQVIFILTSVSGVALIGIMGSSGDTNNSLLGILLMFGAV
FT                   MSAAFFTIISRKISNQFNAIEITYFMMITGAVCFNVISLFEHIINKNLSAYLEPLKSTT
FT                   FLSSVFYLGILSSIIAYFLINFSLSKLEASKTTVFSNISTIVSIFAGVIFLRESFHLYH
FT                   AVGSVLILLGVWGTSHYSR"
FT   gene            656662..658650
FT                   /locus_tag="Clocel_0532"
FT   CDS_pept        656662..658650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0532"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ckr:CKR_0361 hypothetical protein; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50307"
FT                   /db_xref="GOA:D9SR19"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR19"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50307.1"
FT                   /translation="MKISKKIMYSVIVVNVVLIIIGYFVSRTIIQNVLNSDIRISTEEK
FT                   SDAFAELIEEKKITAVNNIKWLEGSSRLIKAVQQNNRGDIIELGKQAMSNFEMDYFVIT
FT                   DANGNVIARAHEPEKFGDSILKQANIEKALKGEVTVGIEEGTTVRLSIRAGCPIKNENG
FT                   QIIGAVSMGYVLADGFVDEINEKVNCEVTIFNGIERVGTTIKDGEKRITGTKIEDAEIE
FT                   DTVLNQGKSIDKVVTIDGKKYVAVYSPLFDVKDNIIGMKFVGVPADIVQSVERQLVIAQ
FT                   VLISFITIVVSLLVLLFILQKSVTSPLKKLVEFFKELSNGEGDLTKTMKVNTKDEVGEV
FT                   IIEFNKFISKLRYIINEVKDSSNIITKETIAMSNNVSSCTDVMLEISKRVSKVSDNMMD
FT                   NSAAIEETTSATHEMNKVSDVVATSCMQVSEQSNYASEITEDGSKAIQDIIYSINDISV
FT                   SSEEVIIKMNELQSLSNKINEIVEIITGVSKQTNLLSLNASIEAAKAGEQGKGFAVVAG
FT                   EIRKLAEESNKSSLEIVGLIKEVQGNIKDTAQKVEAVSENIASGVDKANFADRKFKEIS
FT                   KAINIVSEKSHDIAAAAQEQVASVEQVSNAMEEIAKVTASTADDSYKMNLAMQNERESM
FT                   EEVNQVTQKLTKIIKELNTMVEKFKTS"
FT   gene            658951..659409
FT                   /locus_tag="Clocel_0533"
FT   CDS_pept        658951..659409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0533"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: cdl:CDR20291_1716 putative thiol peroxidase
FT                   (bacterioferritin comigratory protein); PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50308"
FT                   /db_xref="GOA:D9SR20"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR20"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADL50308.1"
FT                   /translation="MLMEGSKAPEFKLEDKDGNEVRLSDFLGKKVVVYFYPKDNTPGCT
FT                   RQACAFKDSYEGFKAKEIVVIGISKDSTKSHEKFAEKHGLPFTLLSDPELIVIKAYDVW
FT                   KEKKLYGKVSMGVVRTTYIINENGIIEKVFEKVKPDTNAKEILDYLEG"
FT   gene            659742..660278
FT                   /locus_tag="Clocel_0534"
FT   CDS_pept        659742..660278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0534"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   cbe:Cbei_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50309"
FT                   /db_xref="GOA:D9SR21"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR21"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADL50309.1"
FT                   /translation="MKVKILPGLNNSGADHWQSIWEKKYGFERVQQDDWKQPKYNEWEK
FT                   NLIDNLQRENDKNIILIAHSLGCLLTAKAITKIEDYVKAIFLVAPPDTSRDIFPKEINS
FT                   FNNLPNKTLGVPGILVYSEDDQYASAEYSLKQAKNWGLQAVSVGKRGHINSDSNIENWD
FT                   QGYEIFQKLLINEER"
FT   gene            660440..660946
FT                   /locus_tag="Clocel_0535"
FT   CDS_pept        660440..660946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0535"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: cbe:Cbei_2322 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50310"
FT                   /db_xref="GOA:D9SR22"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR22"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL50310.1"
FT                   /translation="MRNVGNVISAMIEYYAGDVRRINHFLKVYGFAKAIGEMEKLSPLK
FT                   QEILEVASVVHDIGIKNSEIKYNSSAGNYQQIEGPPVAEEMLKKLGYEDNFIKRVCFLI
FT                   AHHHTYTDIDNYDYQILVEADFLVNIDEDQLSMDVVRSVKEKIFRTEVGIKYLNVLYNI
FT                   DNIGI"
FT   gene            complement(661569..662367)
FT                   /pseudo
FT                   /locus_tag="Clocel_0536"
FT   gene            complement(662513..662683)
FT                   /locus_tag="Clocel_0537"
FT   CDS_pept        complement(662513..662683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg8992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50311"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR23"
FT                   /inference="similar to AA sequence:KEGG:PODANSg8992"
FT                   /protein_id="ADL50311.1"
FT                   /translation="MMNTLVKLDISELEKITGGASDLAYDFGYWIGSIFAPPATHISAG
FT                   GYTHGGGGGRH"
FT   gene            complement(662696..662854)
FT                   /locus_tag="Clocel_0538"
FT   CDS_pept        complement(662696..662854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50312"
FT                   /db_xref="GOA:D9SR24"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR24"
FT                   /inference="similar to AA sequence:KEGG:Csac_0165"
FT                   /protein_id="ADL50312.1"
FT                   /translation="MDFFCTMDENDLTDVNGGNGVLVVIGAACVVYEACNIVYNFGKGI
FT                   SDGYHGK"
FT   gene            663839..664135
FT                   /pseudo
FT                   /locus_tag="Clocel_0539"
FT   gene            complement(664408..665013)
FT                   /locus_tag="Clocel_0540"
FT   CDS_pept        complement(664408..665013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0540"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: cbl:CLK_1643
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50313"
FT                   /db_xref="GOA:D9SR25"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR25"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADL50313.1"
FT                   /translation="MSKDFYIILKERRSFYGIGKETTISTEHIEEIIENALQYTPSAFN
FT                   TPSSRIVLLFGEDHNKLWDITKKEFQEIVPLDQFPSVEEKINSFRNGYGTVLFFEDINV
FT                   IEQLQRNYDLYHDNFPVWAHQASGMLQYIVWSSLEIEGLGASLQHYNPIIDREVKNHWR
FT                   LPSNWKLIAQMPFGKPISVPDKREFTSINERLKVFKSY"
FT   gene            665926..667233
FT                   /locus_tag="Clocel_0541"
FT   CDS_pept        665926..667233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0541"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cce:Ccel_2179 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50314"
FT                   /db_xref="GOA:D9SR26"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR26"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50314.1"
FT                   /translation="MSELKEQNTGGKNEIFNLIKTTLTTSLAILLIIAIVGGTISGIII
FT                   NVIAGSDKAFLISCICIFVNLIMAMSTFLIFSGSIKAASGNFSEILQAFSRGDFSIKLD
FT                   NKEFKALGKIVDHLNSFTTEIRNIIQGTYNLTKSIVDSSFDMTDKVVQINGSFKEISKT
FT                   IDEIASGASEQVAEAQQSVDTMGNLSEQIVVVRDSYNTIVKEAESVNDLNKEGLDTVKV
FT                   LREKSDNYNAASEEILIATEHLTTTLDSIGIFVEAIQGISEQTNLLALNAAIEAARAGE
FT                   AGKGFAVVADEVRKLADQSKDSTENIRKLMETIQNDSKKAIDAMKTMKIVSEQQLSAVN
FT                   QTDDSFKRIADAVDSIIFKINDTKKAIAQMEESKRTSIFAIEKTAEVSEQTAAASEELA
FT                   ATVESQLRLFDEISKAAGNLSTLSSEMNDSLQKYKL"
FT   gene            668228..670285
FT                   /locus_tag="Clocel_0542"
FT   CDS_pept        668228..670285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0542"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: cac:CAC3352 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; Cache domain protein;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50315"
FT                   /db_xref="GOA:D9SR27"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR27"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50315.1"
FT                   /translation="MKKISSSIIAAIIICVILSSISVGTISIFIGYRSVKGEAVDKLQA
FT                   TAMQYANKMNNNFTEAEGAVNGLASYIEASFDMSKIQDKGYDNDFNKALTEQLRILEKN
FT                   NENILGIYAYMEPSYTKSIIGNWFSDGKLITLKLDEEYKLYSDHAESWDFYYEAVENNK
FT                   PAWIDPYYDEDLKFDVVSYLYPVYVDNKLWGVVGMDISFDDFSELVNEMKLYDSGYAFL
FT                   LNQNQNFIVHPEYSNEETLETVGYDKLITKLEESNDGFTQMNIDGKEEYVGYSVLENGY
FT                   VFCTTVPSVEILKSIKTMIIISVLAIAISISIAFIVAVVLGKRISMPISKVAMDLELAG
FT                   DGDFTGRESLAYIRNHDETGILSKALDKMQKSMEAMIDRISNESSEVSDITRELKSVMD
FT                   SLIAEVLNISDITERISAGMEETAATATTIDSASNRMIDQINLMNEKNDHGIKIVEEIS
FT                   KHATSLRESAVKEAQIVNDICISAEAKLSNAINDSKEVSKIKELSENILAIAEQTNLLS
FT                   LNASIEAARAGEMGKGFAVVANEIKKLADDSQKLASEIQSITNGVTNSVGNLCESAEEV
FT                   LDFVNNNVKESYEMLINTSEQYNNDANVVYDMLSDFNRVSYTIFEEINELLRAFNDISV
FT                   AANEGAVGTSDISTRVQEVSYNTKIIEEQFKKLIEVSEKLNSIMHMFKVV"
FT   gene            complement(670461..671756)
FT                   /locus_tag="Clocel_0543"
FT   CDS_pept        complement(670461..671756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0543"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cpy:Cphy_2885 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50316"
FT                   /db_xref="GOA:D9SR28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR28"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL50316.1"
FT                   /translation="MKFHYKRTVFVGLAFLSICAFWQMYDSIIPLILKNTFGIGDTLSG
FT                   LIMALDNILAIFLLPFFGALSDRCNAKIGRRTPFIVIGTLLSIVFMFLIPTADNIVSLP
FT                   LFIIALGLVLLSMGIYRSPAVALMPDITPNQLRSKANAIINLMGAIGGILTLIIIKIFV
FT                   KPISKPNYFYTFIAIALVMIISIVILLITIKERKIVSELEASNYGNPKDIQNKNALEEN
FT                   KIKEPMQPEVKRSLYFLLFSVFLWFMGYNAVSTAFTKYAQEAWSMDIGTAATYLLVATI
FT                   VTILAYVPIGIISSKFGRKKLITFGIILVSISFFLGSLFKNYSPLLNIIFALIGIGWAS
FT                   INVNSYPMVVEISNLHDVGKYTGLYYTFSMSAQIITPILSGALLEYMGYRTLFPYATIF
FT                   IILSFFTMLLVKHGDNKPQLPKDKLGFFSTED"
FT   gene            671991..672509
FT                   /locus_tag="Clocel_0544"
FT   CDS_pept        671991..672509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0544"
FT                   /product="membrane spanning protein"
FT                   /note="KEGG: cbe:Cbei_0760 membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50317"
FT                   /db_xref="GOA:D9SR29"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR29"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0760"
FT                   /protein_id="ADL50317.1"
FT                   /translation="MEKSRTQKMILSALFIAMIFVATRINIKLPLGNGGLVHLGTAFLF
FT                   IIAVNFGTRYGAISGALGMTIFDVLSGWAAWAPTTFVARLVMGYIVGKMNEKREKGNIL
FT                   IMLASFVISGVFMIAIYYIGNAITFGNWIAPIQSIPGDITQIVIGALIALPATKAIERI
FT                   NILKRYRWD"
FT   gene            672515..673654
FT                   /locus_tag="Clocel_0545"
FT   CDS_pept        672515..673654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0545"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: cbi:CLJ_B2224
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50318"
FT                   /db_xref="GOA:D9SR30"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR30"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADL50318.1"
FT                   /translation="MKIMTPGPTQVRENVRVARSIVTTNPDLDLEFYNFYKETCEKAAK
FT                   LLHTENKVLILGGEGILGLEAACASLTEKGDRVLVIDNGIFGEGFSEFVTMYGGEAVFF
FT                   KGDRRNPIDVDALKAFLQKDSDFKYATVVHCDTPSGVLNDMSRICPLLKEYGIITVVDT
FT                   VAAMFGVPLEVDAWKIDIAIGGSQKVISAPPGLTLLSVSDEAFETMEKRKEKIAAFYAN
FT                   ILVWKNYYEDKWCPYTPPISDIIGLRAAIDNIEADEDILKRHEVIAEATREAVIKAGLS
FT                   LHLESGFSNTVTVIEVPKGIESSKILKIMKETYGIMIAGCFAELAGKVIRIGHMGENCN
FT                   EEDVRDTLDSLDMTLVELGFEIEVPMKITFIEAVKRLGL"
FT   gene            673933..676011
FT                   /locus_tag="Clocel_0546"
FT   CDS_pept        673933..676011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0546"
FT                   /product="Lecithin:cholesterol acyltransferase"
FT                   /note="PFAM: Lecithin:cholesterol acyltransferase; type 3a
FT                   cellulose-binding domain protein; KEGG: mla:Mlab_0281
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50319"
FT                   /db_xref="GOA:D9SR31"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR31"
FT                   /inference="protein motif:PFAM:PF02450"
FT                   /protein_id="ADL50319.1"
FT                   /translation="MKKKVCLLTLVFAIAITNLFSTIASAAGATTKRQAVLVIPGIMGS
FT                   NLVDSDGDTVWVTDEWIAGSKQLYYLLNGTISCTSSGFSSETIIPKLGTNEYGAKDTYK
FT                   DLVNRLKGEFQNDYDVIFAAYDWRVDNTRSAMELKKTIDNYDNVIIVAHSMGGLVTSRY
FT                   LQMYGGSKVDKVITLGTPYWGAVSAAETMYTGEVSVLPDIVRGAMSGTMRDLVTNYPSM
FT                   HQLLPNTYYTNKSNWLTTEKRVYEKWYDYVWPRTKDILNNTADTQQFYKDNFNSSLVTV
FT                   ATNFHNSLYSSTAPIKLVDNTVIVGNGVNTVTSVKLATNSILGIKSRLSVPKYTTSGDG
FT                   TVPFLSATIGNGVNYIQRNGIDHTGLVKDPTTLTMVVDSIRGAIASKASVVRSAVSAQG
FT                   SPIDYKLTFAGDLNFQAIKDNTVVSSIDKLPMEDQNYYNVKDAKEVKIDNIGTVGEDNA
FT                   YLATFTQAGYTFKFKSNKDQKIDFAVGPNNLIFGFDNINLNEGADVYVNMTSQENISAA
FT                   IDNNADGVVDSVVNPTIKDLSEDITANDLVVYSSDRNAYNKLDNSLYPQMKVKNVSNKT
FT                   INLSDLELRYFFNNDGNDNNKFECDWAGLNNGTINASVKSDFVSNENGDTMLTIGFVND
FT                   GKVLMPGQEIEVQGRIHNDKWSIYNKSNDYSFSGQAYTVNSKVVLYAKDLLIFGVTP"
FT   sig_peptide     673933..674013
FT                   /locus_tag="Clocel_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            676458..678488
FT                   /locus_tag="Clocel_0547"
FT   CDS_pept        676458..678488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0547"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50320"
FT                   /db_xref="GOA:D9SR32"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR32"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50320.1"
FT                   /translation="MAAEVIQDKQTGIGERGSRGFLNSLKGRLILTYIAIALIPIVLVA
FT                   TMTYINTQKTITEKVGNLSYQSTFQTKINVDSFLAEVENAASLMFAHNDISVYNPSDKS
FT                   VDEYQKLQSEKNITEYLTSISLLKNFTDFAIVYDNNKIVGKISESTQNVYKVDTIFSEL
FT                   KSKLGDNKTKSSWYSANKGDFSRLYYIKRINDNAVMLTSFYTNELSEIFDSNDETNGME
FT                   IELIDEKNNIIYSKTSEEIGRPIDSNILEKINSEGIKVFRSNGKLVTYEDFGPEWKIIS
FT                   TIPTAYILKEVDNIAIFTMVLTLICILAASIFGFVSANSISKPIDKLVKTMKKVENGDL
FT                   TVIAQYERNDELGTLRDSFNVMTSNIRNLIENTRAVAIIVAEESGSIHENAKQAENIAS
FT                   NVTLAMSEIAEGSMNQLSELQETFNTMAKLADSINDIIKAVSQVTIISQEAKNKGDESL
FT                   VTIKELSAKNELTNITMNEINNTMGSLSDSIKEIEVVIRLIKSISEQTNLLSLNASIEA
FT                   ARAGEAGKGFAVVADEVKKLAEESSKSTESIYEVIGNVYKKANETINLINSSKKIFKEQ
FT                   AEAVEFANNSVVNIVEDTEIITAQVEKIERLMNEINNLKDKTLASTNSILSITENSSAN
FT                   TEEVLAATEEQSSTATNLSERSDKLDGAVSGLKETINRFKI"
FT   gene            678518..679777
FT                   /locus_tag="Clocel_0548"
FT   CDS_pept        678518..679777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0548"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tit:Thit_1738 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50321"
FT                   /db_xref="GOA:D9SR33"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR33"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL50321.1"
FT                   /translation="MYKKLMTLIVIFVFVFSFSGCGNEKVNSTKQQETVTIKFSWWGTD
FT                   TRHEATMSAVKKFQEKYPNIKVKMEFGEWTGFQKKMAVYIAGNTEPDVMQINYDWLQLY
FT                   SKDGAGFYDLNKVSDIFNLQNFNEKILSYGSKNNIVNGVPLASNVKGLYYNKTTFDKFG
FT                   VPIPKTWDDLFKAAEKFGEGYYPLELDSRGGWNLAATYVQQKTGKDFIKVDGTIGFSER
FT                   DIKDLLTFYKSLLDKKVIPNLQGKKISNFDEGKYAGTYQWISNSEKYAKKLKDKNQELI
FT                   AGDLPVIDDAVNSGWYVKPSSLFAISKNTEHPKEAAMLLEYLVNDTEGIVAMGTDRGLS
FT                   VSNAAKEYLNTLDKTVQFDATEKLNAIKPVLMNPYFENTLIQNICEASIEEITYDKSTI
FT                   DECAKNTYAKLVTTLSVVAK"
FT   sig_peptide     678518..678586
FT                   /locus_tag="Clocel_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.653 at
FT                   residue 23"
FT   gene            complement(679878..680051)
FT                   /locus_tag="Clocel_0549"
FT   CDS_pept        complement(679878..680051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nhl:Nhal_1050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50322"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR34"
FT                   /inference="similar to AA sequence:KEGG:Nhal_1050"
FT                   /protein_id="ADL50322.1"
FT                   /translation="MDNFSPLTETQLNEINGGWSLKKALKKAVSGLGKIIKIIIDLPKP
FT                   PSPGPTNPGPTF"
FT   gene            complement(680093..680275)
FT                   /locus_tag="Clocel_0550"
FT   CDS_pept        complement(680093..680275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0550"
FT                   /product="Bacteriocin class II, amylovorin-like"
FT                   /note="PFAM: Bacteriocin class II, amylovorin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50323"
FT                   /db_xref="GOA:D9SR35"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR35"
FT                   /inference="protein motif:PFAM:PF10439"
FT                   /protein_id="ADL50323.1"
FT                   /translation="MENFVSLTEVELHEIEGGRWSWKKIAKVAFAVIKTATTIASGGAV
FT                   IPAVIKGAITIIPEL"
FT   gene            complement(680578..680760)
FT                   /locus_tag="Clocel_0551"
FT   CDS_pept        complement(680578..680760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0551"
FT                   /product="Bacteriocin class II, amylovorin-like"
FT                   /note="PFAM: Bacteriocin class II, amylovorin-like; KEGG:
FT                   rha:RHA1_ro09148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50324"
FT                   /db_xref="GOA:D9SR36"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR36"
FT                   /inference="protein motif:PFAM:PF10439"
FT                   /protein_id="ADL50324.1"
FT                   /translation="MENFKTLSEVELHQIDGGKWKWKKIIKIAAAVAGTVVTIASGGAA
FT                   APAVIGGAIAVANEL"
FT   gene            681073..681792
FT                   /locus_tag="Clocel_0552"
FT   CDS_pept        681073..681792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: edi:EDI_341030 intracellular protein transport
FT                   protein USO1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50325"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR37"
FT                   /inference="similar to AA sequence:KEGG:EDI_341030"
FT                   /protein_id="ADL50325.1"
FT                   /translation="MNKILRVIAGVSVAACVLSGCGNDSDSSKKVESSKETSSTTENVN
FT                   NDNKNSAESTKDKNEGLPVVDDSVVREFKQDTPENAIREFYANVSSLNEKEYATFYQVP
FT                   DGYKTIKYSWECYGIEKIDVTKVEVDYNDSVPNDPIALATVQYNQKLKDIEEPLSTFTM
FT                   IELRKVNEKWVIAAQESLTQAQDQWVVKLREEKMNTDEYKKLLESSRKFQEKNSEFMSK
FT                   AAQELNKYLTGQDGTSR"
FT   sig_peptide     681073..681141
FT                   /locus_tag="Clocel_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.508 at
FT                   residue 23"
FT   gene            complement(681885..682748)
FT                   /locus_tag="Clocel_0553"
FT   CDS_pept        complement(681885..682748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0553"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.29"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; KEGG: cbe:Cbei_1903
FT                   fructose-1,6-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50326"
FT                   /db_xref="GOA:D9SR38"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR38"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ADL50326.1"
FT                   /translation="MLVSAKEMLNAARDGKYAVGQFNINNLEWTKAILLTAQENKSPVI
FT                   LGVSEGAGKYMGGYKTIVGMVNGLLEELNITVPVALHLDHGSYEGCFKAMEAGFSSIMF
FT                   DGSHYPIAENIAKTTELVKITGEKGLSLEAEVGSIGGEEDGVVGTGEVADPAECKSIAD
FT                   LGVTMLAAGIGNIHGKYPANWTGLNFEVLAKIKEATGDMPLVLHGGTGIPESMIKEGIS
FT                   LGVAKINVNTECQLSFAEATRKYIEAGKDLQSKGFDPRKLLAPGFEAIKATVKEKMELF
FT                   GSVNRA"
FT   gene            683190..683846
FT                   /locus_tag="Clocel_0554"
FT   CDS_pept        683190..683846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0554"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: eel:EUBELI_20616
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50327"
FT                   /db_xref="GOA:D9SR39"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR39"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ADL50327.1"
FT                   /translation="MKKILSLTLVASMLMLSVGCTSDKKEKLSRSAEDTSAAVQRLVDG
FT                   DKEYIKSNTNEAEITSEIRTDTAKNGQKPYAVVVTCSDSRVPPEHIFSAGLGELFVIRT
FT                   AGNVVDDYEIGSVEYGVEHLGAKVVLVLGHTGCGAVKATVEGGAEGKIETIVEEIHKAI
FT                   GNEKDMEKCVELNVENTKKKLSEDEGIKEKVKAGEVKVIGGIYDIETGEVKLLDN"
FT   sig_peptide     683190..683258
FT                   /locus_tag="Clocel_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.597 at
FT                   residue 23"
FT   gene            complement(683982..684752)
FT                   /locus_tag="Clocel_0555"
FT   CDS_pept        complement(683982..684752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0555"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="KEGG: cbh:CLC_2561 exopolysaccharide biosynthesis
FT                   protein; PFAM: PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50328"
FT                   /db_xref="GOA:D9SR40"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR40"
FT                   /inference="protein motif:PRIAM:3.1.3.48"
FT                   /protein_id="ADL50328.1"
FT                   /translation="MIDFHSHIIPNIDDGAENIATTLEMLKISYGEGTSCICATPHFIP
FT                   EEMEISRSSYDILFKEVVYKKSANIKIITGLELYMSPSIPNLWDKKKIWGINDTNYLII
FT                   ELPLNSYPNYADDVFYELSIRGVKPIIAHPERNIYLQNNLSKMKDLLGKDILFQVNSGS
FT                   LTGKFGEDAKNTAHDLVKRNMVHLLGSDAHGSDSRTPKIRKAFDLIKDMNLELYNWILS
FT                   NEENIINGKPVLPLPIKEEEKKKTIFSFLKKKRK"
FT   gene            complement(684749..685435)
FT                   /locus_tag="Clocel_0556"
FT   CDS_pept        complement(684749..685435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0556"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: cno:NT01CX_1523 capsular polysaccharide
FT                   biosynthesis protein Cap1B; TIGRFAM: capsular
FT                   exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50329"
FT                   /db_xref="GOA:D9SR41"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR41"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ADL50329.1"
FT                   /translation="MLKSLVTHLDPKSVISETYRTLRTNIQYANIDGDLRSIIITSSSP
FT                   SEGKSTTVANLAIATAQTGKKILIIDADLRKPSVHKKFGISNQLGLTNVLTEQCEIFSA
FT                   IQKSEVRNLYILASGPIPPNPSELLGSKKMQNLLDLLKSKFDMVIIDTPPVLAVTDSQI
FT                   LSTEVDGVILVAVYGKTDKKALIKAKERLDKVDANLLGSILTRVPANSKNGSSYYYYYY
FT                   GEKKAK"
FT   gene            complement(685446..686120)
FT                   /locus_tag="Clocel_0557"
FT   CDS_pept        complement(685446..686120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0557"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   cno:NT01CX_1522 Cps19aC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50330"
FT                   /db_xref="GOA:D9SR42"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR42"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADL50330.1"
FT                   /translation="MELKEYWYIIKKRLILIISFTLLCGAISGIITTFVIDKIYTADIS
FT                   VLIGKQESSDSEKTSTTYNDILMYQKIVKTYSQIAKSRKVADDVKEKLSLNMSSGALLG
FT                   SMSVSSSTDTEFMTIRFSSKDPELAAKITNQWAASLKEISKKIKGSDNVQILDNALVPS
FT                   SPSSPNVRSNVIMTLFFGFVLSIGLTFLVDYLDNTVKSEDDLSKILDSTVLGSIPDLKF
FT                   EE"
FT   gene            686486..687535
FT                   /locus_tag="Clocel_0558"
FT   CDS_pept        686486..687535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0558"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: cac:CAC3072 mannose-1-phosphate
FT                   guanylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50331"
FT                   /db_xref="GOA:D9SR43"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR43"
FT                   /inference="protein motif:PRIAM:2.7.7.13"
FT                   /protein_id="ADL50331.1"
FT                   /translation="MLCALIMAGGKGTRFWPLSTEEKPKQFLKLLGNETMIQMTVNRLK
FT                   KLIPIERIFVVTGEMYLNILKEQLPELPQENIILEPVGRNTAPCIALSAFRIKKHYEDA
FT                   TIAVLPADHLIENIDRFLHSLDIANRFIHEKPEAIVTLGMKPTRPEVGYGYIKCEKNSR
FT                   YIDEIEIRKVQAFVEKPNFIKALEYIQTGEYLWNGGMFIWKSDNILELTKKHLDKTYEI
FT                   LKYIDSQPEGDYLNTLKEMYPQVANISVDYGIMEKSQDIYVIPSEFGWDDIGTWASVER
FT                   YREKDELNNLIDGNIKIINSQNNLIIGSKKPVIVKGLDDIYFIETDDMIIIGKKEEINE
FT                   IKELKNIIE"
FT   gene            complement(687766..688602)
FT                   /locus_tag="Clocel_0559"
FT   CDS_pept        complement(687766..688602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0559"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cpr:CPR_0474 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50332"
FT                   /db_xref="GOA:D9SR44"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR44"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50332.1"
FT                   /translation="MMINERYIISESINKENRDLLVYHHGIEQCIPKHCYGPAIRDHYL
FT                   IHYILAGKGKFHANGKIYELVTGDGFLILPDMVTFYEADENEPWTYVWIGFRGIKAAAY
FT                   LESANLNMNNLIFNCTSEILKEYFFKIMNANLYSSGYELRLQGYLSIILSELIDISAMD
FT                   ILDTNKHSDIYVRKALQYIETNYSGSTSVDAVAKAIGLNRNYFSTIFKKHIGISPKEYI
FT                   IRYKIGKACEFLKNNSLTISEISKSVGYNDPLSFSKVFKHIKGVSPKYYRLKKEDT"
FT   gene            688746..690944
FT                   /locus_tag="Clocel_0560"
FT   CDS_pept        688746..690944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0560"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="KEGG: gyc:GYMC61_0528 glycoside hydrolase clan GH-D;
FT                   PFAM: glycoside hydrolase clan GH-D"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50333"
FT                   /db_xref="GOA:D9SR45"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR45"
FT                   /inference="protein motif:PRIAM:3.2.1.22"
FT                   /protein_id="ADL50333.1"
FT                   /translation="MSILYNDHNRRFHLSTKKTSYIIEISEDGYLTHLHWGRKIRNFGS
FT                   SQLLELRERCSFSANPDASKPILSLDTLPQEYPSYGNTDLRNPAFIVQLENGSTITDLK
FT                   YVSHEILKGKPTLAGLPSTYVECVDEAETLEITMEDSLIGLKVILTYTVFEDHNVITRS
FT                   ARFANEGNEKLKILRALSISVDFNRNDYKFLHLAGSWARERHVEIDSLSTGRKSIDSRR
FT                   GASSHQHNPFIALLSSEANEDNGEVYGFSLIYSGNFLAEAEIDQYQTTRVSMGINPFDF
FT                   TWLLEKGEVFQTPEVVMVYSNEGIGDMSRTYHKLYRTRLCRGEYRDKTRPVLVNNWEAT
FT                   YFNFNAEKIEDIAKVGRELGIELFVLDDGWFGKRDSDNCSLGDWVVDKNKLPAGLDDLA
FT                   KRVNNLGLKFGLWFEPEMISPNSDLYRKHPDWCIHVPNRNRSQARKQLILDLSREDVCQ
FT                   YIIKAISDVLKSAPIAYVKWDMNRNMTEVGSALLNAERQRETAHRYMLGLYRVLEAITS
FT                   AFPHVLFESCSGGGGRFDPGMLYYMPQTWTSDDSDAIERLKIQYGTSIVYPTSTMGAHV
FT                   SAVPNHQVERVTSLKTRADVAMSGNFGYELDLTKFTEEEKKEVAKQIEQYKSIRELIQF
FT                   GDMYRILSPFEGNDTAWMYVSEDKNEAFIVYVQTLAIPNPPMKRLRLKGLDPNKEYLLE
FT                   EQLNTIIGGDELMYLGLNIPEIRGDFKSITWKLKSVGL"
FT   gene            complement(691228..692784)
FT                   /locus_tag="Clocel_0561"
FT   CDS_pept        complement(691228..692784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50334"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR46"
FT                   /inference="similar to AA sequence:KEGG:Cbei_1950"
FT                   /protein_id="ADL50334.1"
FT                   /translation="MDTSRLDVNTMYLNINNFSEIIGEKINLPPESLRNYILANISIAI
FT                   VRNTTMKRAINRIYTKDKEKYYLETKKSSCVNHIILTFGTLEQELECRKVLGVLLVAEN
FT                   DYILRNNIIKLLRKNYPSIYSAVKNHDKRPLISRYNKMDEFTRSIEFRLDEAIYFYFSI
FT                   YRSMEAVDIGFIQSIIDDMQFFETSAPINKDVSKEIELHKAKIQELKDYLKNNYGKISN
FT                   YKDILTNSNPSLVSYGETLNNLFTINKFDINHLFSDYQFINIDEILLAYIKNHNQSIDD
FT                   SLLLFSIVSGVFIKCLINEYKKNKLLYFESNQETLSFEIDNLNEVNNKLTLENKELSKK
FT                   IILLESEKLAFDKNLKDELTRLNKFHLQELNIFKSKISALEKDLKEDTIYKSELYRLRE
FT                   YIFQEKKHYIFLNESRNFKELIADKKLIIIGGTKEWRRKFRDKYPEIRTLNGFNESFDP
FT                   SILANYYYIFFYTGFMNHSTYYKAINFIRTNNLNFGYIGKTNIDLVEQEIIEELDTLTL
FT                   T"
FT   gene            693295..703161
FT                   /locus_tag="Clocel_0562"
FT   CDS_pept        693295..703161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0562"
FT                   /product="YD repeat-containing protein"
FT                   /note="PFAM: YD repeat-containing protein; KEGG:
FT                   cth:Cthe_3052 YD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50335"
FT                   /db_xref="GOA:D9SR47"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR47"
FT                   /inference="protein motif:PFAM:PF05593"
FT                   /protein_id="ADL50335.1"
FT                   /translation="MKKFKRFIAFFLIFSIIFTQNQQILVDTFKNVDLDINLGVLSNIT
FT                   LPTIPTSEKTTTTQNRDIPNLEQMHTLELEELNNLTTENQSITMEKQNLLSFQTPSIIE
FT                   VRSINDSTNLINWTYEEDFEYQLEVDGQIVDLKSVKGYVHNFDSNNKTHIYRIRSKSQE
FT                   QFSQWSEAVTKATEPGKTLTDSVLPIDRNLLKRRIPTATNPIVALTDTISEPSVQYEVH
FT                   VKGAPLSDWQNSKDGRLIVTNGIDAIKVSLLSPPSGLKIKYRVYSENGTWQPWTYDGGI
FT                   CGIYGKNIQMIEMKLEGITTSFSIGYILTNNANQESFPLEMDGETSGTMGTNSGIFLAC
FT                   LVNNNDSKVEVIDKDTTWKKSEGPHIIDGIVRVEPGVTLTIEPGTKVIFQKYKYRENGL
FT                   YINGKVIMEGTPSEKIQFSSMVDGQAVSTDQYYFRGIYVLPTGEIKASYVDMELDRKDN
FT                   YILVNGDVSFNYCNFNCVGDSGIDWNYVIYAKVEREKVLNVSNCTFSNAGQGIGLGDSF
FT                   GEVNITNNSFSNTIRDSIQVGISDYETYSVLANIKANTIVGGKNGISLKGIRSNIVNIK
FT                   VTDNVIKNCSETGVYIEEYLGSLTFQRNTISGVDTNRVKELSGPIVVKVEKLGTNFSSV
FT                   ISAVNPKDVALKNTLSGNNFDAIVLNGTINENSRLFNGTNRYLVRSYLDISKDKTLSIE
FT                   DGTIIHLRGEVVVYGCIRSEGKANNQIVFTSVNSEYTLPYKPTSDPAQKIMDDFFPWIN
FT                   IRNSGSFLGLNTVINRGGGPRKAGGPGYCSINLDGKLTLINSSVFNSTNAGIDAFKDNE
FT                   STEPSDLTIINCSITHNMGHGIWIGHIPATIINSDIHQNDSGIVTFADDTVIAGNSFVG
FT                   NRTSAVNYWNDTKDKYIDLRNNYWGASDGPYATDTGGGAWEGKGQKVNVYPGYAVVYPF
FT                   LKTPSDCVPVGDLNNYVRSVQLRDQKWFGSQGVSVATGNYCKTFMDMEDCFPNLGLSLS
FT                   HTYNSKDETVSILGKGWRLSLQGEISDFSSSAGTAMKKVVLPSGETQTFTVNSNGTFTA
FT                   NDSRNTLTKAGDTFTLTNKEQMQYLFNSSGKLYCVKDKNGNAVNIAYDNGKIDRVYDET
FT                   NKSFKLTYDAATGYIDKITESFGTVTGRIVDFNYDSSKRLSSVTDASGNVTNYVYSGIG
FT                   LLQDTKSGEGALLERIIYTLDGGSYKVRQKIDNYGNSFTYKYDDFVNRTIVTESNGWVK
FT                   EYWCDSYGYPTVTIYPDRSTENKEYYLDASGENKYGEIKASMDIYGNRTEYIRDGRGNV
FT                   TKQINPDESEKNFAYDDKNNLIKEVNEDGNVTYYCYDANKINLIQKVQPLNGTDPLVNP
FT                   LDETKFAITSYEYYSETERVQNGYKVKGSLKTEKTPLGNTTTFKYDANGNKTVVTDGFG
FT                   NNTVYTYDSYNNEASMTTSEGYKTTYVYDMNGRLEKATLHGGEVTRTVYDNEGQKLKEI
FT                   TPNIYDAALDNIDAHTYSGEHGTRFTYYYNGKVATATDAMGNTTRYYYDKYGNVSKEIK
FT                   PNKSVYLYQYDCHNRPIKTTFKESDASTTEILIEEFNYSLSYDRTLESNVLIKSHKQYI
FT                   DNTNTVTSILKFDYANRLVKVKNSDGTEISTKYTPSGLKLIEKDEDSNETLYNYDALGR
FT                   LIKKWTPISENDDVTYYSYSGFQYDKDGNKKVEWTGKNLVEYGVSVSILDPNAIKLTYD
FT                   YYKDGKVQSKVDNEGRRTDYEYSKDRVLTKETVFLTYGGKYEITEYRNNYLGKPIKTLV
FT                   KTAKQDIIGNSITDSALSNMWTTYEYDKNGNLKNVKNYGVVDGTDILSTTPVLNVTSYE
FT                   YDNLNRETKQTKQAKNTAGNDTTIFTSKNYSWDGKVLNSRDGNGRVTTNTYDLRGRLVK
FT                   VRDPKGQYTLFTYDYLGRVLSKTISRLNEDYNSYIQKFNAAINTTPDSPNWDPEYDFNK
FT                   DNVVDLYDNVIINRENIDKTLFEYDDMGRVIREIKSSRNPNTLAWDNVTTKAYKYDNQG
FT                   NVIKELDALGYEQGSGATPAEKIENGYGTEYTYNLLNKQTSVLTPASKDKGLAFNSKYE
FT                   YDGLGRVVKDISANQGSYTYEYNNSGKLTKTTLNKKDGSQLVIKTNQYDLGDNLISEKD
FT                   AKGIETKYEYNLLGKIRKVTTASDATINANTIQYQYDIYGNQALSQESSGRVDLTEYDN
FT                   AGRKIHEKTQKSDGTQVIEKFYFNDGNGNVVAFIDGNGNKTTSTYDEQNKITSKRINVT
FT                   YVDGSTKENRITYEYDIFGQLISETDPLGNVLKYKYDAFGRVIDKRDAYNKVIQILTYN
FT                   ANGSQKESFDALNNEITYIYDKDKRLIKSINGDEATGTIAAEQVYDERNNVIEKRDGNG
FT                   NSTKYQYDELNKLKSVTNALGQVTSYTYDDNGNMETMTDGNGNVTYYEYNCANKPIKIK
FT                   TLKKDITTNVSGNTVDLSTANLSEGYTYYVDGNIKTRTSKNTDVTTYTYDIYGRKLTEV
FT                   IGSINNSYTYDKNDNLLTVKDSTGTTTRTYDALNRTITKDVPNGGTTKYLYDSTNGVDP
FT                   GCYAEVSTDAKGFVTTKIFDKAKRLYKVTESGNTTTYNYYDNGNRQEVIYPNGSKEVYY
FT                   YNKNNTLAKLENKNPNGSIAESFVYEYDNSGNITAKVDKKGKTIYTYDRLNRVETTTEQ
FT                   DGKITTYKYDNAGNRTSMSAVFGSNVETTEYYYDSLNRLRYSHQLLTGIQDSGVALTAE
FT                   KQNSKYDYDENGNQIKVTETSYDSTKQQNVVKETINKYDKLNQLIETTTKDGVVVKNAY
FT                   NAEGYRVAKDVNGVKTNFVYEGDKVVLELDASGNEKGRNIYGENLISRNADGQKVYYLY
FT                   NGHSDVTTLTNEAGAIIGTYYYDEFGAVEESTGTVDNPFLYAGYRYDKETGNYYLNSRM
FT                   YDPVTARFLQEDTYRGSYNDPLSLNLYTYCYNNPLIYDDPTGHWLHIAIGALVGAVAGV
FT                   AINAVSDYLDDGKFNKGWKSYAGAAVEGAITGGLAAATGGLSLGATIAINAGASFVGNV
FT                   AGQYISKGEVNWKEAAVSAVVGGGGAAAGHYAKKIVSKLPSIPKPPVISRAEQLLNKAK
FT                   ARVKVLGDAGMSRLNQISDNIASKISSKLSPQMSFAGVGNINLPKTSFRGNVKEVGIFK
FT                   KADTSVQKNFKDVVKTNEKRIEALNSSGGINKNINKTQSGSKSFYTVQNAEDGARLLND
FT                   GTPWPTEPHKANLGEGVYSWDNLEDAENYLKLKKRRTDVELNIYEFKVANKDLAKMKSL
FT                   DMTKLPDDEVDAFLDIHAKLNGGTPNHGLEYIRRATNIGVENYFHSSVFKYLKFTKK"
FT   gene            703175..703600
FT                   /locus_tag="Clocel_0563"
FT   CDS_pept        703175..703600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50336"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR48"
FT                   /inference="similar to AA sequence:KEGG:HCH_03160"
FT                   /protein_id="ADL50336.1"
FT                   /translation="MSMYEHTYRVFKSSWGISIKITAEITTVGNCDEDSKYDKICDGLM
FT                   AGYASKPLVDGEKFLEEDKIFLWEGLKRVGDLIVNTSPYKADTLIIIHSLVFSLCDFQE
FT                   EGLTAAIIEWAANACGFQAPIINVSFNKELNKYEFKY"
FT   gene            704364..704960
FT                   /locus_tag="Clocel_0564"
FT   CDS_pept        704364..704960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B2107 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50337"
FT                   /db_xref="InterPro:IPR028048"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR49"
FT                   /inference="similar to AA sequence:KEGG:H16_B2107"
FT                   /protein_id="ADL50337.1"
FT                   /translation="MSRLNQISDNIASKISSKLSPQMSFAGVGNVNLPKTNFRDTVKDL
FT                   GFFKKADTSVQKNFKEAVKTNEKRLEALNSSGGINKGAGNPVSRKQALSEIKKDLGISK
FT                   SQQPLEQKMVPLLDENKNRILDANNNFVETRELTYSVQGKFDVQGNPIDKVVIQDHSYG
FT                   HYYNSGIGNQPSHFNVRPSTNTKNGAVQGMKDHYY"
FT   gene            704979..705362
FT                   /locus_tag="Clocel_0565"
FT   CDS_pept        704979..705362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC0929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50338"
FT                   /db_xref="InterPro:IPR028957"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR50"
FT                   /inference="similar to AA sequence:KEGG:BC0929"
FT                   /protein_id="ADL50338.1"
FT                   /translation="MFEGIDNAVVIKNIFGDKNVFEKAELINVNWQMIDSRIELSILVH
FT                   DEPTKVPKKWGVFESVYVRLEFYGLNYLRIDVKEDKPRIEKFTMQSNSDKYCCKISMSD
FT                   EQEIQCTFEVARIQNIKPFVDKQ"
FT   gene            705466..705929
FT                   /pseudo
FT                   /locus_tag="Clocel_0566"
FT   gene            705938..706420
FT                   /locus_tag="Clocel_0567"
FT   CDS_pept        705938..706420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50339"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR51"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1623"
FT                   /protein_id="ADL50339.1"
FT                   /translation="MKYTIRKLFEVIDEVKDENEFFYELDGGDEGADYFIELITNFSPR
FT                   EKEIIKSECHGQCLNNLSLGEQEVDVDGFLVFERMAHEEDYRILRVNSIDEVEKIIFGK
FT                   AGITNMFTADIVVLENGKRKKYSIKDKKGNIINFEDFYRKDYKDLDDEYFLQWISR"
FT   gene            706807..706923
FT                   /pseudo
FT                   /locus_tag="Clocel_0568"
FT   gene            706942..707034
FT                   /locus_tag="Clocel_0569"
FT   CDS_pept        706942..707034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50340"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL50340.1"
FT                   /translation="MYLEIDNKFVLDNIFGDIDVFKGAEITNTN"
FT   gene            complement(707158..709572)
FT                   /locus_tag="Clocel_0570"
FT   CDS_pept        complement(707158..709572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0570"
FT                   /product="cellulosome anchoring protein cohesin region"
FT                   /note="PFAM: cellulosome anchoring protein cohesin region;
FT                   KEGG: pjd:Pjdr2_3202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50341"
FT                   /db_xref="GOA:D9SR53"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR53"
FT                   /inference="protein motif:PFAM:PF00963"
FT                   /protein_id="ADL50341.1"
FT                   /translation="MKISCDLRFKKIFSVLCICILFLGFSLTSIPVSAATETTVSYSIT
FT                   GDGIVGSTVEIAANVSSASNLYGVSWDFIYDTSMLQIQSISAGPLMGTNISKFTSNANG
FT                   RAYISMSKFTTASPVNGEGTLAIIRARVLKVGTIKINTTPTTSNLNISNLTSCIKLSDD
FT                   YSNKIAYSYKDSSIITKPISSLTDGKYENTNGNLTYTDNWIKATDSSQHFSNVLDNEVS
FT                   FSFEGTGVNIHSITANNRGIAKVYIDGIAYDADDYTETVQRKVIFSKTDLPIGKHEVRI
FT                   VVTNNKNAASTGYYISIDAIEILCNPPVLKSGKYQNTDSNLFYAGSWVQVTDGSQRYSK
FT                   IENSTLYFSFEGTGFNLTSLVASNRGIAKIYVDGTAYDIDTYSPTVTSKIIFAKDGLPF
FT                   GKHDVKVVVTNTKNATSTDTYISIAAIEILISPPVLTTGKYENTNSNLIYTGSWVQVAD
FT                   GSQRYSNIVDSAFQFSFEGTGFNLNSLVANNRGIAKVYIDGTSYDVDTYSDVVQRKTIF
FT                   SKDGLAMGKHTVKVVITNTKNAASSNYYISITSIEILNSSPVLASGMYENTSSDIAYTG
FT                   SWVKVTDGSQNYSKIENSALYFSFQGTGFNLHSIVANNRGIAKVYVDGVAYDVDTYSPT
FT                   VERKIVFTKDGLAYGKHNVKILVTNTKNTTSTDTYISIDAVEILVTPPTLSSGKYDNFD
FT                   PNLIYTGSWTSVAYDSQHFSKTENSTVSFSFEGTGFNLHSLVASNRGIAKLYVDGVAYD
FT                   VDTYSPTIERKIVFTKDGLTYGKHNVQIVVTCTKNTISTDTYISIDAVEII"
FT   sig_peptide     complement(709468..709572)
FT                   /locus_tag="Clocel_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.964 at
FT                   residue 35"
FT   gene            complement(709785..710927)
FT                   /locus_tag="Clocel_0571"
FT   CDS_pept        complement(709785..710927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0571"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: cbe:Cbei_1821 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50342"
FT                   /db_xref="GOA:D9SR54"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR54"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADL50342.1"
FT                   /translation="MNNSFIDLKINQNLIEGLEKQNITIPTEIQQLVIKSALENKDIIG
FT                   ESYTGSGKTLSYLLPIFHKIDTAKREMQAIILAPTHELVMQIEEQVSLLAKNSEIPVTS
FT                   LTIIGEASMEKQIKKLKDNKPHIIVGTIGRVLDLIQKKKIKAHTVKTIVIDEADNLLSE
FT                   SSLGTVNNIIKTTMRDRQLMAFSATINPKTLDTAKALMKEPEVFKTDGKVAMNPRISHE
FT                   YIVCSHRDKFEILRKLIAATKTERAIVFLNKNEEIQLITDKLNYHSKNAGGIYGAASKE
FT                   ERKNTINSFKSGKINLLVSSDLSARGLDVPEVTHIFNLDFPVNTNDYSHRAGRTARGNL
FT                   SGTCISIITEKELAAIRVYEREFNVKFEQIDVYEGRIHKA"
FT   gene            711114..711827
FT                   /locus_tag="Clocel_0572"
FT   CDS_pept        711114..711827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0572"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG:
FT                   bay:RBAM_006580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50343"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR55"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADL50343.1"
FT                   /translation="MGVLGRFKAIMEANINALLDKAEDPSKMIDQYLRDLNSDLGKVKA
FT                   ETAAIMAEEQRTKRVYEECGVEIEKMQNYAKKAVQAGNDNDARQFLGKKAELLQKQESL
FT                   KMAYDAAKANAIKMKSMHDKLQRDIGQLNARKDAIKAKVSIAKTQERINKMGASITNAG
FT                   ANISAFDRMEEKADRMLDEANAMAELNKSSEEVDINLLTSKYDSSINIEDELEMLKGND
FT                   IEEELKALKENSTQD"
FT   gene            711918..713126
FT                   /locus_tag="Clocel_0573"
FT   CDS_pept        711918..713126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lba:Lebu_1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50344"
FT                   /db_xref="GOA:D9SR56"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR56"
FT                   /inference="similar to AA sequence:KEGG:Lebu_1615"
FT                   /protein_id="ADL50344.1"
FT                   /translation="MDKESYKCECCGGTMEFDVKTQKLKCPNCDNMIEIIDNKNFVIEH
FT                   KFTLIDRETIKVSMKNSSTMECQGCGAHVEVASDCTAVSCPYCGSSYVLAEKQEEILIP
FT                   DGVIPFKVEKAEIAQMMRKWIYSRWLAPNKLKALYENDKIQGIYVPYWTFDAMVDCPYT
FT                   AMGGRDRQVAYQDREGKVHYRTETDWFFTKGRINYFFDDVQVTASRNMNPSLINGIEPF
FT                   TTKDIASYSPSYLSGFSAETYSIGLEEGNIEAKKKMRNELHRMAEKEVTRHYDRVREVR
FT                   LNPSFYDETYKHVLLPVYATSYSYNGKNYHVLINGETGKMKGDYPKSPFKIAILVIFAM
FT                   IIAAIILYLKNHSEIRKVSFNNNIYQTQLSNSQNIFNNIYEEVNKFNNQEVYIHGVIFK
FT                   SVL"
FT   gene            713098..714069
FT                   /locus_tag="Clocel_0574"
FT   CDS_pept        713098..714069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0574"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: bld:BLi00643 YdjI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50345"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR57"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADL50345.1"
FT                   /translation="MGLFSSQFSNVVEWEEYRDDLIFWKWSNKEIKKGSRLIIRQGQDA
FT                   IFMYNGKLEGIFTDEGSYDMESQIVPFLSTLKGFKFGFNSGIRAEVLFINTKEFTVKWG
FT                   TKNPVSIEAPGLPGGMPIRTFGTFNFKVADYMVLIEKIAGIKKQYAVEDIKERVTSILN
FT                   QLLMKWIAKEGKNKFNLQANAFDIAKGIREDLDMEIIKLGITVTGFNIESFTYPEEVEK
FT                   MATKVASHSMINDMGKYQNVSIVDGMASGNMKGGGTASDVMGIQMGYMMGKQVVDQMQQ
FT                   NKNVNNVASQETTTSAAPKFCPNCGVKTQGTKFCSNCGYKLI"
FT   gene            714431..716131
FT                   /locus_tag="Clocel_0575"
FT   CDS_pept        714431..716131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0575"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: afl:Aflv_1304 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50346"
FT                   /db_xref="GOA:D9SR58"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR58"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50346.1"
FT                   /translation="MKNLRLKGRIVRLLILSVICISSSLLGLSYYFTNKATQSSVTDEL
FT                   TSTSNLVSAVLDSSYPGTWALNGEKLTKGKNPLHDIVGIIDKVKEQSNSEVTIFANDTR
FT                   FITTLIVDNKRNVGTKADEKVIEIVLKNGEEFQSQVTISGVKYIGKYTPIKNGKNEIVG
FT                   MIFVGKEYAVLMKPLTESIVYMVGCTIIVAILMIILGGVFASRVAKPISISVKALKRVS
FT                   SGDLTEDIPSNLSIRKDEAAELAEAVGDMQNFLNNIVNNIKSTTSNMFNSSSNLLTVSE
FT                   NMTAASSNITHAIGEMASGTVGQAEDISDISQSLNEFGNKIQEAKEATSMIHDGSIEIE
FT                   KMTNENNVQMKMVVDSIGNVKEQFDEFANSVSILGSNITRVDEITGVINSIADQTNLLA
FT                   LNAAIEAARAGESGKGFAVVADEIRKLAEESRKSSESIKELVAFIAKDTYKIVDNSKEV
FT                   NNKLAEQLEAINKTLGSFEGITKSVSDIIPKINQVDKNSESINESKTTLISKAENAASI
FT                   AEEISAATEEIAASSEEMASSAIEVEKVSEVLNLETKKLIDYVSIFKSK"
FT   gene            716339..718042
FT                   /locus_tag="Clocel_0576"
FT   CDS_pept        716339..718042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0576"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: afl:Aflv_1304 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50347"
FT                   /db_xref="GOA:D9SR59"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR59"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50347.1"
FT                   /translation="MKGFKMRGKILILVIALILSTGITSLVIGYSSSSSLAKDGIYEEL
FT                   TSVEKMTVSLINEKYPGDWKLDGNKLYKGDNLINEDNEFVDFVKEQTNCEITIFRKDTR
FT                   IVTTISEDGKRIVGTTAKENVVSTVIDNKKDYQGNVEISGEPFLVKYSPIVDSKGNAIG
FT                   MVFIGKENSDVRSMINSSIALMLIATVVISILAYILSAIIVKKIINPIIISIECLKKVA
FT                   NGDLTLDIPEDLTVRHDEAGELAKAVQNMQKSLKAIVTNIKKVTGEVYENSENLLAISE
FT                   EMSATSDNISHAVQEMASGSTSQAQDLSTVTEALNDFGDKIEDTKESVSVIYNGSVEIG
FT                   NMTSSSNEDMKNVVNSINSVKSEFDGFTHKIQGLGDNIKRINEITEAINSIAQQTNLLA
FT                   LNAAIEAARAGESGRGFAVVAEEIRKLAEQSSESSDNIKALVESISKDADNIVHSSTIV
FT                   NDQLTEQLDVIDNTIVSFKKITKSIESIIPKMNGVNKATNDINESKDGILGKAENTAAI
FT                   AEEISASSEEIAASTQEMNNAACQVAKSAEELTLQTKRLIEEIEVFKVEK"
FT   sig_peptide     716339..716452
FT                   /locus_tag="Clocel_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.985 at
FT                   residue 38"
FT   gene            718270..718965
FT                   /locus_tag="Clocel_0577"
FT   CDS_pept        718270..718965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0577"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbb:CLD_1399 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50348"
FT                   /db_xref="GOA:D9SR60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR60"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50348.1"
FT                   /translation="MLKVTNLTKKYGKMLAVKNVSFFVETGEIAVLAGPNGAGKSTVIK
FT                   SIVGLLRYQGSITVNDKINKSIEGKSYIGYIPEIPSLFPLLTVSEHITLMAHAFGIKDY
FT                   ETEAEELLKAFDLWDKKDKFGSELSKGMQQKVSICCAIITKPKILLVDEPMVGLDPKAI
FT                   RTMKNLLLKLKEQGTSIVVSTHLLDSVQDLWDRIIIMKDGEFVYSNTKHEIGKEDKSLE
FT                   DIFFEYTEE"
FT   gene            718969..720552
FT                   /locus_tag="Clocel_0578"
FT   CDS_pept        718969..720552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_1192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50349"
FT                   /db_xref="GOA:D9SR61"
FT                   /db_xref="InterPro:IPR031584"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR61"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_1192"
FT                   /protein_id="ADL50349.1"
FT                   /translation="MKALIYLMKTNIINYFKQLKKKPAKAIGPIAMVVFMITMFLSKND
FT                   TSKTLDIDIFISLFLLITISAFIYSLYTGTKSINSKFNMADVNLIFVSPIKPQTVMIYG
FT                   IIKKMSVELFAYFYIIYQIPNLTKSMDITIGQTVSVIIIFIIMQIVFCNIVKLLVFVLN
FT                   SKYPLLGRIIRLTIKIVGAVLCVAAVLIFLKGRPITFVKELYSSIGQDSWIKFIPIFGW
FT                   VREMVYQSLTTINMTFFLYLAMIIFLSVLLVYITYCIEIDFYEDMLSSAEANEVIKKAK
FT                   NREQVTTESNRNNRLFKAFRKVQLKLDNKYKAEVLFYKHLNEYSKRSFLFFINTYSIIL
FT                   LLVSLTLGIFAKGVEIKLVYMIFCGLLFFGAGLAGKIYYEITNPLIFMIPDSPQKKLFY
FT                   GTASSLIKLVSDSIILFIPFGILSGVSIIEMFLCCISYVLLGAMFSYSGLVGFRISNYF
FT                   GFTDQISQGVFFMFFQMFLLVPAAIMVITLGVATEFSGYAIYLAMIAYTSVLTVIFSFG
FT                   AVGIFDNMEL"
FT   gene            720580..720846
FT                   /locus_tag="Clocel_0579"
FT   CDS_pept        720580..720846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50350"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR62"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0044"
FT                   /protein_id="ADL50350.1"
FT                   /translation="MMVKIWGKLIKNNKIIKQAVASSDIHDTYQENLTECIVELCYGFD
FT                   IGKPYWLTKNADEYNKRYKTTFNVDNFIESIEFDKFIIEALEE"
FT   gene            complement(720971..721594)
FT                   /locus_tag="Clocel_0580"
FT   CDS_pept        complement(720971..721594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_05374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50351"
FT                   /db_xref="InterPro:IPR032256"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR63"
FT                   /inference="similar to AA sequence:KEGG:PFHG_05374"
FT                   /protein_id="ADL50351.1"
FT                   /translation="MLNNKKSLLSIFLVIALFTGAGCSKTEKPVKESSTANSSLSDGTS
FT                   NVSASYELEYHNDTRFFKAEIEPKSDAEKVILDKFKIQINDKYDELSKLFIDSPEFNNQ
FT                   SQIYKNLFDEGEYAEAITIHSLKKLSEEEYSNNPDFISYNFMDTINKFNPYEFQVIEVN
FT                   YTIKLTDKYASAAQWSNGNWTRDFIVVQEKENTPWRIFDIYGYH"
FT   sig_peptide     complement(721520..721594)
FT                   /locus_tag="Clocel_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.729 at
FT                   residue 25"
FT   gene            721931..722305
FT                   /locus_tag="Clocel_0581"
FT   CDS_pept        721931..722305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0581"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cno:NT01CX_0788 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50352"
FT                   /db_xref="GOA:D9SR64"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR64"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL50352.1"
FT                   /translation="MSYYFDDKIPIYLQIMDIIKQNIVSGELSEGDKLLSVREMAEKYS
FT                   VNPNTIQRAYQELERNNIIYTQRGMGTFITKDSSKIEEIKNTMAVDIVITFIDGMKKIG
FT                   FASEEAIKVLQNYVAKEMKG"
FT   gene            722302..723003
FT                   /locus_tag="Clocel_0582"
FT   CDS_pept        722302..723003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0582"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ckr:CKR_2082 hypothetical protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50353"
FT                   /db_xref="GOA:D9SR65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR65"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50353.1"
FT                   /translation="MKSILEIENLSKSFSRRKALDGISLNLENSKVLGLIGPAGSGKTT
FT                   LINIIAGLAKQDQGTIKIDDHEPGVYTKEIVSYLPQGNHLHNWMTVKEEIGFFQDFYKD
FT                   FDKKKAENLLSDMNIDGKIKVGNLSKDNLEKLKLTLIFSRKAKLYLLDEPFSGADSLVR
FT                   DEIIDIILRSYDEESSVILSSKDAKIFERLVDKVAFISGGKILLSGDPEDLRHERRMSI
FT                   DDLYREVIKNV"
FT   gene            722996..723796
FT                   /locus_tag="Clocel_0583"
FT   CDS_pept        722996..723796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0583"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_3770 putative ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50354"
FT                   /db_xref="GOA:D9SR66"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR66"
FT                   /inference="similar to AA sequence:KEGG:CLK_3770"
FT                   /protein_id="ADL50354.1"
FT                   /translation="MFKLLKYELKARNKIIFATCIALILINLFALISFKWGGLMSNSKG
FT                   LSFSGDVDLNFTSIMSMLVAIIINGVSMIVAIIMAIRILLKDIFSDSGKLLFTLPKNGC
FT                   TIVGAKLISAAGEFLIYFSIILVFAALHVMKIVKASEAAIGKTLYLMDDLLYIAVIALV
FT                   GYVFVIVLAYFSIILFRSIAKTKSLATVLAVIAFFALNGAFGAIGRLIKNAMPIYIELQ
FT                   KFTIESTSSASITQTSVTGLLFKIVVAIVLFAVSASIIEKRVEI"
FT   gene            723835..724512
FT                   /locus_tag="Clocel_0584"
FT   CDS_pept        723835..724512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0584"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cac:CAC3560 ABC-type transporter, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50355"
FT                   /db_xref="GOA:D9SR67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50355.1"
FT                   /translation="MSYVIEVEDLHKSYQMGDMSVDILKGISLNISLGEFVSIMGPSGS
FT                   GKSTLLYLLGGLDKPTKGSIKIKGSDIAKMNDKAESIMRRREIGFVFQFYNLIPNLTVE
FT                   ENIMLPLLLDGKKTNKYKKELNDILEIVGLTERRNHTPRELSGGQQQRVAIARALINEP
FT                   DIILADEPIGNLDSKTGNEIMNLFQKINKEKGKTIVQVTHSIESAGFGQRIINVRDGKV
FT                   ENI"
FT   gene            724512..725678
FT                   /locus_tag="Clocel_0585"
FT   CDS_pept        724512..725678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_3080 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50356"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR68"
FT                   /inference="similar to AA sequence:KEGG:Amet_3080"
FT                   /protein_id="ADL50356.1"
FT                   /translation="MKKLFIMFLIAAAMTTLTACSESQQSVTVTASNSTEEASSTGNVQ
FT                   AYGVIKSGTVKNINVNFPTAVEEIYVKAGQKVTKGEKLVRINISEYEGLIKNKEHEARV
FT                   AQLEVQSAQNGENIDLQNETIRKLNEDLVTKQGYLNNNSSPEMIKLQKDLTYCQNAYNK
FT                   AKSALDANEAAAKQNKLSSATELEESRSKEQEAFKALEDVKFDIDTLNAKLKEEIGQIQ
FT                   SDISKAQIQQNTITAGNVPEVQTEKLNQLNEEIALMRKNLEEAFLKDGIISCDVDSAVV
FT                   GDVISNVGEAVEKNVKLLSLIDTKQLIVEADISEEFYKDVKQGATVKIIPIADKSKEYT
FT                   GKVTYIASNVTKENTESIIKAQITIENADEFLLPGLNVNLQINAQGVK"
FT   sig_peptide     724512..724577
FT                   /locus_tag="Clocel_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.611 at
FT                   residue 22"
FT   gene            725723..728212
FT                   /locus_tag="Clocel_0586"
FT   CDS_pept        725723..728212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0586"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   amt:Amet_3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50357"
FT                   /db_xref="GOA:D9SR69"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR69"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL50357.1"
FT                   /translation="MSIVLKMLIKNITSKKARTFLILFSIILSTAVFFSSIAISGSILK
FT                   TVLGSVTQVVGVSDITISPTEKSDSKFLSQSALEKYKNDFDIVVGELDASGVYNVTLGE
FT                   SVPVIVKGVVPEELNKVNPFSIASSLENEEFKGKSIIVSSTVAEDHNLKLGDTITVVIK
FT                   GQEQRFTLWGIASAKGPFSKAITVPNFAIPEETMASLLDAHGKKNILYIKLKDTSLKKS
FT                   MVKTLQSDYKSYQVKETFNVEKLQSNLSDISSIFLLLSGIVFFMSAFIIYSSFKVIAAE
FT                   RIPVIGTLRSIGATKKTTNTILLGESILYGTIGGFLGCGFGIGLLYVLSLYMSDIANVT
FT                   PGLQLNTTIQFSFAQLAVAFIISILLSFISSIFPIMKISKIPIKDVILRTAELVKKDKK
FT                   IKILLPIICVVIAYLITIPKYNPDDNLFLGLAMLFALLAIVFFIPYATKLFVKLFEKIY
FT                   VVIFGNIGILAAKNLRENKGVLNNMIMLAISISVLLAINTTGYNTVLSSLNSYKGANFD
FT                   LKITVSNAENSFVNKLYNKDGVEDVYVDYEFENIKIVDTDTAIGTVKGIDMLKFSDFWT
FT                   ISTEEDFGDMSKELDAGRNIMISSTLQRTLEVQKGDVLKLKTTSGEKEYKIIGFFKDFM
FT                   NDSDYALVSERFMKADMKSSEASAYYVRSSIAPKELGKELKADFKKLSPKINTKAQLEQ
FT                   IEVDDNVNTISLMQSFCIMAIVIGFFGVINNLVLSFMQRKQSLAMFRSVGMSKKQIVSM
FT                   TFIEAFTGAVIGGIMGVVGGIGMTYILSKLDDSKLVIQIEYLGLYVAIGILVMILASII
FT                   PVVKSAKLNLIEAVKQE"
FT   sig_peptide     725723..725845
FT                   /locus_tag="Clocel_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.510 at
FT                   residue 41"
FT   gene            complement(728492..729733)
FT                   /locus_tag="Clocel_0587"
FT   CDS_pept        complement(728492..729733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0587"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   ckr:CKR_0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50358"
FT                   /db_xref="GOA:D9SR70"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR70"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL50358.1"
FT                   /translation="MNYKRKANMALGISVIFFCLCVVLRYFYRDAVIFKLLLFVAEASL
FT                   VGGIADWFAVTALFTKPLGFTYHTEIIPRNRKSIINSTANLVETDLLSKQTLKKHIDNL
FT                   AIVELLVKYFDEDKERKTNYIDKLSQFIMKYICKKDLKVAASYIENLLRKEGKNVSLSN
FT                   KLKDFIEDKFIYENRIVWVQDLLNKLSKGELDELILTISRKILANSEEKSSFSLKNLLK
FT                   KLNVSMAEDLANLIKSQLKIILTELMKEESGLPQECVENIIRSLDGIELSPASIEQWKL
FT                   NLLESTDFKPIIEAQLPLAINEISINTIVEKLWDYFKENSTIKSAIDRGIKELICDLLE
FT                   ENHNVIGSIVSDTLNNFTDEKLNAFVEDKAGEDLQWIRINGSVLGGCIGLVLFGFLNLI
FT                   FEPYVSPIIRGLLS"
FT   gene            complement(729745..731049)
FT                   /locus_tag="Clocel_0588"
FT   CDS_pept        complement(729745..731049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0588"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   dae:Dtox_1997 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50359"
FT                   /db_xref="GOA:D9SR71"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR71"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL50359.1"
FT                   /translation="MERNISKEKRKNSNIATWILLIFSAVFFISYPFHYSFLGGLISSL
FT                   CCAAMIGGLADWFAVVALFRTPLNSNVLRKLFESSKFIRTEIIPKNRERIFQALVDMVE
FT                   KELLTKESIISKLENINPSGIIIDQIKTDKKQNLHIILDTVFKEIVCNLNEKDLENIET
FT                   LTNKILKDNLKSLELSNIISQVLDWMWDNGYKEKITDILIDKIEELSKTYEAKMLIQDA
FT                   VLHILELNRGSFLIMIVGFFVKGNLENISKGVQEKLVGFLADMREPDSIERGQIQSFAK
FT                   KQLDRLKTDDALKNSIENWKNEKLVGNDAVIKKLGEILTQYISSLKSEPTKTFHITEGL
FT                   LDKVENQLEDFVINEEKQITFNTAIKNIIEQTVEKNHYKIGLIVKEKLDGISGEELSNM
FT                   IEPIIGSDLQLIRINGSLVGGLVGIITYLLTFWIV"
FT   gene            731364..733673
FT                   /locus_tag="Clocel_0589"
FT   CDS_pept        731364..733673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0589"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="KEGG: cce:Ccel_1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50360"
FT                   /db_xref="GOA:D9SR72"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR72"
FT                   /inference="protein motif:PRIAM:3.2.1.51"
FT                   /protein_id="ADL50360.1"
FT                   /translation="MSIKDLKNSEDLFKLWYDEPAEVWNWDQALPVGNGKLGAMVFGHV
FT                   HKEQIQLNEESLWSGGYLDRNNPDALAQLPKVRQLLFDGKLKEAERLCAIAMMGTPEHQ
FT                   RHYETLGDLFIDFYHDSDEVKNYRRELDINKAMVTVQYEIDGVNFKREILSSAVDDAIV
FT                   IRITADKKEAISFRGFVGRELFMDTRTALNDSTVALRGGCGGPDSINYSIILKGTSEGG
FT                   NLYTMGGNIVVENADAVTLYLTSKTSYLSNDFDAVAISTAEAVSKRTYESILQDHIAEY
FT                   QSYFSRMTLQLGNKQEALELSKIPTDERLERVKEGKLDDGLISLYFHFGRYLLISCSRP
FT                   GTLPANLQGIWNKHHTSPWGCKFTININTEMNYWPAETCNLSDCHTPLFDLIEKMREPG
FT                   RHTAKVMYDCGGFVAHHNVDLWGDTAPQDHWMPATVWPMGAAWLCLHLWEHYEFTCDLK
FT                   FLKKAYETLKESAEFFVDYLIEDRNGYLVTCPSVSPENTYRLESGETGSLCIGPSMDSQ
FT                   IIYALFSSCIEASELLNTDKEFAETLISLRERLPKPSIGKYGQIMEWAEDYDEVEPGHR
FT                   HISQLFALHPSNQITVKDTPQLAKAARNTLERRLAHGGGHTGWSRAWIINFWARLEEGE
FT                   KAYENINALLAKSTLINLLDNHPPFQIDGNFGGAAGVAEMLVQSHSNEINIFPAMPKQW
FT                   SEGEVTGLCARGGFELSIKWTENKAYVTVTSKAGNRCIIRTPRFAHTSEEVSVEKLQDN
FT                   VIAFDTIKGEDYHLEF"
FT   gene            733776..735095
FT                   /locus_tag="Clocel_0590"
FT   CDS_pept        733776..735095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0590"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="TIGRFAM: xylose isomerase; KEGG: cbe:Cbei_2383
FT                   xylose isomerase; PFAM: Xylose isomerase domain-containing
FT                   protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50361"
FT                   /db_xref="GOA:D9SR73"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR73"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ADL50361.1"
FT                   /translation="MREYFANVPKIKYEGKDSKNPLAFKYYNPDEVVGGKTMKEHLRFT
FT                   LSYWHTLTGAGSDPFGVGTMLRPWDCAEDEMELAKMRMEANFELMDKLGIEYFAFHDRD
FT                   IAPEGKTLADTNEKLDEIVAYCKELMQKHGKKLLWGTANMFGNPRFVHGAATTCNADVF
FT                   AYAAAQTKKAMDVTKELGGENYVFWGGREGYETLLNTDLGLEQDNLARFFQMAVDYAKK
FT                   IGFTGQFLIEPKPKEPTKHQYDFDVATVLGFLRKYNLEKYFKMNIEANHATLAQHTFQH
FT                   EVAVARVNGVLGSLDVNQGDPNLGWDTDQFPTNIYDATMVMYEVLKNGGIAPGGLNFDA
FT                   KTRRASFEPEDLFLSYIAGMDTMAKGLRVAYSLLDDAVLENNTSERYKTFSEGIGKDIV
FT                   EGKVDFESLEKYALENSVISNKSGRQEYLESVVNQYIFND"
FT   gene            735255..735902
FT                   /locus_tag="Clocel_0591"
FT   CDS_pept        735255..735902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0591"
FT                   /product="transaldolase"
FT                   /note="KEGG: cac:CAC1347 putative translaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50362"
FT                   /db_xref="GOA:D9SR74"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR74"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ADL50362.1"
FT                   /translation="MKIFIDTANVDEIIEANDMGVICGVTTNPSLVAKEGKDFNEVIKT
FT                   IASIVDGPISGEVNSDDAEGMIVEGREIAKIHKNMVVKIPMTKEGLKAVKVLTAEGIKT
FT                   NVTLVFSAAQALLAANAGATYVSPFVGRLDDIGSTGMELIEKIAYIFERQDIETEIIAA
FT                   SIRSSIHAIEAAEAGAHIATIPYGVLMNMAKHPLTDSGIERFKKDWADAFNK"
FT   gene            735918..737408
FT                   /locus_tag="Clocel_0592"
FT   CDS_pept        735918..737408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0592"
FT                   /product="xylulokinase"
FT                   /note="KEGG: tex:Teth514_0154 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50363"
FT                   /db_xref="GOA:D9SR75"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR75"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADL50363.1"
FT                   /translation="MKFLGVDLGTSSVKIIMVDEEGKLLSSVSKEYPVSYPKNGWSEQN
FT                   PEDWWNGTKEGIRELMEKSKVSGEEVKGIGFSGQMHGLVILDKDNNVLRPAILWNDQRT
FT                   QEECDYLNNEIGQEKISKYTGNKALTGFTAPKVLWVRKHEKEIFDKIAHILLPKDYIRF
FT                   KLTGEFASEVSDASGTLFFDVENRQWSKEMMDILGIKEEQLPKMYESWEVTGKVTKEVA
FT                   EYIGVSSETVVVGGGGDQAAGAIGTGTVDAGILSVALGTSGVVFASSDSYAVDDENTLH
FT                   SFCHGNGKYHQMGVMLSAASSLKWWVEEINEDSKDFNKLLADAEKSTVGSNGVIFLPYL
FT                   TGERTPYSDPNAKGVFFGLNITTKREDMTRAVLEGVAFGLRDSLEILKSLNVPIEEVRV
FT                   SGGGAQSPLWKQILADVFNVKVSMINSKEGPAYGAAILAIVGCGVYPTVDEACKNLIKV
FT                   TETVHPIAENVAKYEKPYEVYRKLYPALKDSFKAINNI"
FT   gene            complement(737460..737933)
FT                   /locus_tag="Clocel_0593"
FT   CDS_pept        complement(737460..737933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0593"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   KEGG: ctc:CTC00149 methionine sulfoxide reductase A; PFAM:
FT                   Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50364"
FT                   /db_xref="GOA:D9SR76"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR76"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADL50364.1"
FT                   /translation="MKEIIVAGGCFWGVEEFFSRIPGILDTEVGYANGVTENPTYEDVC
FT                   KNNTGFAEACYIKYDEAVLPLDALLEQYWSIIEPTYLNRQGNDIGSQYRTGLYYKQEED
FT                   KEILLKSKEEIQKQYDEKVVTEVDLLKNFYIAEEYHQDYLKKNPNGYCHIKLD"
FT   gene            738158..739330
FT                   /locus_tag="Clocel_0594"
FT   CDS_pept        738158..739330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0594"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; regulatory protein MarR;
FT                   KEGG: cac:CAC3673 XylR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50365"
FT                   /db_xref="GOA:D9SR77"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR77"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADL50365.1"
FT                   /translation="MTKIKKLDQETIKKINQNNVLYLLYRHDQLTKHDIAKKLGISIPT
FT                   VVTNINELIELGFVEEAGVGKSTGGRKPVIVKFLPDSRYSMGVVITKDYVRMVLTNLHF
FT                   EIIKEVSISIDEELQSIDYIIEAVKEFQKNVCEELSIDENKILGIGFSLPGTVNEKTLI
FT                   LENAINLGIKNIDFKNYDFNCPVYIENEANASAYAEYFVYPDKSNSKLIFVSITEGI