(data stored in ACNUC1104 zone)

EMBL: CP002162

ID   CP002162; SV 1; circular; genomic DNA; STD; PRO; 7025559 BP.
XX
AC   CP002162; ADBZ01000000-ADBZ01000162;
XX
PR   Project:PRJNA37957;
XX
DT   14-AUG-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Micromonospora aurantiaca ATCC 27029, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Micromonospora aurantiaca ATCC 27029
OC   Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae;
OC   Micromonospora.
XX
RN   [1]
RP   1-7025559
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Hirsch A.M., Woyke T.;
RT   "Complete sequence of Micromonospora aurantiaca ATCC 27029";
RL   Unpublished.
XX
RN   [2]
RP   1-7025559
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Hirsch A.M., Woyke T.;
RT   ;
RL   Submitted (05-AUG-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d20fcab54699fd8321d2760002135cb2.
DR   BioSample; SAMN00006196.
DR   EnsemblGenomes-Gn; EBG00001211792.
DR   EnsemblGenomes-Gn; EBG00001211795.
DR   EnsemblGenomes-Gn; EBG00001211798.
DR   EnsemblGenomes-Gn; EBG00001211800.
DR   EnsemblGenomes-Gn; EBG00001211805.
DR   EnsemblGenomes-Gn; EBG00001211808.
DR   EnsemblGenomes-Gn; EBG00001211809.
DR   EnsemblGenomes-Gn; EBG00001211810.
DR   EnsemblGenomes-Gn; EBG00001211811.
DR   EnsemblGenomes-Gn; EBG00001211812.
DR   EnsemblGenomes-Gn; EBG00001211813.
DR   EnsemblGenomes-Gn; EBG00001211814.
DR   EnsemblGenomes-Gn; EBG00001211815.
DR   EnsemblGenomes-Gn; EBG00001211816.
DR   EnsemblGenomes-Gn; EBG00001211817.
DR   EnsemblGenomes-Gn; EBG00001211818.
DR   EnsemblGenomes-Gn; EBG00001211819.
DR   EnsemblGenomes-Gn; EBG00001211820.
DR   EnsemblGenomes-Gn; EBG00001211821.
DR   EnsemblGenomes-Gn; EBG00001211822.
DR   EnsemblGenomes-Gn; EBG00001211823.
DR   EnsemblGenomes-Gn; EBG00001211824.
DR   EnsemblGenomes-Gn; EBG00001211825.
DR   EnsemblGenomes-Gn; EBG00001211826.
DR   EnsemblGenomes-Gn; EBG00001211827.
DR   EnsemblGenomes-Gn; EBG00001211828.
DR   EnsemblGenomes-Gn; EBG00001211829.
DR   EnsemblGenomes-Gn; EBG00001211830.
DR   EnsemblGenomes-Gn; EBG00001211831.
DR   EnsemblGenomes-Gn; EBG00001211832.
DR   EnsemblGenomes-Gn; EBG00001211833.
DR   EnsemblGenomes-Gn; EBG00001211834.
DR   EnsemblGenomes-Gn; EBG00001211835.
DR   EnsemblGenomes-Gn; EBG00001211836.
DR   EnsemblGenomes-Gn; EBG00001211837.
DR   EnsemblGenomes-Gn; EBG00001211838.
DR   EnsemblGenomes-Gn; EBG00001211839.
DR   EnsemblGenomes-Gn; EBG00001211840.
DR   EnsemblGenomes-Gn; EBG00001211841.
DR   EnsemblGenomes-Gn; EBG00001211842.
DR   EnsemblGenomes-Gn; EBG00001211843.
DR   EnsemblGenomes-Gn; EBG00001211844.
DR   EnsemblGenomes-Gn; EBG00001211845.
DR   EnsemblGenomes-Gn; EBG00001211846.
DR   EnsemblGenomes-Gn; EBG00001211847.
DR   EnsemblGenomes-Gn; EBG00001211848.
DR   EnsemblGenomes-Gn; EBG00001211849.
DR   EnsemblGenomes-Gn; EBG00001211850.
DR   EnsemblGenomes-Gn; EBG00001211851.
DR   EnsemblGenomes-Gn; EBG00001211852.
DR   EnsemblGenomes-Gn; EBG00001211853.
DR   EnsemblGenomes-Gn; EBG00001211854.
DR   EnsemblGenomes-Gn; EBG00001211855.
DR   EnsemblGenomes-Gn; EBG00001211856.
DR   EnsemblGenomes-Gn; EBG00001211857.
DR   EnsemblGenomes-Gn; EBG00001211858.
DR   EnsemblGenomes-Gn; EBG00001211859.
DR   EnsemblGenomes-Gn; EBG00001211860.
DR   EnsemblGenomes-Gn; EBG00001211861.
DR   EnsemblGenomes-Gn; EBG00001211862.
DR   EnsemblGenomes-Gn; EBG00001211863.
DR   EnsemblGenomes-Gn; EBG00001211864.
DR   EnsemblGenomes-Gn; EBG00001211865.
DR   EnsemblGenomes-Gn; EBG00001211866.
DR   EnsemblGenomes-Gn; EBG00001211867.
DR   EnsemblGenomes-Gn; EBG00001211868.
DR   EnsemblGenomes-Gn; EBG00001211869.
DR   EnsemblGenomes-Gn; EBG00001211870.
DR   EnsemblGenomes-Gn; EBG00001211871.
DR   EnsemblGenomes-Gn; EBG00001211872.
DR   EnsemblGenomes-Gn; EBG00001211873.
DR   EnsemblGenomes-Gn; EBG00001211874.
DR   EnsemblGenomes-Gn; EBG00001211875.
DR   EnsemblGenomes-Gn; EBG00001211876.
DR   EnsemblGenomes-Gn; EBG00001211877.
DR   EnsemblGenomes-Gn; EBG00001211878.
DR   EnsemblGenomes-Gn; EBG00001211879.
DR   EnsemblGenomes-Gn; EBG00001211880.
DR   EnsemblGenomes-Gn; EBG00001211881.
DR   EnsemblGenomes-Gn; EBG00001211882.
DR   EnsemblGenomes-Gn; EBG00001211883.
DR   EnsemblGenomes-Gn; EBG00001211884.
DR   EnsemblGenomes-Gn; EBG00001211885.
DR   EnsemblGenomes-Gn; EBG00001211886.
DR   EnsemblGenomes-Gn; EBG00001211887.
DR   EnsemblGenomes-Gn; EBG00001211888.
DR   EnsemblGenomes-Gn; EBG00001211889.
DR   EnsemblGenomes-Gn; EBG00001211890.
DR   EnsemblGenomes-Gn; EBG00001211891.
DR   EnsemblGenomes-Gn; EBG00001211892.
DR   EnsemblGenomes-Gn; EBG00001211893.
DR   EnsemblGenomes-Gn; EBG00001211894.
DR   EnsemblGenomes-Gn; EBG00001211895.
DR   EnsemblGenomes-Gn; EBG00001211896.
DR   EnsemblGenomes-Gn; EBG00001211897.
DR   EnsemblGenomes-Gn; EBG00001211898.
DR   EnsemblGenomes-Gn; EBG00001211899.
DR   EnsemblGenomes-Gn; EBG00001211900.
DR   EnsemblGenomes-Gn; EBG00001211901.
DR   EnsemblGenomes-Gn; EBG00001211902.
DR   EnsemblGenomes-Gn; EBG00001211903.
DR   EnsemblGenomes-Gn; EBG00001211904.
DR   EnsemblGenomes-Gn; Micau_R0001.
DR   EnsemblGenomes-Gn; Micau_R0002.
DR   EnsemblGenomes-Gn; Micau_R0003.
DR   EnsemblGenomes-Gn; Micau_R0004.
DR   EnsemblGenomes-Gn; Micau_R0005.
DR   EnsemblGenomes-Gn; Micau_R0006.
DR   EnsemblGenomes-Gn; Micau_R0007.
DR   EnsemblGenomes-Gn; Micau_R0008.
DR   EnsemblGenomes-Gn; Micau_R0009.
DR   EnsemblGenomes-Gn; Micau_R0010.
DR   EnsemblGenomes-Gn; Micau_R0011.
DR   EnsemblGenomes-Gn; Micau_R0012.
DR   EnsemblGenomes-Gn; Micau_R0013.
DR   EnsemblGenomes-Gn; Micau_R0014.
DR   EnsemblGenomes-Gn; Micau_R0015.
DR   EnsemblGenomes-Gn; Micau_R0016.
DR   EnsemblGenomes-Gn; Micau_R0017.
DR   EnsemblGenomes-Gn; Micau_R0018.
DR   EnsemblGenomes-Gn; Micau_R0019.
DR   EnsemblGenomes-Gn; Micau_R0020.
DR   EnsemblGenomes-Gn; Micau_R0021.
DR   EnsemblGenomes-Gn; Micau_R0022.
DR   EnsemblGenomes-Gn; Micau_R0023.
DR   EnsemblGenomes-Gn; Micau_R0024.
DR   EnsemblGenomes-Gn; Micau_R0025.
DR   EnsemblGenomes-Gn; Micau_R0026.
DR   EnsemblGenomes-Gn; Micau_R0027.
DR   EnsemblGenomes-Gn; Micau_R0028.
DR   EnsemblGenomes-Gn; Micau_R0029.
DR   EnsemblGenomes-Gn; Micau_R0030.
DR   EnsemblGenomes-Gn; Micau_R0031.
DR   EnsemblGenomes-Gn; Micau_R0032.
DR   EnsemblGenomes-Gn; Micau_R0033.
DR   EnsemblGenomes-Gn; Micau_R0034.
DR   EnsemblGenomes-Gn; Micau_R0035.
DR   EnsemblGenomes-Gn; Micau_R0036.
DR   EnsemblGenomes-Gn; Micau_R0037.
DR   EnsemblGenomes-Gn; Micau_R0038.
DR   EnsemblGenomes-Gn; Micau_R0039.
DR   EnsemblGenomes-Gn; Micau_R0040.
DR   EnsemblGenomes-Gn; Micau_R0041.
DR   EnsemblGenomes-Gn; Micau_R0042.
DR   EnsemblGenomes-Gn; Micau_R0043.
DR   EnsemblGenomes-Gn; Micau_R0044.
DR   EnsemblGenomes-Gn; Micau_R0045.
DR   EnsemblGenomes-Gn; Micau_R0046.
DR   EnsemblGenomes-Gn; Micau_R0047.
DR   EnsemblGenomes-Gn; Micau_R0048.
DR   EnsemblGenomes-Gn; Micau_R0049.
DR   EnsemblGenomes-Gn; Micau_R0050.
DR   EnsemblGenomes-Gn; Micau_R0051.
DR   EnsemblGenomes-Gn; Micau_R0052.
DR   EnsemblGenomes-Gn; Micau_R0053.
DR   EnsemblGenomes-Gn; Micau_R0054.
DR   EnsemblGenomes-Gn; Micau_R0055.
DR   EnsemblGenomes-Gn; Micau_R0056.
DR   EnsemblGenomes-Gn; Micau_R0057.
DR   EnsemblGenomes-Gn; Micau_R0058.
DR   EnsemblGenomes-Gn; Micau_R0059.
DR   EnsemblGenomes-Gn; Micau_R0060.
DR   EnsemblGenomes-Gn; Micau_R0061.
DR   EnsemblGenomes-Gn; Micau_R0062.
DR   EnsemblGenomes-Gn; Micau_R0063.
DR   EnsemblGenomes-Gn; Micau_R0064.
DR   EnsemblGenomes-Tr; EBT00001781109.
DR   EnsemblGenomes-Tr; EBT00001781110.
DR   EnsemblGenomes-Tr; EBT00001781111.
DR   EnsemblGenomes-Tr; EBT00001781112.
DR   EnsemblGenomes-Tr; EBT00001781113.
DR   EnsemblGenomes-Tr; EBT00001781114.
DR   EnsemblGenomes-Tr; EBT00001781115.
DR   EnsemblGenomes-Tr; EBT00001781116.
DR   EnsemblGenomes-Tr; EBT00001781117.
DR   EnsemblGenomes-Tr; EBT00001781118.
DR   EnsemblGenomes-Tr; EBT00001781119.
DR   EnsemblGenomes-Tr; EBT00001781120.
DR   EnsemblGenomes-Tr; EBT00001781121.
DR   EnsemblGenomes-Tr; EBT00001781122.
DR   EnsemblGenomes-Tr; EBT00001781123.
DR   EnsemblGenomes-Tr; EBT00001781124.
DR   EnsemblGenomes-Tr; EBT00001781125.
DR   EnsemblGenomes-Tr; EBT00001781126.
DR   EnsemblGenomes-Tr; EBT00001781127.
DR   EnsemblGenomes-Tr; EBT00001781128.
DR   EnsemblGenomes-Tr; EBT00001781129.
DR   EnsemblGenomes-Tr; EBT00001781130.
DR   EnsemblGenomes-Tr; EBT00001781131.
DR   EnsemblGenomes-Tr; EBT00001781132.
DR   EnsemblGenomes-Tr; EBT00001781133.
DR   EnsemblGenomes-Tr; EBT00001781134.
DR   EnsemblGenomes-Tr; EBT00001781135.
DR   EnsemblGenomes-Tr; EBT00001781136.
DR   EnsemblGenomes-Tr; EBT00001781137.
DR   EnsemblGenomes-Tr; EBT00001781138.
DR   EnsemblGenomes-Tr; EBT00001781139.
DR   EnsemblGenomes-Tr; EBT00001781140.
DR   EnsemblGenomes-Tr; EBT00001781141.
DR   EnsemblGenomes-Tr; EBT00001781142.
DR   EnsemblGenomes-Tr; EBT00001781143.
DR   EnsemblGenomes-Tr; EBT00001781144.
DR   EnsemblGenomes-Tr; EBT00001781145.
DR   EnsemblGenomes-Tr; EBT00001781146.
DR   EnsemblGenomes-Tr; EBT00001781147.
DR   EnsemblGenomes-Tr; EBT00001781148.
DR   EnsemblGenomes-Tr; EBT00001781149.
DR   EnsemblGenomes-Tr; EBT00001781150.
DR   EnsemblGenomes-Tr; EBT00001781151.
DR   EnsemblGenomes-Tr; EBT00001781152.
DR   EnsemblGenomes-Tr; EBT00001781153.
DR   EnsemblGenomes-Tr; EBT00001781154.
DR   EnsemblGenomes-Tr; EBT00001781155.
DR   EnsemblGenomes-Tr; EBT00001781156.
DR   EnsemblGenomes-Tr; EBT00001781157.
DR   EnsemblGenomes-Tr; EBT00001781158.
DR   EnsemblGenomes-Tr; EBT00001781159.
DR   EnsemblGenomes-Tr; EBT00001781160.
DR   EnsemblGenomes-Tr; EBT00001781161.
DR   EnsemblGenomes-Tr; EBT00001781162.
DR   EnsemblGenomes-Tr; EBT00001781163.
DR   EnsemblGenomes-Tr; EBT00001781164.
DR   EnsemblGenomes-Tr; EBT00001781165.
DR   EnsemblGenomes-Tr; EBT00001781166.
DR   EnsemblGenomes-Tr; EBT00001781167.
DR   EnsemblGenomes-Tr; EBT00001781168.
DR   EnsemblGenomes-Tr; EBT00001781169.
DR   EnsemblGenomes-Tr; EBT00001781170.
DR   EnsemblGenomes-Tr; EBT00001781171.
DR   EnsemblGenomes-Tr; EBT00001781172.
DR   EnsemblGenomes-Tr; EBT00001781173.
DR   EnsemblGenomes-Tr; EBT00001781174.
DR   EnsemblGenomes-Tr; EBT00001781175.
DR   EnsemblGenomes-Tr; EBT00001781176.
DR   EnsemblGenomes-Tr; EBT00001781177.
DR   EnsemblGenomes-Tr; EBT00001781178.
DR   EnsemblGenomes-Tr; EBT00001781179.
DR   EnsemblGenomes-Tr; EBT00001781180.
DR   EnsemblGenomes-Tr; EBT00001781181.
DR   EnsemblGenomes-Tr; EBT00001781182.
DR   EnsemblGenomes-Tr; EBT00001781183.
DR   EnsemblGenomes-Tr; EBT00001781184.
DR   EnsemblGenomes-Tr; EBT00001781185.
DR   EnsemblGenomes-Tr; EBT00001781186.
DR   EnsemblGenomes-Tr; EBT00001781187.
DR   EnsemblGenomes-Tr; EBT00001781188.
DR   EnsemblGenomes-Tr; EBT00001781189.
DR   EnsemblGenomes-Tr; EBT00001781190.
DR   EnsemblGenomes-Tr; EBT00001781191.
DR   EnsemblGenomes-Tr; EBT00001781192.
DR   EnsemblGenomes-Tr; EBT00001781193.
DR   EnsemblGenomes-Tr; EBT00001781194.
DR   EnsemblGenomes-Tr; EBT00001781195.
DR   EnsemblGenomes-Tr; EBT00001781196.
DR   EnsemblGenomes-Tr; EBT00001781197.
DR   EnsemblGenomes-Tr; EBT00001781198.
DR   EnsemblGenomes-Tr; EBT00001781199.
DR   EnsemblGenomes-Tr; EBT00001781200.
DR   EnsemblGenomes-Tr; EBT00001781201.
DR   EnsemblGenomes-Tr; EBT00001781202.
DR   EnsemblGenomes-Tr; EBT00001781203.
DR   EnsemblGenomes-Tr; EBT00001781204.
DR   EnsemblGenomes-Tr; EBT00001781205.
DR   EnsemblGenomes-Tr; EBT00001781206.
DR   EnsemblGenomes-Tr; EBT00001781207.
DR   EnsemblGenomes-Tr; EBT00001781208.
DR   EnsemblGenomes-Tr; EBT00001781209.
DR   EnsemblGenomes-Tr; EBT00001781210.
DR   EnsemblGenomes-Tr; Micau_R0001-1.
DR   EnsemblGenomes-Tr; Micau_R0002-1.
DR   EnsemblGenomes-Tr; Micau_R0003-1.
DR   EnsemblGenomes-Tr; Micau_R0004-1.
DR   EnsemblGenomes-Tr; Micau_R0005-1.
DR   EnsemblGenomes-Tr; Micau_R0006-1.
DR   EnsemblGenomes-Tr; Micau_R0007-1.
DR   EnsemblGenomes-Tr; Micau_R0008-1.
DR   EnsemblGenomes-Tr; Micau_R0009-1.
DR   EnsemblGenomes-Tr; Micau_R0010-1.
DR   EnsemblGenomes-Tr; Micau_R0011-1.
DR   EnsemblGenomes-Tr; Micau_R0012-1.
DR   EnsemblGenomes-Tr; Micau_R0013-1.
DR   EnsemblGenomes-Tr; Micau_R0014-1.
DR   EnsemblGenomes-Tr; Micau_R0015-1.
DR   EnsemblGenomes-Tr; Micau_R0016-1.
DR   EnsemblGenomes-Tr; Micau_R0017-1.
DR   EnsemblGenomes-Tr; Micau_R0018-1.
DR   EnsemblGenomes-Tr; Micau_R0019-1.
DR   EnsemblGenomes-Tr; Micau_R0020-1.
DR   EnsemblGenomes-Tr; Micau_R0021-1.
DR   EnsemblGenomes-Tr; Micau_R0022-1.
DR   EnsemblGenomes-Tr; Micau_R0023-1.
DR   EnsemblGenomes-Tr; Micau_R0024-1.
DR   EnsemblGenomes-Tr; Micau_R0025-1.
DR   EnsemblGenomes-Tr; Micau_R0026-1.
DR   EnsemblGenomes-Tr; Micau_R0027-1.
DR   EnsemblGenomes-Tr; Micau_R0028-1.
DR   EnsemblGenomes-Tr; Micau_R0029-1.
DR   EnsemblGenomes-Tr; Micau_R0030-1.
DR   EnsemblGenomes-Tr; Micau_R0031-1.
DR   EnsemblGenomes-Tr; Micau_R0032-1.
DR   EnsemblGenomes-Tr; Micau_R0033-1.
DR   EnsemblGenomes-Tr; Micau_R0034-1.
DR   EnsemblGenomes-Tr; Micau_R0035-1.
DR   EnsemblGenomes-Tr; Micau_R0036-1.
DR   EnsemblGenomes-Tr; Micau_R0037-1.
DR   EnsemblGenomes-Tr; Micau_R0038-1.
DR   EnsemblGenomes-Tr; Micau_R0039-1.
DR   EnsemblGenomes-Tr; Micau_R0040-1.
DR   EnsemblGenomes-Tr; Micau_R0041-1.
DR   EnsemblGenomes-Tr; Micau_R0042-1.
DR   EnsemblGenomes-Tr; Micau_R0043-1.
DR   EnsemblGenomes-Tr; Micau_R0044-1.
DR   EnsemblGenomes-Tr; Micau_R0045-1.
DR   EnsemblGenomes-Tr; Micau_R0046-1.
DR   EnsemblGenomes-Tr; Micau_R0047-1.
DR   EnsemblGenomes-Tr; Micau_R0048-1.
DR   EnsemblGenomes-Tr; Micau_R0049-1.
DR   EnsemblGenomes-Tr; Micau_R0050-1.
DR   EnsemblGenomes-Tr; Micau_R0051-1.
DR   EnsemblGenomes-Tr; Micau_R0052-1.
DR   EnsemblGenomes-Tr; Micau_R0053-1.
DR   EnsemblGenomes-Tr; Micau_R0054-1.
DR   EnsemblGenomes-Tr; Micau_R0055-1.
DR   EnsemblGenomes-Tr; Micau_R0056-1.
DR   EnsemblGenomes-Tr; Micau_R0057-1.
DR   EnsemblGenomes-Tr; Micau_R0058-1.
DR   EnsemblGenomes-Tr; Micau_R0059-1.
DR   EnsemblGenomes-Tr; Micau_R0060-1.
DR   EnsemblGenomes-Tr; Micau_R0061-1.
DR   EnsemblGenomes-Tr; Micau_R0062-1.
DR   EnsemblGenomes-Tr; Micau_R0063-1.
DR   EnsemblGenomes-Tr; Micau_R0064-1.
DR   EuropePMC; PMC6562861; 31108876.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01382; HIV-1_SL4.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002162.
DR   SILVA-SSU; CP002162.
DR   StrainInfo; 104779; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086088
CC   Source DNA available from Ann M. Hirsch (ahirsch@ucla.edu)
CC   Organism available from ATCC: ATCC 27029
CC   Contacts: Ann M. Hirsch (ahirsch@ucla.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Micromonospora aurantiaca ATCC 27029
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: ATCC 27029, DSM 43813
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02094
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 12856
CC   Funding Program     :: DOE-CSP 2008
CC   Isolation Site      :: Soil
CC   Sporulation         :: Sporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 37C
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7025559
FT                   /organism="Micromonospora aurantiaca ATCC 27029"
FT                   /strain="ATCC 27029"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644283"
FT                   /culture_collection="ATCC:27029"
FT   gene            314..2137
FT                   /locus_tag="Micau_0001"
FT   CDS_pept        314..2137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   saq:Sare_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43570"
FT                   /db_xref="GOA:D9T2Y7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Y7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADL43570.1"
FT                   /translation="MTGATDLAAVWTATTDELADEIISAQQRAYLRLTRLRAIVEDTAL
FT                   LSVPDAFTRDVIESRLRPAITEALSRRLGRPIQVAVTVRVSDDPSARPAGTVYRSGPEP
FT                   LPEHDAAAPLPGFDQPASAFPSPRPEPGYAEAGYAEPRPEQPLDEPAPRQRTADGGGRP
FT                   HLIPAGRDAQDTLFSAAFAEPVRTAPERRAFDERTRIEPPVPDAGGYEPRYRESPPADP
FT                   APMRGLPRDGATDNGPGRGGADHHRPGGGGQADRRLPGGTESGGNRLNPKYMFETFVIG
FT                   SSNRFAHAASVAVAESPAKAYNPLFIYGSSGLGKTHLLHAIGHYATTLGNARSVRYVST
FT                   EEFTNDFINSLRDDKTSAFQRRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANK
FT                   QIVITSDRSPKQLATLEDRLRTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPDV
FT                   LEFIASRVSNSIRELEGALIRVTAFASLTRSSVELSLAEEVLRDFIPDGAGPEITADQI
FT                   MVSTADYFGVSLEDLRGHSRSRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVM
FT                   HADRKIRQQMAERRSLYNQIAELTNRIKQNT"
FT   gene            3193..4326
FT                   /locus_tag="Micau_0002"
FT   CDS_pept        3193..4326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: stp:Strop_0003 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43571"
FT                   /db_xref="GOA:D9T2Y8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Y8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADL43571.1"
FT                   /translation="MKFRVERDALAEAVAWTAKSLPNRPSVPVLAGVMLRVTDGNLQVS
FT                   GFDYEVSSQVTVEVQGDADGAALVSGRLLAEITKALPAKPVDIAAVGAHLELVCGSARF
FT                   TLPTMPVEDYPTLPEMPESAGTVDAAAFASAVAQVAVAAGRDETLPMMTGVRIELSGST
FT                   MAMLATDRYRLALREMEWNPDDPEISLNALVPARTLHDTAKALGPLGGHVTMALSSGGA
FT                   GEGMIGFSGGTRRTTSRLLDGANYPPVRSLFPADHNAEARVAVAALIEVVKRVALVAER
FT                   TTPVLLSFSADGLVVEAGGTEEARASEAMEATFSGEPLTIGFNPQYLIDGLANLGAQHA
FT                   LLRFVDAFKPAVISPAGEDGEVIPGYRYLIMPIRVSR"
FT   gene            4367..5239
FT                   /locus_tag="Micau_0003"
FT   CDS_pept        4367..5239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: stp:Strop_0004 6-phosphogluconate
FT                   dehydrogenase-like protein; TIGRFAM: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding; 6-phosphogluconate dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43572"
FT                   /db_xref="GOA:D9T2Y9"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Y9"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADL43572.1"
FT                   /translation="MQLGLVGLGRMGGNMRERLRAAGHEVVGYDHNPEISDAASLAELA
FT                   EKLQSPRAVWVMVPAGVTDATIDELAGVLGEGDIIIDGGNSRFSDDAPRAERLNEQGIG
FT                   YIDVGVSGGVWGRQNGYALMVGGAQEHVERLMPIFESLKPEGEFGFVHAGPVGAGHYAK
FT                   MVHNGIEYGLMHAYAEGYELLAASELVTNVPGVFKSWREGTVVRSWLLDLLDRALDEDP
FT                   ELAELSGYTEDTGEGRWTVDEAVRLAVPLNVITASLFARFASRQDDSPAMKAVAALRQQ
FT                   FGGHAVHKR"
FT   gene            5256..6389
FT                   /locus_tag="Micau_0004"
FT   CDS_pept        5256..6389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: saq:Sare_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43573"
FT                   /db_xref="GOA:D9T2Z0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADL43573.1"
FT                   /translation="MYVRRLELVDFRSYERVGVDLEPGPNVLVGANGVGKTNLVEALGY
FT                   VATLDSHRVATDAPLVRMGAASAVIRCAVVHEGRELLVELEIVPGKANRARLGRSPARR
FT                   ARDVLGALRLVLFAPEDLELVRGDPAERRRYLDDLLVTRQPRYAGVRADYERVVKQRNA
FT                   LLRTSYLARKTGGTRGGDLSTLAVWDAHLAQHGADLLAGRLELVAALTPHVAKAYDAVA
FT                   AGRGAAGIAYRPSVELPEPGADRAALAEALAAALTANRAAEIERGTTLVGPHRDDLALT
FT                   LGPLPAKGYASHGESWSYALALRLAGYDLLRADGIEPVLVLDDVFAELDTGRRERLAEL
FT                   VGGASQLLVTCAVDDDVPATLRGTRYAVGERTVRRAG"
FT   gene            6379..6984
FT                   /locus_tag="Micau_0005"
FT   CDS_pept        6379..6984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   saq:Sare_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43574"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z1"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADL43574.1"
FT                   /translation="MPDDEVQLPPARLGPGRDARTPGKPADGEPAAKLPEGTAGPELAR
FT                   AVLDAAKARRQAAAPRRRGAVRGDGEKRLRGYSGPGPDPRDPQPLGAVLDKLMKARGWQ
FT                   QPAAEATVFGAWEKVVGPEVAQHSRPVKLEDGELTVEARSTAWATQLRLLAGSLLQQIA
FT                   REVGHNVVRKLHIHGPAAPSWSRGPRRVRGRGPRDTYG"
FT   gene            complement(6975..7214)
FT                   /locus_tag="Micau_0006"
FT   CDS_pept        complement(6975..7214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ago:AGOS_ADL028W ADL028Wp"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43575"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z3"
FT                   /inference="similar to AA sequence:KEGG:AGOS_ADL028W"
FT                   /protein_id="ADL43575.1"
FT                   /translation="MSDDEQVGDASGKGGRLLGWVFRNLAGPSQVQGAVQGGSKLARDA
FT                   WKEDLERRKQWSREQRELKRARREARRSGGVGQP"
FT   gene            7295..7783
FT                   /locus_tag="Micau_0007"
FT   CDS_pept        7295..7783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0007"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: gob:Gobs_2803 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43576"
FT                   /db_xref="GOA:D9T2Z2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL43576.1"
FT                   /translation="MTDGIEEDPLALEQQVCFALSVAARSVVAVYRPLLEPMGLTHPQY
FT                   LVMLALWQHAPLSGRDLSRLLQLDPGTLSPLLKRLEAAGYIRRERDAADERSLAVSLTA
FT                   EGQALRAQAERIPPAIVQRLGLPLADLRHLHTALTEVIAAANQATSSSGAAAPGQASA"
FT   gene            complement(7768..8322)
FT                   /locus_tag="Micau_0008"
FT   CDS_pept        complement(7768..8322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43577"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z4"
FT                   /inference="similar to AA sequence:KEGG:Strop_0007"
FT                   /protein_id="ADL43577.1"
FT                   /translation="MGLDNVAVHWPRTGRFYDPVAPAEFVDFGEIVDMPRISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATENAVEDEDPVIDPDGCSWIAEGVEKFVA
FT                   RHRPYGEPVTFESVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWNFTCAEL
FT                   SVLAAFYRRCAERGFAVYADA"
FT   gene            8870..10816
FT                   /locus_tag="Micau_0009"
FT   CDS_pept        8870..10816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0009"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: stp:Strop_0008 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43578"
FT                   /db_xref="GOA:D9T2Z5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z5"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADL43578.1"
FT                   /translation="MAAEDNKKYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLVWE
FT                   VVDNAVDEALAGHCDTIDVVLLADGGVRVTDNGRGFPVDLHPKLKKPGVEVALTVLHAG
FT                   GKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIHKDGFVWRQQYHHSKPTPLEKGEATD
FT                   RTGSAVSFWPDPDVFETVDFDFHTIYRRLQEMAFLTRGLTIHLLDERVPEDEDGKTREV
FT                   TFHYEGGIADFVRHLNASKSPIHKTVVEFGAEETGMSVEIAMQWNESYGESVYTFANNI
FT                   NTHEGGTHEEGFRAALTSVVNRYGAEKKLLKGDERLSGEDIREGLAAIISVKLTDPQFE
FT                   GQTKTKLGNTPVKGFVQRVCNESLVDWFDRNPAEAKIIIQKASQAARARIAAQQARKLA
FT                   RRKSLLESGSMPGKLADCQSTDPRESEVFIVEGDSAGGSAKQGRDPRTQAILPIRGKIL
FT                   NVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADADVDGQHIQTLLL
FT                   TLLFRFMRPLVELGHVYLAAPPLYKIKWNKKGDDAQYAYSDRERDGLIALRQQKKPNAR
FT                   PDDIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSVLMGEDVEARRSF
FT                   IQRNAKDVRFLDI"
FT   gene            10947..14726
FT                   /locus_tag="Micau_0010"
FT   CDS_pept        10947..14726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0010"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   Hedgehog/intein hint domain protein; TIGRFAM: DNA gyrase, A
FT                   subunit; KEGG: mkm:Mkms_0015 DNA gyrase subunit A; PFAM:
FT                   DNA gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43579"
FT                   /db_xref="GOA:D9T2Z6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z6"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADL43579.1"
FT                   /translation="MTDTPESTPNEPETPEPLAAVVQHDRIEPVGLEVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHRKILYAMFDSGYRPDRGYVKCSRVVGDVMGQFHPHGDSAI
FT                   YDALVRMAQPWSLRYPLVDGNGNFGSPGNDPAAAMRYCLAADVRVRTVDGTVRIGDVVP
FT                   DAAPSSETDVDLKVRDRNGDLVRASRFFHSGEHPTLRLRTREGYELTGTHNHPVLCLVN
FT                   VAGVPTLLWKLLAEIAPGDRVALQRTVPDEIGYPMLEHVEAAVLAGALVSEGWVSEQRA
FT                   GFNNVDREFFVRVLTAYDLAVGGPRYVAERVIDSGSTLHELDVQNLAALRASVLGEMVG
FT                   ARSADKFVPEFVWRGPAAVKRAFLQALFEGDGSSSLLPRRTIQVSYSTRSERLAREVQQ
FT                   LLLEFGVVSRQCRYDDGEIKVVVTNRRDARIFAAHVGFLGRKQAKLESELAQVPASSTA
FT                   LSGDHVPFVGDFVREHGASRWTERDWLRRHNVDRIERWERDRDEIAARITEPGILDVVE
FT                   PLVDGRFYYAEVTDVTDAGVQPVYSIRVDTEDHSFVSDGFVSHNTECKLDPLAMEMLRD
FT                   IDEDTVDLQDNYDGRAKEPTILPSRIPNLLINGSEGIAVGMATKIPPHNLREIGAAVQW
FT                   CLEHPEADEATTLEALLEIVKGPDFPTHGLIVGQAGIQDAYRTGRGSIRMRAVVEVEED
FT                   KRGRPALVVSELPYQVNPDNLAERIAELIKEGKLAGIADIRDESSGRTGMRIVLVLKRD
FT                   AVAKVVLNNLYKHTQLQETFGANMLALVDGVPRTLNLAQFIRYYVEHQIEVIRRRTAFR
FT                   LRKAEERAHILRGLSKALDALDEVIALIRRSPTVEDARQGLIRLLDIDEVQATAILDMQ
FT                   LRRLAALERQRILDDLAKLEVEIADLKDILAKPERQRRIVSEELGEIVAKWGDDRRTKI
FT                   VPFDGEVSMEDLIAREDVVVTITRTGYAKRTKVDLYRSQRRGGKGVSGATLRQDDIVSH
FT                   FFVCSTHDWILFFTNKGRVYRAKAYELPEASRVAKGQHVANLLAFQPDEQIAQIIEIPN
FT                   YQVAPYLVLATKNGLVKKTRLEEFDSNRSGGIIAINLRDEDELVGAVLVAPEDDLLLVS
FT                   KNAQAIRFNATDEALRPMGRATSGVIGMRFSGEDELLAVEVVREGLDVLVATNGGYAKR
FT                   TPIEEYPVQGRGGKGVLTAKITERRGGLVGAVVIDPEDELFAITSNGGVIRTPVKPVRR
FT                   TRDRNTMGVKLMDLPDGVTIVAIARNADEPDEQD"
FT   gene            14730..15656
FT                   /locus_tag="Micau_0011"
FT   CDS_pept        14730..15656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0011"
FT                   /product="Protein of unknown function DUF3566"
FT                   /note="PFAM: Protein of unknown function DUF3566.
FT                   transmembrane; KEGG: stp:Strop_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43580"
FT                   /db_xref="GOA:D9T2Z7"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z7"
FT                   /inference="protein motif:PFAM:PF12089"
FT                   /protein_id="ADL43580.1"
FT                   /translation="MTETQAKSGNKGTSATPVEEEAAQGGTPATGRAAVGRATVPADAP
FT                   APKFTRAPGMAPPPDKPAEDSGSRDSAETKVDAPTSADGLAAPAAKPANATSTQPIKTP
FT                   SAAGRASTGTTGTQPRIGAGLGTAPKTSPDGSRPSGAASAQARPANGGGLPPGISGAAA
FT                   VGAARVGEAVRAARTSVSSAASRGPRRARLNLKRIDPWSVMKFAFAVSVVLFIVVVVAT
FT                   SVLYLALDAMGVFKSVNDSLTDLVNAGGGQGGGGFRITAKGVILTSALIGLVNVVLFTA
FT                   LATLSAFVYNVCADLVGGIELTLAERD"
FT   gene            15801..15877
FT                   /locus_tag="Micau_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            15801..15877
FT                   /locus_tag="Micau_R0001"
FT                   /product="tRNA-Ile"
FT   gene            15918..16046
FT                   /locus_tag="Micau_0012"
FT   CDS_pept        15918..16046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43581"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z8"
FT                   /inference="similar to AA sequence:KEGG:Strop_0012"
FT                   /protein_id="ADL43581.1"
FT                   /translation="MFKKLLILAGIVGVAAVVAKKVKASNDERALWHEATTAPDLR"
FT   sig_peptide     15918..15977
FT                   /locus_tag="Micau_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.845 at
FT                   residue 20"
FT   gene            16057..16132
FT                   /locus_tag="Micau_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            16057..16132
FT                   /locus_tag="Micau_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(16188..17339)
FT                   /locus_tag="Micau_0013"
FT   CDS_pept        complement(16188..17339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0013"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   fre:Franean1_5518 integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43582"
FT                   /db_xref="GOA:D9T300"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D9T300"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADL43582.1"
FT                   /translation="MTGRRRRAHGEGSVYEQRPGVWAAVIDLGWIDGKRKRKYVYAKSE
FT                   AEAVRKRDELRRQLQLGVDLTAQPRTVEAWLTEWLRDVKAHDGTRPSTLARYRLAVTKH
FT                   LVPGLGRVKLDRLTPREVQRFLTGLRGKLAPASIIKVHAVLRVALADAERMDLVARNVA
FT                   KAAKPPALGRVERRALTPEEAKQLLSVLTGDRLESLFVLALATGLRRAELLGLRWSDVD
FT                   LPGKALFVRQTVQRTDRGLEFVPPKTHRSSRPLPLSALAVRALEAQRVRQARERLAAGE
FT                   LWSDLGLVFASTIGTAMEPRNVNRRFEQLRAAAGLDWLHLHDLRHAFATFLLDQGEELR
FT                   TVMELLGHSTIRMTADTYGHVLPARARQAASAIDRVLGEEGMA"
FT   gene            complement(17336..17533)
FT                   /locus_tag="Micau_0014"
FT   CDS_pept        complement(17336..17533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0014"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: fal:FRAAL1735 excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43583"
FT                   /db_xref="GOA:D9T2Z9"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2Z9"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADL43583.1"
FT                   /translation="MIQPHAVAPKSVRPAEAAALLGVCRDTVYVLMRSGRLRSIKAGRA
FT                   RLIPLTAIDEFLSADEEFAA"
FT   gene            complement(17533..19290)
FT                   /locus_tag="Micau_0015"
FT   CDS_pept        complement(17533..19290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0015"
FT                   /product="replication initiator protein"
FT                   /note="KEGG: fal:FRAAL1734 replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43584"
FT                   /db_xref="UniProtKB/TrEMBL:D9T301"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1734"
FT                   /protein_id="ADL43584.1"
FT                   /translation="MTAPTLPGLTPDPAPPTTNPVTVPADLGPAPGTRAARLALPMSRK
FT                   VLTEMAAEYGVCLHPVTLRRTDLHTGHTEVVDLPCGSTREDKCEPCAKRARRLRQTQIR
FT                   EGWHRTDEPAPGPNPATDAQRELILLRAHLEFARDEAQRAAQFDQVPAIDEAIGEVEEA
FT                   IAAEGLRGAVAPPHDQDDDNHARRKRSTRRRQDAPDLPRKKVEPRTVGKVYTAPDGTEH
FT                   RPSMWLSLTLDTYGRVLPDGTPVNPDTYDYRRAAWDAVHFARLLDRFWQNLRRCVGWNV
FT                   QYAGCVEPQRRLAPHAHFAIRGTIPRAVLRQVAAATYHQVWWPAADEPVYSLDRPPVWD
FT                   ADRAEWIDPDSREPLRSWADALDLIDSDPDAQPAHVVRFGSQVHAEGVTPGTVHANRTI
FT                   GYITKYITKSAADCHKPDTDRQRDHLDRLWHELRVTPCNERCANWLLYGIQPKKAHGRL
FT                   QAGRCKGKVHQRATLGIGGRRILVSRDWSGKTLADHRADARAWVRNLLGITVGAADADA
FT                   VDQDDPPAYAWELARPDDPDLPPLQHRLLKALSQRAQWKAALLAARDKATQGIPVPTRS
FT                   DLDSPEGRA"
FT   gene            complement(19725..20168)
FT                   /locus_tag="Micau_0016"
FT   CDS_pept        complement(19725..20168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_24370 ABC-type xylose transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43585"
FT                   /db_xref="GOA:D9T302"
FT                   /db_xref="UniProtKB/TrEMBL:D9T302"
FT                   /inference="similar to AA sequence:KEGG:Svir_24370"
FT                   /protein_id="ADL43585.1"
FT                   /translation="MSSTARTALAHRTRPTTLTRRIVGTPAEVAAALAVLRESGRLMFA
FT                   DRPHQHADGRVTVTVRFLNTARTTPPPVRRLRRGRVIAATAITTTAVGALAGIGYLATQ
FT                   VAHTVQRNAPAVVGVVLVLLVLAVLLLRRKVTCGGLHCSGCQH"
FT   gene            complement(20247..20393)
FT                   /locus_tag="Micau_0017"
FT   CDS_pept        complement(20247..20393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43586"
FT                   /db_xref="UniProtKB/TrEMBL:D9T303"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL43586.1"
FT                   /translation="MTQPKHPRLTDMCAVCNGPIEYVDVKDPYWRHTDMRNLAKPHGAR
FT                   PRR"
FT   gene            complement(20390..20977)
FT                   /locus_tag="Micau_0018"
FT   CDS_pept        complement(20390..20977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43587"
FT                   /db_xref="GOA:D9T304"
FT                   /db_xref="UniProtKB/TrEMBL:D9T304"
FT                   /inference="similar to AA sequence:KEGG:Sare_2056"
FT                   /protein_id="ADL43587.1"
FT                   /translation="MTATRPSPDRLEAVALVLILLIVAGTAGWASFSHVHDWTMRHVPP
FT                   GTPDAFGWANAVLSDLVPVACLLDIRRRRRHRQPIGYPVFLMLAFASFSLAAQLAVADA
FT                   SPSGWLLSALPALAFMALTKLVFTGTPTPVKPAPTPTPAPDREPVDAEPVNVPTAPAPV
FT                   FTPPAPVPVRSALVSSVVQAPRNGHIVSEVTR"
FT   sig_peptide     complement(20870..20977)
FT                   /locus_tag="Micau_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.671 at
FT                   residue 36"
FT   gene            complement(20974..21231)
FT                   /locus_tag="Micau_0019"
FT   CDS_pept        complement(20974..21231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_33340 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43588"
FT                   /db_xref="UniProtKB/TrEMBL:D9T305"
FT                   /inference="similar to AA sequence:KEGG:ROP_33340"
FT                   /protein_id="ADL43588.1"
FT                   /translation="MTGRPGRGPFALPVAVFIVGWGGPVQLVTDPDDCSLCQQRDEVQI
FT                   WNPDMTDGLTYELTPPAHRMWKVPCPVCRHTDFTRWEAPK"
FT   gene            complement(21228..21416)
FT                   /locus_tag="Micau_0020"
FT   CDS_pept        complement(21228..21416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: par:Psyc_2111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43589"
FT                   /db_xref="UniProtKB/TrEMBL:D9T306"
FT                   /inference="similar to AA sequence:KEGG:Psyc_2111"
FT                   /protein_id="ADL43589.1"
FT                   /translation="MRTRRLNRRPIRRTCLDLLHTDPDQTCPYCAPDPDAVDVIAAALR
FT                   QHAEIAAEDAEAWGWAA"
FT   gene            complement(21444..21755)
FT                   /locus_tag="Micau_0021"
FT   CDS_pept        complement(21444..21755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_6780 L-gulonolactone oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43590"
FT                   /db_xref="UniProtKB/TrEMBL:D9T307"
FT                   /inference="similar to AA sequence:KEGG:Sros_6780"
FT                   /protein_id="ADL43590.1"
FT                   /translation="MTHHEIPEGAAVRVPYADEPDQQTSEPRRFYRLRAPHVDKASVPV
FT                   TVRVTPDADLYIAVGAGRRRMYLTPAEAWALWRCLSEAVASTGEPPEWIRVHVNPTTR"
FT   gene            complement(21752..23398)
FT                   /locus_tag="Micau_0022"
FT   CDS_pept        complement(21752..23398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0022"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: cell division
FT                   protein FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43591"
FT                   /db_xref="GOA:D9T308"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T308"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADL43591.1"
FT                   /translation="MVRAPLVNFRRFQISAPWPLLWTVTVLFLLFRLAVAVVRLAVFVV
FT                   RHWQAWPGVALVLLAVNVYRSHGWWPHALVAVVLAASGGVWWWRGRDSFHRHVILRSVS
FT                   VWRRLWVYRRQWHEVMSLCGLVKKYDGGEVVPRLLSVRCSYATDELVLRMPKGQNPEVY
FT                   HKAARDLAYSFGTRHCRVFSTRRHPIPHRTGRLAFVLRLIDRVQFRDRPRHVWLVFIRR
FT                   DPLTRIVAPLPVPARPDFTALPLGLREDLAVYCFRLLATHVLIGGATRMGKGSVIWSLL
FT                   RSLAAGIRSGLVRVWAIDPKGGMELAIGRPLFSRYVDDDWSRMADLLEDAVARMRARQQ
FT                   ILRGKARVHTPTVDEPLIVVVIDEIAALLAYLPDSEVRQRITQALGLLLSQGAGLGVLV
FT                   VAATQDPRKEVVSVRDLFPTRIALGLTERGHVDLLLGDGARERGALADQIPLSGKGVAY
FT                   VLLDGQPEPARVRFSYLADDVIRDMAATFPAPPETQPEPAVQPTAPKPRASNGSGRHTT
FT                   YRPTPKQGAPLLPPSLLNALDLNSTNGSDPR"
FT   gene            complement(23398..23568)
FT                   /locus_tag="Micau_0023"
FT   CDS_pept        complement(23398..23568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAP1p61 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43592"
FT                   /db_xref="UniProtKB/TrEMBL:D9T309"
FT                   /inference="similar to AA sequence:KEGG:SAP1p61"
FT                   /protein_id="ADL43592.1"
FT                   /translation="MPVVLDWTRTAGAGEPVPCVICGKPAICRSPAGKPVHKVCAETWT
FT                   EQRSADRRAVA"
FT   gene            complement(23660..23875)
FT                   /locus_tag="Micau_0024"
FT   CDS_pept        complement(23660..23875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0024"
FT                   /product="E1-E2 cation pump ATPase FixI"
FT                   /note="KEGG: ccs:CCNA_01473 E1-E2 cation pump ATPase FixI"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43593"
FT                   /db_xref="UniProtKB/TrEMBL:D9T310"
FT                   /inference="similar to AA sequence:KEGG:CCNA_01473"
FT                   /protein_id="ADL43593.1"
FT                   /translation="MFGRKRPEPEPVRRDQVMKLINLGMKETDAADRDIDSPEFDRARD
FT                   AFNSAMRKSTPAEKAAAYDALKRHGY"
FT   gene            complement(23875..24273)
FT                   /locus_tag="Micau_0025"
FT   CDS_pept        complement(23875..24273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43594"
FT                   /db_xref="UniProtKB/TrEMBL:D9T311"
FT                   /inference="similar to AA sequence:KEGG:Sros_0153"
FT                   /protein_id="ADL43594.1"
FT                   /translation="MALRGGTRFSVPFEAVFPHGAVFVPDSIAEAQDFNEATRQRTPAK
FT                   DKVTGQRVWQCRVMDMDPELGSRSREVAIKILADVQPVPPVGPFQPVEFEGLTVTPYVG
FT                   SNGRLAFSYRATGLVAPKTLAETRGKAA"
FT   gene            24459..25325
FT                   /locus_tag="Micau_0026"
FT   CDS_pept        24459..25325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0026"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="KEGG: stp:Strop_0072 regulatory protein GntR, HTH;
FT                   PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43595"
FT                   /db_xref="GOA:D9T312"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T312"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL43595.1"
FT                   /translation="MTEDLDYLGELDPDDPKQASQQIANKLRAAILTRRLAPGDKLPSQ
FT                   PELASRYGVARETIKRALEVLRSERLIITRQGSGAFVRAQTQRAVELRPHIEAAFERAH
FT                   VTIDFAGFSGETLRDALAEVLDKVRVGRLAPETIAVRVLVSDMSVPMALPARAETQSDD
FT                   PAVRERADRITRRAVDGIVDQVTELGDLGLIRSATVEVRMHRGSPQFKLYVLNGEEVFF
FT                   GFYPAVERTVTIKGEPTAIYDLMGKDVPLFHYAVTDDDTSHGTQFVEASRQWFDSLWST
FT                   IAYRHEG"
FT   gene            25322..26017
FT                   /locus_tag="Micau_0027"
FT   CDS_pept        25322..26017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0027"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: saq:Sare_1573 hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43596"
FT                   /db_xref="GOA:D9T313"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D9T313"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADL43596.1"
FT                   /translation="MTASLEQLCRDVRALLLDFDGPVCSIFANYPAPQVARELLDLLVS
FT                   QGLALMNELAEESDPLEVLRHTGSSSDQELTRLVEDALIAAEVKAASTAEPTAYGREVI
FT                   VAARQLHLPIAVVSNNSPQAVEAYLREHRLSQHVAKTVGRAYADPSRMKPNPTPIVDAA
FT                   ASLGVVPALCVLVGDSLSDIEGAKAAGTRVIGYANKPAKVAAFQEAGADAVVTSMRQIA
FT                   QALMQVEGL"
FT   gene            complement(27585..28739)
FT                   /locus_tag="Micau_0028"
FT   CDS_pept        complement(27585..28739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0028"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43597"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D9T314"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADL43597.1"
FT                   /translation="MSSLPSKDGDLVQLKRGDLLNSKAHALVNTVNCVGIMGKGIALAF
FT                   KKRYPNMFRDYVRRCDQGLVQLGKPYAYQDEEKLIINFPTKQHWRSVSRLEDIEHGLEH
FT                   LRSNLSKWGVRSIAVPPLGCGNGQLEWSVVGPTLYRHLSTFGIPVELYVPHDVEPDQAQ
FT                   LALFNPQASPPSGVASAHEARYVDPATIALVEILHRIEQEPFHWPVGRIMFQKLAYFAT
FT                   AAGLPTGLDYQAASYGPYAADLKRVVGRLQNNGLVKEQQNGRAFEVKVGPTFTDARASA
FT                   IGELDGWEDRISRVVDLISRFNPSRAEVAASVHYAADALRNKLGRTPTAEEVVDAVLKW
FT                   KVRRQPPIRREDVEQAVVQLAIQRWIEVEPDDSIADAANELVGV"
FT   gene            complement(28723..29307)
FT                   /locus_tag="Micau_0029"
FT   CDS_pept        complement(28723..29307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0029"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43598"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:D9T315"
FT                   /inference="similar to AA sequence:KEGG:Slip_1960"
FT                   /protein_id="ADL43598.1"
FT                   /translation="MERGRVQELHFITPISNLESVLRHGILSHNAARRLPHLSVADEDV
FT                   QSRRRQKRVPGGMQLHDYANLYFDARNPMMYRIKGNGTPLAVVCVNPSILDLPGVVITD
FT                   GNAASDGTRFAASPGGIAILDEGLVYAHSWTSSDRWDYIERKRARCAEVLVPNCVDPSY
FT                   IDKAKVIRQSHVISCHAAGLRGEVFANVFFA"
FT   gene            complement(29960..30991)
FT                   /locus_tag="Micau_0030"
FT   CDS_pept        complement(29960..30991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0030"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sgr:SGR_6170 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43599"
FT                   /db_xref="GOA:D9T316"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9T316"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADL43599.1"
FT                   /translation="MRRNLPPTVGRGTLYILLAAIAWGTGGAAAAVLYDTSGLGPVAVS
FT                   FWRFAGGVLLLAAGHLTRRRPSSRIRVVSTRPRHRWRQVVTTGVGLAVYQTAYFAAVGY
FT                   AGLAVATMVTLGAGPVLIALGSRLALGERLGRSGGVTVVTALVGLVLLLGGGSAGSAPA
FT                   PLLGLACALLSAAGYAAVTLLNRKLGRDGGGHTPLLDGFAVGMICLLPLALLEGILPTA
FT                   GDIRQTVGLLAFLAVGPTAVAYTLFFAGLASVRATTASVIALVEPVTAALIAVLLLDER
FT                   LTVTAVLGSIVLLAAVVTLMLGEPGPAPSSTAALRDRDADMRNRRRPRRARAGGGVATR
FT                   RPG"
FT   sig_peptide     complement(30899..30991)
FT                   /locus_tag="Micau_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.878 at
FT                   residue 31"
FT   gene            complement(31114..31680)
FT                   /locus_tag="Micau_0031"
FT   CDS_pept        complement(31114..31680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0031"
FT                   /product="ATP-binding protein"
FT                   /note="KEGG: ccs:CCNA_00911 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43600"
FT                   /db_xref="GOA:D9T317"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:D9T317"
FT                   /inference="similar to AA sequence:KEGG:CCNA_00911"
FT                   /protein_id="ADL43600.1"
FT                   /translation="MPGFILTGAPGSGKTAILRHLEVDGHPVVEEAATDVIALHQALGR
FT                   PEPWREPDFAERVLALQRRRRRRAEARAGEIVFHDRSPVCTLALCRHLGSTPPSALLDE
FT                   VERLTTERRHYERTVFFVRNQGFVEATAARRISFEESLVFERVHELTYRDAGFDLVEVP
FT                   AGPLTTRVAAIKQAVDRLRAARVRT"
FT   gene            31732..32037
FT                   /locus_tag="Micau_0032"
FT   CDS_pept        31732..32037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0032"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: mjl:Mjls_5643 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43601"
FT                   /db_xref="GOA:D9T318"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T318"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL43601.1"
FT                   /translation="MVGDVGDLYQALADPTRRLILDELTERDGQTLFEICGRLATKHQV
FT                   GSSRQAISQHLDVLEAAGLIVTRRQGRYKFHHLDTRPLRSITERWLRSDAPTQENP"
FT   gene            32034..32420
FT                   /locus_tag="Micau_0033"
FT   CDS_pept        32034..32420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0033"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: msm:MSMEG_5678
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43602"
FT                   /db_xref="GOA:D9T319"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9T319"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADL43602.1"
FT                   /translation="MRINLTSVYVDDQDKALRFYTEVLGFVKKTDVPTGEYRWLTVVSP
FT                   DAPDGVELLLEPDAHPAAKAFKEALAGDGIPLTQFAVDDVAAEHDRLRGLGVLFTQEPV
FT                   DMGPVTTAVFDDTCGNLIQIAQYR"
FT   gene            32431..32979
FT                   /locus_tag="Micau_0034"
FT   CDS_pept        32431..32979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_3153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43603"
FT                   /db_xref="UniProtKB/TrEMBL:D9T320"
FT                   /inference="similar to AA sequence:KEGG:Kfla_3153"
FT                   /protein_id="ADL43603.1"
FT                   /translation="MAGPWRSPALAAAVARLEDEIRDAWARLRGELDVAPGSPEESELA
FT                   WLVIDDPGAYDWRTVDGAVDRLTCPDCGARLTAGPATCETCEFRHRMRFGARERDRPHV
FT                   PPGNEHALRVATAVTRSRHRYSPRARVGYELVLPDLLAGALPTTPQAQAAKALVNTLTD
FT                   DECDRVVSLAEVVELARGR"
FT   gene            33022..33711
FT                   /locus_tag="Micau_0035"
FT   CDS_pept        33022..33711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43604"
FT                   /db_xref="GOA:D9T321"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:D9T321"
FT                   /inference="similar to AA sequence:KEGG:SAV_2519"
FT                   /protein_id="ADL43604.1"
FT                   /translation="MTVWRRPYSLDLTTSGFMVVAVLAVGFFVLLVFEVRSGRMTGRDA
FT                   VFLGVWNAAGLAVAVRRAMLGVWVSPVGVRSRSLLRTTTVPWASVAEIHSGTGSIVGLD
FT                   VGRDAIVIERIDGEPVQTPIQSGAVVRPFRLELTRLVTWPEHYDEILANLRECHRNARP
FT                   PEQRAAASPAPDPVRTDRPVPPGQIRRPAPSATQRRDIHALTRQYERGVLTDAEYAAAL
FT                   ARLRGDE"
FT   gene            complement(33715..34305)
FT                   /locus_tag="Micau_0036"
FT   CDS_pept        complement(33715..34305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0036"
FT                   /product="dienelactone hydrolase"
FT                   /note="KEGG: nca:Noca_3343 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43605"
FT                   /db_xref="GOA:D9T322"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9T322"
FT                   /inference="similar to AA sequence:KEGG:Noca_3343"
FT                   /protein_id="ADL43605.1"
FT                   /translation="MAEIVLFHHIQGLTDGVRALAGSLRSGGHTVHVPDLFDGERPATI
FT                   SDGAALIKRIGGDVLDRRADALVADLPAGLVYAGVSWGAAIAQRLAQTRAGARAALLYE
FT                   ACLPVTGEWAIGPWPDGVAVQVHGMERDPFFGLEGDVDAARELVSIVGPERGELYVYPG
FT                   DRHLFTDSSLPSYDAEATALVVSRSRELLDRLG"
FT   gene            34371..34961
FT                   /locus_tag="Micau_0037"
FT   CDS_pept        34371..34961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0037"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: bcv:Bcav_3725 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43606"
FT                   /db_xref="GOA:D9T323"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T323"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL43606.1"
FT                   /translation="MSVNERIPDYDLDDLLVVTAPEQLRALADPLRSTLLELLLERAAT
FT                   VNEMARAVDRPKSSVAYHVNQLVDAGLLRVVRTRRVRAIEERFYGRVARTYYVGALSRA
FT                   EDKQVVSRINGLAEAAAEAAAAHAADELRCTLVHARIPIEDVREFWAEVQALARRFAQI
FT                   PRAGDQVYGFAAGLYPTDAPTLPDTEPATDPRD"
FT   gene            35027..35998
FT                   /locus_tag="Micau_0038"
FT   CDS_pept        35027..35998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0038"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: stp:Strop_0016 SUA5/YciO/YrdC/YwlC family
FT                   protein; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43607"
FT                   /db_xref="GOA:D9T324"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:D9T324"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADL43607.1"
FT                   /translation="MSTGSPRVLPAERGIDEAAAVLRAGGLVAFPTETVYGLGANALDA
FT                   RAAARIFEAKARPSFDPLISHLADAADLAALVGEVPAAVAELAKRFWPGPLTLIVDRPE
FT                   IIPPIVTSGLDTMAVRVPDEPSARALIAAAGVPVAAPSANRFGQLSPTRAEHVVAGLGG
FT                   AVDVVLDGGPTRCGIESTIVDARGERPVVLRLGALPVEALVEAVGPVEVRQGSSGQPVA
FT                   PGTLAAHYAPRTPLRLGAAAEPGGGRRGFLAFREPPADSDWAAVEVLSPDGDVTAAAAR
FT                   LFDALHRLDAAGVTEIVAEPVPETGVGRAINDRLRRAAATWR"
FT   gene            complement(35995..40494)
FT                   /locus_tag="Micau_0039"
FT   CDS_pept        complement(35995..40494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0039"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   saq:Sare_0021 ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; SMART: cation transporting
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43608"
FT                   /db_xref="GOA:D9T325"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9T325"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADL43608.1"
FT                   /translation="MTSLGRFAGLLLSPTVVPETAARVARTVGSALPTDAVPARVSEVA
FT                   GSVGTAAARLARLTGLTSRRVWSQDGRHHIEVHGVCQDGGDRLARQVEAALESMPGVAW
FT                   ARVNAPSGRVVVATGDPAPKLRDLIATVARVEQTCPYEPDPEIEPPQPPEDGPRTARTF
FT                   GALLSDVLGLSISAATRVLPLTPIPAEVAGLLGAVDLHPKLHALAGLGIRADPRAEVLF
FT                   PLAEAVVQGLTGGWAGIVLDGAQRVVQWGEGAAQLNAWRRAEPHLTGDPERAVARVPDG
FT                   ERPCPVPDGQPERYAKRVLPAGAVAGAAALPVLGPKRAAALALSSLPKAPGSGREGYGA
FT                   QLGRMLARRGVIAMDRSVLRELDRIDTVVLDAAVLGSDRGVLADLAPLADADTGQVAAR
FT                   AFALFDPAEPDAVRADGGWRIGPLDRLGADDPGDTPDSARLRADGGRLLGLAENGRLAA
FT                   VLRVEPEPAPGVDALASAARQAGLRLVVGGADDGRYDFADLLVPGGARLADAVHDLQRE
FT                   GAVVMVVSGERSALAASDCGLGVYGPDDLPPWGAHLLVGDDLRVPALLVDAAGVARRMT
FT                   EQNVRISMAGSGLGALAAFTADRRRLPRPTLAAVNGAAALAFAHGVFRAHRLPDRTGAP
FT                   MPALTAWHLMPAQTVLDQLATDPSGLAEDEAARRRRVEVGDEHGPAGLLRAFVEELSNP
FT                   LTPVLAAGAVLSAAFGSLVDAALVGGVVGGSALVGAVHQRNTERSLAELLSRSAVTARV
FT                   LRDGAERVVPAEELVRGDVITVSSGDAVPADCRVLTSDGLEADESSLTGESLPVAKSPE
FT                   PVVAAAIAERHSMLFEGTTVAAGHGTAVVVATGAETEAGRSLAMARQAPPASGVEARLG
FT                   RLTSSAVPLAAASAIAVAGAGLLRGVPLAETAATAANLAVASVPEGLPFLVSAAQLAAA
FT                   RRLAEHGALVRNPRTIEALGRVDVLCFDKTGTLTEGKLLLAGVGTGDGRYAVLDELDEP
FT                   LRSTLAAAVRATPAAADPDELPQQTDRAVRHGADAAGVTEQTGAAEWTATAGMPFEPSR
FT                   GYSATVGRGTGGLLLSVKGAPESVLPRCASRRTAEGDRPLDAAGREEVQAMLAGRAGAG
FT                   HRILAVAECQVSIEQVSDEQVDGLVFVGFLTLADGVRESARPAVARIRAAGVHTVMITG
FT                   DHPATAEAIAAKISPDDGGQRVVTATDLDRLDDAALAERLMATDVVARCTPAHKVRIIQ
FT                   ALQRQDRTVAMTGDGANDAPAIRLADVGIALGQRGTPAARAAADLVVTDDRLETIIATL
FT                   VEGRAMWSSVRHALSILVGGNLGEIAFSVLTAAATGRSALTGRQLLLVNLLTDLAPALA
FT                   IAVRPPADDSADHLLREGPDSSLGVTMTREIGLRAASTTLGATAGWTIARWTGTQRRAS
FT                   TVALASLIGTQLGQTVLAGGTSPSVLAATAASVGVLVAVVQTPGVSQFFGCTPLGPVGW
FT                   TIATGSALGATFANGALTKLVDRLPQPGSHRRPDADQS"
FT   gene            40705..42081
FT                   /locus_tag="Micau_0040"
FT   CDS_pept        40705..42081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0040"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   kfl:Kfla_6909 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43609"
FT                   /db_xref="GOA:D9T326"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T326"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL43609.1"
FT                   /translation="MTSTTAVPADPPVDLWSPRLRAMTVGSVALVSLLAFEALAVGTAM
FT                   PTVARSLDGLGLYALAFGGSFASGVVAMVASGIWCDARGPRPAMWHGVVWFVAGLVVAG
FT                   AATTMEVLVVGRVVQGFGSGLVSVALYVVVGQAYPEQLRRRIFAAFAAAWVVPSLVGPA
FT                   LAGLIVEHLGWRWVFLAVPAVAIPAALLVQPGLRALTATVATRPPAGALARIGWACGAG
FT                   ASAALLHYGGQQRGVLAAALIAGALAGLFVCVPHLLPAGFLRAARGLPTVIGLRALASA
FT                   AFVAAEVVIPLMLSRERGFSPTGAGLVLTVGALSWSVGSWIQGRIRSPRSAATLPRAGL
FT                   ACITIGTAGVASALVPGLPVLPAVLSWSVAGLGMGLLYPSLSVLTLEQSAPAEQGRNSS
FT                   ALQLGDSLAAATVLALTGAVLAAGASPGPAGFATTLAVAATCGLLGLLLAGRVVLRPTP
FT                   "
FT   gene            42331..43110
FT                   /locus_tag="Micau_0041"
FT   CDS_pept        42331..43110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43610"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T327"
FT                   /inference="similar to AA sequence:KEGG:SACE_2006"
FT                   /protein_id="ADL43610.1"
FT                   /translation="MRVLVTGATGRLGRVAVPRLRDEGFTLRAMSRGPRTGDGVEWVTA
FT                   DLATGAGLAEAVAGVDAVLHLASSPQRRTHDIDVLGTRRLAVAAGHAGVRHLVFVSIVG
FT                   VDRVPLGYYRHKLAAEQVVAAGPVPWSVLRATQFPEFLEGLLSGASRLGPVIGDRAVLA
FT                   QPVDPGEVADRLAVLLLAGPSNRVEDFGGPEVLRYDDAARAWLAARRVRRPLLPVRIPG
FT                   RLGRELRAGGLTTTATPTGTRTWADHLADTYGGTAGR"
FT   gene            43147..43344
FT                   /locus_tag="Micau_0042"
FT   CDS_pept        43147..43344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43611"
FT                   /db_xref="GOA:D9T328"
FT                   /db_xref="UniProtKB/TrEMBL:D9T328"
FT                   /inference="similar to AA sequence:KEGG:Sare_0023"
FT                   /protein_id="ADL43611.1"
FT                   /translation="MLVFVATVVLYVFGFVFLYGVIRVGVRHGIEDAEANRPEVLRRRQ
FT                   LTTTESRDFAQENAFLTNPN"
FT   gene            43404..43952
FT                   /locus_tag="Micau_0043"
FT   CDS_pept        43404..43952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0043"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: tfu:Tfu_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43612"
FT                   /db_xref="GOA:D9T444"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D9T444"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADL43612.1"
FT                   /translation="MGTLKTEPARTRLDLLAPPVAAALQDWPAEAPVDVDDVLVAPIDA
FT                   DLADTAAFCEAYGVGLEESANCVVVAGKRGGEIRYAACVVLATTRADVNGVVRKLLDVR
FT                   KASFAPMAEAVESSGMEYGGITPIGLPADWPILVDSRVIATPHVIIGSGVRHSKIALPG
FT                   PALGALPGARVVEDLARPA"
FT   gene            complement(43989..44621)
FT                   /locus_tag="Micau_0044"
FT   CDS_pept        complement(43989..44621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0044"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: saq:Sare_0024 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43613"
FT                   /db_xref="GOA:D9T445"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9T445"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADL43613.1"
FT                   /translation="MDIEIYADVVCPWCWIGKRRLEQALESYDGEVNVRFRPFQLDPTP
FT                   VTEPKPLLEALGDKFGGRDKAEGMAAHVTGVAAGAGLDLRFDRAVAANTFDAHRLVRFA
FT                   TEHGRSAEMVERLYRAHFHDGVDVGSIDALVTLAGEAGLDETEARQYLESNLGRREVAA
FT                   DLSTAHQLGVSSVPTFVLAGKYAVTGAQEPETLLAALREVAQREAAA"
FT   gene            complement(44642..45067)
FT                   /locus_tag="Micau_0045"
FT   CDS_pept        complement(44642..45067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0045"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   saq:Sare_0025 Fe-S metabolism associated SufE"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43614"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:D9T446"
FT                   /inference="protein motif:PFAM:PF02657"
FT                   /protein_id="ADL43614.1"
FT                   /translation="MPEMPTKLAEIVDEFAAAPRDVVLEMLLEFADVIPPLPEGVNREE
FT                   LEQVPECQTAFFLRAEVNADKTVSTVFDCPPEAPTTRAFAGILAEGLAGASAEEVLAVP
FT                   DDLYQRMGLAQAISPLRVRGGTAILARLKRQVREQIS"
FT   gene            complement(45146..45565)
FT                   /locus_tag="Micau_0046"
FT   CDS_pept        complement(45146..45565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0046"
FT                   /product="CBS domain containing protein"
FT                   /note="KEGG: stp:Strop_0022 signal-transduction protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43615"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D9T447"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADL43615.1"
FT                   /translation="MFRVSDVMTRQVVYLSAETPLDEAARVMKESDIGDVVVTDGATLA
FT                   GMLTDRDIVVRAVAERADPGTTTIGSIITREVVMIEQHCTANEAAALMRERNIRRVLVC
FT                   DSDRKLVGIVSLGDLAMQLDPHSALSDISEAAPNV"
FT   gene            complement(45620..47389)
FT                   /locus_tag="Micau_0047"
FT   CDS_pept        complement(45620..47389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0047"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="KEGG: saq:Sare_3553 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); YbaK/prolyl-tRNA synthetase associated region;
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43616"
FT                   /db_xref="GOA:D9T448"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D9T448"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADL43616.1"
FT                   /translation="MLLRMSTLLLRTLREDPADAEVPSHRLLLRAGYVRRAAPGGYTWL
FT                   PLGKLVLDRITAIVRDEMTGIGDQEVHFPALLPAEPYRTSGRWTEYGDDIFTLADRKGA
FT                   EHLLAPTHEELAALLVKDLFTSYRDFPVTLFQIQTKFRDEARPRAGLLRGREFLMKDAY
FT                   SFDLDEAGLQAAYDRHRAAYERVFTRLGLDFTTVHAMSGAMGGSASEEFLAATPVGEDT
FT                   FVGCTACDYAANTEAVVTRAPAAGDPDAYPPAEVHDTPETPTIAALVELAEARELGGRT
FT                   GWTAADTLKNVVLTVRRPGAEQGEPLVIGLPGDREVDLKRVEAVLVPATVAVFEDWDAH
FT                   PELVRGYIGPQILAKHGIRYLVDPRVVPGTSWLTGANEPGRHATDVVCGRDFVPDGTIE
FT                   AAEVRPGDSCPACADGELTIRRGIEIGHIFQLGRRYTDAFAVDVLGPEGKPVRPTMGCY
FT                   GIGVSRAVAAVAEQHHDDRGLVWPAAVAPCDVHLIAAGKGPQLDAALDLGGRLAAAGLR
FT                   VLVDDRTHVSAGVKFTDAELIGIPRAVVVGRRLAEGYVELRDRATGERTELPVEAIVER
FT                   LRDEAGATRRDGV"
FT   gene            47563..47937
FT                   /locus_tag="Micau_0048"
FT   CDS_pept        47563..47937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43617"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D9T449"
FT                   /inference="similar to AA sequence:KEGG:SGR_3077"
FT                   /protein_id="ADL43617.1"
FT                   /translation="MAERPLMKLTTTVLDAPSAEDLAAFYERLLGWSRREDESDWVVLA
FT                   PPDGGTWLAFQDEPAYVRPVWPAGPGDPPMMTHLDIKVDDLEAASAYAVSVGATLADFQ
FT                   PQDDVRVHLDPAGHPFCLYL"
FT   gene            complement(47962..48726)
FT                   /locus_tag="Micau_0049"
FT   CDS_pept        complement(47962..48726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0049"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bcv:Bcav_1034
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43618"
FT                   /db_xref="GOA:D9T450"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9T450"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL43618.1"
FT                   /translation="MTIHVLSDTGTLTGRSLRHILRSPDTIITTAVTPVALMLLFVYVL
FT                   GGAINTGSGESYINYMLPGILLITIASGIAYTAYRLFLDMQGGIFERFQSMPIPRPSVL
FT                   WAHVLTSLVANLASLVIVTGVALIMGFRTGASVVGWLAAAGILILFTLALTWVAVIAGL
FT                   SAKTVDGASAFSYPLIFLPFISSAFVPTDSMPGPVAWFADNQPVTSIVNTLRALFAQQP
FT                   VGNDVWIALAWCAGLLLAAYAAATAIYRTKVS"
FT   gene            complement(48723..49535)
FT                   /locus_tag="Micau_0050"
FT   CDS_pept        complement(48723..49535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0050"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: bcv:Bcav_1033 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43619"
FT                   /db_xref="GOA:D9T451"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T451"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL43619.1"
FT                   /translation="MTTATREPAIRVRGITKSYKDLHVLRGVDFEVTAGSIFALLGSNG
FT                   AGKTTLVRILSTLLKADTGTATVHGFDVASVPAEVRKSISLTGQFAAVDEVLTGRENLV
FT                   LVAKLRHLRNPGAVADDMLARFSLTDAGNRRAGTYSGGMRRRLDIAMSLVGNPPVVFLD
FT                   EPTTGLDPQARIEAWRTVRQLAEDGTTILLTTQYLDEAEQLADRIAILHEGTIIQNGTL
FT                   AELKRLLPTAKVEYVEKQPTLEDVFLALVGHTARAADKAAVPAGEESR"
FT   gene            complement(49532..49909)
FT                   /locus_tag="Micau_0051"
FT   CDS_pept        complement(49532..49909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0051"
FT                   /product="uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: uncharacterized conserved protein UCP029876;
FT                   KEGG: aau:AAur_3849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43620"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:D9T452"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADL43620.1"
FT                   /translation="MAAKWIETLVGSLDQKKQYKRHMARMEALPEPHRSAAKALQRYFM
FT                   YQGGIVDGNTLVAMLGDSVDLWERAVADNTPVRAIVGDDPVEFAETFVSAYSGRQWMDK
FT                   ERERLRKAIDAAAGNSGEEHS"
FT   gene            complement(49912..50259)
FT                   /locus_tag="Micau_0052"
FT   CDS_pept        complement(49912..50259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0052"
FT                   /product="transcriptional regulator PadR family protein"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: bcv:Bcav_1031 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43621"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T453"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADL43621.1"
FT                   /translation="MANQMTEMLKGTLEGIVLAILARRSAYGYEITAWLRDRGFSDIAE
FT                   GTIYALLVRVEQRGFVDVEKVPSEKGPPRKVYSINAKGRDQLAEFWRTWSVLAERIDHL
FT                   RDDDDRHDEGA"
FT   gene            50380..51147
FT                   /locus_tag="Micau_0053"
FT   CDS_pept        50380..51147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0053"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: kfl:Kfla_2348
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43622"
FT                   /db_xref="GOA:D9T454"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9T454"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL43622.1"
FT                   /translation="MTTTPSARAVSQYATTTGNLTARMALHSYGTNPQDWFAWLGERLP
FT                   LSGDVLEVGAGTGELWHRIGHRPRLTLTDFSPAMCARLREVPGARVLRCDATHLPFRTG
FT                   VADAVIANSMLYHLDDPDAALREFARVLRPGGRLAVAVNGRDHMAELNTLGPVIGCPDL
FT                   AVRFHDRNDVTAETTPARVAAHFDDVTVERYPDELVVPAAEPILAYVASMIGPLPAAQE
FT                   AAARAAIEARIDAEGAFRVRKHTVLISSTRGAR"
FT   gene            complement(51122..51313)
FT                   /locus_tag="Micau_0054"
FT   CDS_pept        complement(51122..51313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0054"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   saq:Sare_2601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43623"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D9T455"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ADL43623.1"
FT                   /translation="MELIGALWRKSSRSGQSECVEVADNLAGVVGVRDSKDPAGPVLTF
FT                   TPDAWRTFVRLSGRRASS"
FT   gene            complement(51304..52107)
FT                   /locus_tag="Micau_0055"
FT   CDS_pept        complement(51304..52107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0055"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   saq:Sare_0926 helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43624"
FT                   /db_xref="GOA:D9T456"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9T456"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADL43624.1"
FT                   /translation="MENEPTAELIRAQLRRLRVRAELSQEEFGRLVHFSGSQVSAVELG
FT                   HRPLDRFFLARADEVLGTGGLLMSLLKLAERDGQPSWFRPWLEAERQAQQLRCYQPSLI
FT                   PGLLQTENYARAMIRTDDMLAEQEAERRLAVRLDRQTVLAGADPPKFVAVIEETVLRRA
FT                   DESFRGLMSQQVAHLIEASSHPHIAVHVIPADVGLHIGLTGPFTLARGGDGGWIGYLEN
FT                   QLGGTVIDKDEHVAILLSRWESVRSEALSRRQSIELMKEVVESWS"
FT   gene            52203..52538
FT                   /locus_tag="Micau_0056"
FT   CDS_pept        52203..52538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43625"
FT                   /db_xref="UniProtKB/TrEMBL:D9T457"
FT                   /inference="similar to AA sequence:KEGG:Strop_0101"
FT                   /protein_id="ADL43625.1"
FT                   /translation="MNLPVPRLGPYPDRPRPYPPDHPAHLPIRPLWLCRACGGPWPCAQ
FT                   ARLLLKVEYADHPVDLAVYLSGLYHEATHDLFRLNPQDGPTPRELFERFVGWGPYRRSI
FT                   TDTMPAS"
FT   gene            52535..53092
FT                   /locus_tag="Micau_0057"
FT   CDS_pept        52535..53092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_4488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43626"
FT                   /db_xref="UniProtKB/TrEMBL:D9T458"
FT                   /inference="similar to AA sequence:KEGG:SACE_4488"
FT                   /protein_id="ADL43626.1"
FT                   /translation="MTAPGDFDLTTDELREVTRYAVRHAEDVLPVYERAVPGDPRPRAA
FT                   VDAAWTFARGAARTRLQRVTSLDAHRAARSAPTEAARLAARAAGDAAAAAYLHPIAKAT
FT                   QVGHILRAAANAARVAELEAGGDEAVGDSQVDRSRRLATPVLVDVLRRYPPLTGGGSRV
FT                   ARLMSTLDHDLRQGTAGPEAAS"
FT   gene            53089..53604
FT                   /locus_tag="Micau_0058"
FT   CDS_pept        53089..53604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43627"
FT                   /db_xref="UniProtKB/TrEMBL:D9T459"
FT                   /inference="similar to AA sequence:KEGG:Namu_0341"
FT                   /protein_id="ADL43627.1"
FT                   /translation="MILPKVRDPRFTTIRRGGTLTDEHHHLLALWAATCAEHVLGMFEA
FT                   VRPDDSRPREAIEHTRAWVRGEVRMMEARAAGGHAMGAARDLRGAARNAAYAAGQAAVV
FT                   AHVAAHELGAAAYAIKAVRAAAPAGLAEAAGRDECRWQRDQLPAEIRDLVLDDQRLRND
FT                   ICWSVFDC"
FT   gene            53721..54251
FT                   /locus_tag="Micau_0059"
FT   CDS_pept        53721..54251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0059"
FT                   /product="RNA polymerase sigma-70 factor, sigma-E family"
FT                   /note="KEGG: stp:Strop_3158 sigma-70 region 4
FT                   domain-containing protein; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43628"
FT                   /db_xref="GOA:D9T460"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9T460"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADL43628.1"
FT                   /translation="MDPLLNEFDLFVRTRTPALLRSAYLLTGDQHLAEDLVQSALARTH
FT                   RAWNRLHETGNAEAYTRKTMYHLQVSWWRRRRVAESMPGDMPEPRGGDSAPDHAQQTTL
FT                   RLALRAALARLSAKQRAVLVLRFFEDRTESEAADLLGVTVGTVKSQTSKARAKLRSVAP
FT                   ELAELYVTEGTAR"
FT   gene            54248..55354
FT                   /locus_tag="Micau_0060"
FT   CDS_pept        54248..55354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43629"
FT                   /db_xref="GOA:D9T461"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D9T461"
FT                   /inference="similar to AA sequence:KEGG:Strop_3157"
FT                   /protein_id="ADL43629.1"
FT                   /translation="MNQDRLRFDLADLAEEVTPVDLRDRALRTSRRLGIQRAVATSAAA
FT                   LVVLAAATGTALAIRPNSQAPAPAGPSVTVTAPPVEPSRTPSPDASTATGQSQSALAGT
FT                   RYYLEQTSTRSRIHEVRGTRDRVVHEVVHEAASRCESNTVSVSPDGKRVVWVQDSTDNA
FT                   SGVLLIATVGDKGATTLAEGISCFGARPMRWKGDDRLMVQRKNGQSVLYDVVANKQVVG
FT                   DPGQETKRCWSADGTWLAAESDGKPYVSDTTDLRQYTYTPPQQEAAKWDGWEARSVSTD
FT                   GRYVAVGWIGTDPSRRDGSFAVVDTRTSKVVDLPGTGEVRSILFSADGTVLLRRGTGIT
FT                   VLDREFKPLGTVTEPAPTRNRALLAYVP"
FT   gene            55457..56539
FT                   /locus_tag="Micau_0061"
FT   CDS_pept        55457..56539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43630"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D9T462"
FT                   /inference="similar to AA sequence:KEGG:Strop_3157"
FT                   /protein_id="ADL43630.1"
FT                   /translation="MQIETDVWECIRDAHQPTPEDRIVNVIVTSARGLRTVAALAAAAF
FT                   VAVGVSACGDGGSTPSAPAAGQSSAAAPSSAAPSPSDASSAALPGTRYYLSFGEQAAEV
FT                   HVVKGGTDRVSASVPYGGGDCVRNTITISPYGERLAWVEGAAGAEAGKLVTTRIDGSDR
FT                   ATIATEPPFSGKAPCDGGDPLVWNTNDRVLVQQDGHMALIDLSSRKPADGDAGNETLKW
FT                   WTPDGRNWAAVSEGRPYATTDPKVTFYRYTPPTAQAARYDGWRVRSVSADGRYVAVGWI
FT                   NKDETRNDGSFAVVDTRTSKVVDLPGTGEVRSILFSTDGTVLVRRDNGISVLDKRFQPV
FT                   GTVTEPAGLSGALLLAYVPA"
FT   gene            complement(56591..57991)
FT                   /locus_tag="Micau_0062"
FT   CDS_pept        complement(56591..57991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0062"
FT                   /product="Pyrrolo-quinoline quinone beta-propeller repeat"
FT                   /note="SMART: Pyrrolo-quinoline quinone beta-propeller
FT                   repeat; KEGG: sro:Sros_3286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43631"
FT                   /db_xref="GOA:D9T463"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D9T463"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADL43631.1"
FT                   /translation="MTYQHQHPPPAYPPAGWPGPAGAPPAAPKRRGRVALLVAGGLVAV
FT                   LAVAAGTAYGVSRLVGGDDDDGRKLRTAWVLDFPERQRNGLKTYDGQDMFGAWLVGDAV
FT                   VRAQPDGVIAYRLDDGAQAWGVPAPQATSLCAAAQTLAEGRGVVALGSADSCDTIVGFD
FT                   AAAGTQTWRATFPVERRTGRSEIVAPDLSVTAGQVVVRSGENVLGYSLADGKRLWQTDA
FT                   DRLLPGRDCRLTDAQAAGDQAVVTALCDGDRGALLGLDPATGKPRWQQKLPAAQQSAGV
FT                   LSVDPLVSLPGLSTETFVARDAAGKARATFGNPVDGTRFSDLPVNRSNTVSGPGIRPYL
FT                   ADADTLYLPTEATNVGGKMRQANQVVAIDLATGNRRWVSAGHTDSEVELVRLDEQGLLA
FT                   WEVGDRRDLAPRLVRIDPATGEVTVVAEAPLSAGTEGSDAKVLERDGTVVLVPWKHVTA
FT                   DAAITVLR"
FT   gene            complement(58011..59492)
FT                   /locus_tag="Micau_0063"
FT   CDS_pept        complement(58011..59492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_3285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43632"
FT                   /db_xref="GOA:D9T464"
FT                   /db_xref="UniProtKB/TrEMBL:D9T464"
FT                   /inference="similar to AA sequence:KEGG:Sros_3285"
FT                   /protein_id="ADL43632.1"
FT                   /translation="MTQGHPPAGWPPPGNADPRYAAAPPPAQPGPWGPPPATPKSRRGL
FT                   WIGLAAGALALALCAGTAVGVGLGLRGDDEEGPAPKAAAGANGVTVTNAELTALLDRHS
FT                   KALAAKDLDGYLAAFDPARKELIAGQSQLFRNLGKLPLSVARYETIERQGRAGDAFGQG
FT                   VTFQLDVSFVHQLDGFDLAPVTEWYRWTIVRTGKDAPIRVTAVTGAPAAGNGGSKTVHY
FT                   PGPWDKWREIHVERTPHALLIADAARAGVAKRYAPAADVAVTNGLAVWRASGPPGPVPS
FT                   GFVITLADGKDEMTSLYRIGTEKATEAGFSLGLVAAERKDGKDTIGGTRIVVDTSDRYF
FT                   TRTGGDNDARMVLRHEVAHSLMTPRTDLTAVDAFSKLDEWVVEGFAEYIAFHGRPLGAS
FT                   ERTAQARQLVRGGWNGTLPGNGEWDDPDRLSFHYWLGHAAMNHLAEKHGEPKLFRFVEA
FT                   VYAGTPTDRAARDVLGVSLDEFQAGWAAYVRAQAR"
FT   gene            59747..60517
FT                   /locus_tag="Micau_0064"
FT   CDS_pept        59747..60517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0064"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   saq:Sare_0027 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43633"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9T465"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADL43633.1"
FT                   /translation="MRWRSYVAVGDSFTEGMDDAYPDGSYRGWADLVATRLAAEAGPDF
FT                   GYANLAIRGRLFPNVVAEQVPSALAMKPDLISFAAGGNDVLRRSFDPDSFVPRFDSVVQ
FT                   RLRSGGSDVVLFRFADVMARLPGQRLVAPRVALLNRAVGEVAERHGAILVDLYADDTYL
FT                   NPLLWSTDRLHLSAAGHRRVAAQVLTALGVGCEEEWLMVPPHPAPSPWLAARAADLRWA
FT                   GRHLAPWIKRRLTGRSSGDFVTAKRPVLGPVERD"
FT   gene            60520..60966
FT                   /locus_tag="Micau_0065"
FT   CDS_pept        60520..60966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43634"
FT                   /db_xref="GOA:D9T466"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D9T466"
FT                   /inference="similar to AA sequence:KEGG:SAV_4826"
FT                   /protein_id="ADL43634.1"
FT                   /translation="MRTVHAADLLRLTPDDPPRTGLAVVVAGDRVEAIVPTAELSGAYP
FT                   GVRVRRWAGTLGPALVHDGPLPPAPTPRERVHALFRLGVAAVLDEHVTDPALRSAAARN
FT                   EVAVLPAARPPALVTGGRADLAVFDADGSCLATVVAGRLVHRRA"
FT   gene            61007..61909
FT                   /locus_tag="Micau_0066"
FT   CDS_pept        61007..61909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0066"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: saq:Sare_0028 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43635"
FT                   /db_xref="GOA:D9T467"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9T467"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL43635.1"
FT                   /translation="MPVPSDPHPHLQSYADPQRLVTTEWLAEHLGDEGLVVVESDEDVL
FT                   LYDTGHIPGAVKVDWHTELNDQVTRDYLDAASFAELCAAKGIGRDDTVVFYGDNFNWWA
FT                   AYALWVFSLFGHQDVRLLDGGRQKWIAEGRELTRDKVSRPRASYPVPERNDAPIRAYRE
FT                   QVMAHVAAGRPLVDVRSPGEYTGEMLHMPDYPQEGALRGGHIPGAVSKPWKSAANDDGT
FT                   FKSADELRAIYGDQLGLSPSDDVVAYCRIGERSSHTWFVLHHLLGFPQVRNYDGSWTEW
FT                   GNLVRAPVVKGDQPGGLTR"
FT   gene            complement(61991..63184)
FT                   /locus_tag="Micau_0067"
FT   CDS_pept        complement(61991..63184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_4783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43636"
FT                   /db_xref="GOA:D9T468"
FT                   /db_xref="UniProtKB/TrEMBL:D9T468"
FT                   /inference="similar to AA sequence:KEGG:Kfla_4783"
FT                   /protein_id="ADL43636.1"
FT                   /translation="MSEPELTRLLTRAAEEIRPTRPAEAGWERAGRVRRARRAAGVAAV
FT                   AVVLLGGGTTALLHRSGPPPAAPPRPTVTAAPSAPVVQRPPDRLGEAGDPLGRLGDRVA
FT                   FALSDRPVSRALALYQPVDPETGDAGPVRVLGDDGMVRELDVVTLAPTRDAEGNEATPL
FT                   KPGSLSPDGRTAAFAQTGEVVVVGLTDGAVRRYPLTGYLEHVLWAGDRLLVGDNDTTYE
FT                   LDRRTGAARKLAVDPWTLVVPEPARSGDLFTVGGWSGDGGLAVRRFPASGGAPERRPVT
FT                   AGELPPGYQLNEVYGRGWQRGDRIAQAGWTTTAGAAGTMSGAEGVAVLDARTGAVTRLL
FT                   DLGREGRTKGCCEVYGWTADGAVLLRYDAGLARWRPETGAVDWVASNVPGRLSIAAR"
FT   gene            complement(63181..63711)
FT                   /locus_tag="Micau_0068"
FT   CDS_pept        complement(63181..63711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0068"
FT                   /product="RNA polymerase sigma-70 factor, sigma-E family"
FT                   /note="KEGG: stp:Strop_4572 sigma-70, region 4 type 2;
FT                   TIGRFAM: RNA polymerase sigma-70 factor, sigma-E family;
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43637"
FT                   /db_xref="GOA:D9T469"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9T469"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADL43637.1"
FT                   /translation="MGRDADDGRADYLAFVESHQHRLLRAAYLICGNRHQAEDLLQDAL
FT                   LKLALRWPSVRDGDPAAYVRAILYRDAVSWWRRRRREWLSAYPPDRPGADADAALRLTV
FT                   RAALDRLPPRQRAVVVLRYFEDLTEVATAEALGVTVGTVKSQCHDALRKLRDVVPAPGT
FT                   SGDGLVTGMEANP"
FT   gene            complement(63728..64327)
FT                   /locus_tag="Micau_0069"
FT   CDS_pept        complement(63728..64327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0069"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kfl:Kfla_0041
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43638"
FT                   /db_xref="GOA:D9T470"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D9T470"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL43638.1"
FT                   /translation="MDVTEPATRTRRSDATRAAILRAARERFAADGYDRATIRAIAADA
FT                   RIDPSMVMRYYGSKEGLFAAAAEFDLRLPDLAEVPPDRLGETLTRHFVRRWEADGTLVA
FT                   LLRAAATNPGAAERMRGIFAGQLATAVARSGADPATADRRAGLVASQILGLALTRYVVR
FT                   LPPVVDLDPEELADWVGPTIQRYLTQPLPPSRASGG"
FT   gene            64419..65564
FT                   /locus_tag="Micau_0070"
FT   CDS_pept        64419..65564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0070"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: kfl:Kfla_0042
FT                   monooxygenase FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43639"
FT                   /db_xref="GOA:D9T471"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9T471"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADL43639.1"
FT                   /translation="MLPERTDVLVVGAGPTGLAAAVTLARHGVTATVVDRLAEPPVTSR
FT                   AAVVHAGTLEVLDRIGVAAPLAARGLHSARFGVRDRDRVLVTVPFDRLPSRYPYALLIS
FT                   QAETEAVLTDQLTALGGRVLRPYEMTGLDLDGDGAVARFDGGRAVRARWVVGADGMHSR
FT                   VRELAGIGFGGPADPRESFLLADVHVDSALPRDQVSLFLSRRGPLVWAPLPDGTVRLVA
FT                   TVDDAPRDPQAHHFQALLDERGPARRPDRVTGMAWASRFRIHHRIASTYRSGPVLLAGD
FT                   SAHVHSPAGGQGMNLGLRDAVALGDALAAGPQALDGYAADRRPRAEEVLGFAAGLTRLA
FT                   AAPPAVRPLRNLLLRAVSTLPPLRHRIAVRLAGFEPARPDS"
FT   gene            complement(65581..66852)
FT                   /locus_tag="Micau_0071"
FT   CDS_pept        complement(65581..66852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0071"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_6301 antibiotic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43640"
FT                   /db_xref="GOA:D9T472"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T472"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL43640.1"
FT                   /translation="MTITAVPGRDYRLLWSAAVCSQVGDSLRTPALALLAATLTRDPRA
FT                   VAAVTVAGLLPPLLFGLLSGVYADRWDRRRTMAVVDGGRAVVVAALAWSVATGHAGIAT
FT                   LVVVASLLALLGTLFDASAYALLPTVVPPEGLAGANARLQAGTAVAGGFVGAPLAGVLF
FT                   AVSPALPFTADALTFALAAVLILAIPAPTPRRSCTFRPGKAAQKGRSRGHNRKINEDKG
FT                   GVWEGIRFLRRDRVLRALTVGTAGSNLAIGGLASVLVLYALAVLRVPEAAYGLFAAGAI
FT                   AGGLGGALFAGRLAARFGTLPTLRVVLLGQTLALAGFALARHPLTGGLAMAGFTAGSTI
FT                   WNSLRAAYGQRHVPPDLLGRVGAAQRVAGLAAAPAGAVLAGLAAQAFGLTPVPWAAAAV
FT                   FALVTAAVWVTFRARTGPPAAPPH"
FT   gene            66971..68764
FT                   /locus_tag="Micau_0072"
FT   CDS_pept        66971..68764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0072"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: tcu:Tcur_4208 ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43641"
FT                   /db_xref="GOA:D9T473"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:D9T473"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL43641.1"
FT                   /translation="MDRTFQVDLRGVVDLLSHHLYGSPRVYVRELLQNAVDAITARRST
FT                   EPKAPARVRIEPPELTGDGTLRVHDTGIGLTEAQVHELLATIGRSSKRDELGFSRHEFL
FT                   GQFGIGLLSCFLVADEIRVVTRHADEPTVLWTGWSDGRYAVRLAEPDQARDEPGTTVTL
FT                   VPRRDADQWLGVPTVTELARLYGGLLPVDVRVGDTPTTAGPPPWPTTPGAPVDRAALQR
FT                   YAQELLGFVPFDVVPLSVPEAGLTGVAFILPAAVNPAARAGHRVYLKRMLLSEHADGLL
FT                   PEWAFFAHCVVDASELRPTASREALYEDALLTSVREALGDQIRGWLVRLAKHDPRRLGE
FT                   FLQVHHLGVKALAMHDDEMLRLVDQWWPMDTNVGTMTLAEFRQRHGVLRYAASLDEFRQ
FT                   LAAVAAAQDVAVVNGGYTYDTELIERLPTVDRSVLIERLEPSDLTTRFEILDPATELAL
FT                   RPFLTAAQRALERLGCEVVIRAYDPVSLPALYLVSRSAAFHDQLAASRDKADELWGGVL
FT                   DALAASAPPDRPQLVLNHRNPLVRRVTTLADPELVGLAVEALYGQALLLGHHPIRAADA
FT                   ALLNSSFLGLLGRAVPGETRD"
FT   gene            68757..71600
FT                   /locus_tag="Micau_0073"
FT   CDS_pept        68757..71600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0073"
FT                   /product="tetratricopeptide TPR_4"
FT                   /note="KEGG: tcu:Tcur_4207 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43642"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D9T474"
FT                   /inference="similar to AA sequence:KEGG:Tcur_4207"
FT                   /protein_id="ADL43642.1"
FT                   /translation="MTDDDLWRMHHEIESMPYGPGQIAALEQLLRRADAGDDRHLAFAA
FT                   RVTGTTAYVYGGEPAKSFVTFSWCLAEYDKDPQPYHQRYTHQLLWFFKYMVNAMVKFPE
FT                   LPLDRTYAVLDDMERRYRDSGHSLQAVYKHRYLVAAHLGDDEAAEQWYRKWMTTPRDTL
FT                   SDCAGCDPTTQVAHLVRHGRHEEAVALAEPVLAGRLTCSEQPQGILTALLTPYRETGRT
FT                   DAARDAHREAYRRVRGHLADLWDIADHVEFCTVTGNEARALELVERHLDWLDRAPTPAA
FT                   AMHFAAAASAALRQVPAELTVHRRASGERAAADVPAGALADELAGTATALAERFDARNG
FT                   TTHQSGLIARKLAAGPVGEHLPLSASLRRPAVPAPRTGSDAPVASPQPVTVPADAGADE
FT                   LLALAEECWRTNRRDGLVAALHAYDERFGDADVPATTRAWRLELRAGELSQDDDGVPVA
FT                   IEVNREALAAWREVPDPLRAQVVAGRLGVLLSMVEESADEGMALARESAGYLTEHGEPR
FT                   DRAAGWDRLALAHVHREQWAEALDALDRAEAEADADPWLAGRVALHRTHVLEQLERAEE
FT                   FRDAAARSRRLAGELGDAEMLTGACLAYARATDDPADAVAACEEALSVAPAGAHLPLRV
FT                   TRGRALMAADRAGEAVEDLAEAVTLCVEQGLEGDALLRWELAEAYRVAGRLAEAAEVAE
FT                   EAVLGLDRAGAQAEADRCRHMLAGIYAGLGETDLALTVLDTLAENLDGPDNLPHRAQVL
FT                   EESGGLLYDADRDALAAQRFAAAATAWRLAGFQVDELRARRRELLALHWSGDLPAAVAA
FT                   IERVDEAAAALPAEADEAPVVTYERAMAADAVARVLIGEDRLTAALDRVDGVPERLRSI
FT                   EAFGEAAQVEVLTGELLLRDGRPEQAEGLLRPVLGGLPSGSRPATQAAWLLARALDEQG
FT                   REAEASKVRADHGIEED"
FT   gene            71672..72286
FT                   /locus_tag="Micau_0074"
FT   CDS_pept        71672..72286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0074"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: saq:Sare_0030
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43643"
FT                   /db_xref="GOA:D9T475"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D9T475"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL43643.1"
FT                   /translation="MAVEQQARGAAGAARRRSRRDEILEIAVGLFAARGYHGVSMDDIG
FT                   AAAGVTGPALYHHFAGKEAMLVAALIPVSEGLLAGGRERAAGHPGDPRAALESLIDFHV
FT                   DFALANPAVIALHLHELDRLPDEPRRRIRRLQRMYVEEWVTVLTALHPGLPDGAARVLA
FT                   HAAFGLMNSTPFLGGEVDRRRRAELLRGATLAALLAPTDPT"
FT   gene            72355..73701
FT                   /locus_tag="Micau_0075"
FT   CDS_pept        72355..73701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0075"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   stp:Strop_0025 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43644"
FT                   /db_xref="GOA:D9T476"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D9T476"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADL43644.1"
FT                   /translation="MQKMIESLLVANRGEIARRIIRTGRRLGIRTIAVHSEADGALPFV
FT                   TEADEAVCVGPANPAQSYRNVEAILDAARSTGAQAIHPGYGFLSENADFARTVEGAGLI
FT                   WVGPGADAISAMGDKINARNLMAAAGVPVAPGTTEPASDLDAAVTAAAEIGYPVMVKAA
FT                   AGGGGMGMGVAADEAALRTEYDKVRAFAERMFGDGSVLIERYFPRVRHVEVQILGLADG
FT                   RVVALGERECSVQRRNQKLVEESPSPAVSPELRERFLAAAVRAGEAVNYRNAGTVECLL
FT                   DPSTQEFFFLEMNTRLQVEHPVTEYVYGVDLVEEQLRVASGLAPTFDPDALTPRGHAIE
FT                   LRINAEDPKRFLPGPGAITTWNEPSGTGVRVDSGYVAGNTVTPFYDSLMAKLILTGATR
FT                   EEAVERARAAVAQFEIAGPKCNLPFFAELLENPEFLSGDYDTGIVSRMR"
FT   gene            73727..74647
FT                   /locus_tag="Micau_0076"
FT   CDS_pept        73727..74647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0076"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   saq:Sare_0032 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43645"
FT                   /db_xref="GOA:D9T477"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9T477"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADL43645.1"
FT                   /translation="MAELPGSVSIREVGPRDGLQNEEPIPTDAKVRLLDALSRTGVRRI
FT                   EAVSFVHPKAIPQMADADEVWQRAEKVDGVRYSALVPNTRGAQRALAAGFTEIEVVVSA
FT                   SDTHNRRNVNRSTDESLDDIAELIDLLHGAGATAEVIVATSFGCPYEGDVDPRRVAAIV
FT                   DRVARDGADRVAFGDTTGMGTPRRVRELVTAVRDRNAHLPVLLHFHNTRGTALANMLTA
FT                   MELGITEFDASVGGLGGCPYAPGASGNLATEEAVHMLHDMGIDTGIDLDALIEAAELAE
FT                   TLVGKQLPSGVLRAGPRTRLTPRPA"
FT   gene            74805..76337
FT                   /locus_tag="Micau_0077"
FT   CDS_pept        74805..76337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0077"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="KEGG: saq:Sare_0033 propionyl-CoA carboxylase; PFAM:
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43646"
FT                   /db_xref="GOA:D9T478"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D9T478"
FT                   /inference="protein motif:PRIAM:6.4.1.3"
FT                   /protein_id="ADL43646.1"
FT                   /translation="MTLDGEALEQLRKRARAGGADKYHAANAAKGKLFARERVAYLVDE
FT                   GSFVEDGLYANAMADGLPADGVVTGTATIDGRQVCLMANDSTVKAGSWGARTVEKIIRI
FT                   IERAYATGVPMVYLVDSAGARITDQVDLFPGRRGAGKIFWNQVRASGSIPQVCALFGPS
FT                   AAGGAYIPAFCDVVAMVDGNASMYLGSDRMVEMVTGEKTTLEAMGGAKVHCAESGVGHF
FT                   LCKTENDALDVVRTYLSYLPSNWKQDPPAAEAVAAPEKADLAALVPASERQAFDMRRYV
FT                   KGLLDEGSFFEIQALWAKELTIGFGRLNGEVVGVVGNNSMFKGGVLFVDSADKATRFVQ
FT                   LCDAFNVPLLFLSDVPGFMVGSAVEKQGIIRHGAKMITAISEATVPKICVVVRKAYGAG
FT                   LYAMAGPGFEPDATIALPTAKIAVMGAEAAVNAVYANKIAAISDEAERAAFVAAKREEY
FT                   ERDIDVVRLASELVVDAIVEPHELRAELVRRFTAARGKERHFSRRRHGVTPV"
FT   gene            76456..77604
FT                   /locus_tag="Micau_0078"
FT   CDS_pept        76456..77604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0078"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: saq:Sare_0034 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43647"
FT                   /db_xref="GOA:D9T479"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D9T479"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADL43647.1"
FT                   /translation="MDFRLDEEQQALRESVREFAREVVAPTIAEHYEQHTFPYEIVRQM
FT                   GKMGLFGLPFAEEHGGMGGDYFALCLALEELARVDSSVAITLEAAVSLGAMPIYRFGTE
FT                   EQKAQWLPKLLSGEALAGFGLTEPGTGSDAGGTRTRAVLDGDEWVINGSKAFITNSGTD
FT                   ITALVTVTAVTGTRPDGGKELSTIIVPSGTPGFTVAPGYSKVGWNASDTHELTFDDCRV
FT                   PAANLLGERGRGFAQFLRILDEGRIAIAALAVGLAQGCVDESIKYAKERQAFGQPIGNY
FT                   QAIQFKIADMEMKAHTARLAYYDAAARMLAGEPFKRQAAIAKLHASTVAVDNAREATQI
FT                   HGGYGFMNEYPVARFWRDSKILEIGEGTSEVQRMIIARDLGM"
FT   gene            77705..80242
FT                   /locus_tag="Micau_0079"
FT   CDS_pept        77705..80242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0079"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: saq:Sare_0035 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43648"
FT                   /db_xref="GOA:D9T480"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T480"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL43648.1"
FT                   /translation="MTPDHDRARGPGGRTGLADLLRGHRLAVGLTQAELAGRAGVGVRT
FT                   VRDLERGRATRPQRTTVDLLADALGLSGDERREFVDTARPAASRLPAAGAAADDPPVAL
FT                   PQPVPLLGRERDVAEVSGLLDAYPVVSLVGLAGVGKTALAVTVAHAVAARHPAGVAGVL
FT                   VGEGSDAADVLAASASMFGVNRLADLSCRIGDRRALLLVDAVDRAPEPVAEALRVLTAA
FT                   VPTLRVLVTGRRPVGLAGEMVRPVAPLDVPPAGTEPADRAGLDRWPAAALFAARFAQAR
FT                   REPPTPAELPALAALVRRLGGLPLAIELMAARGRILDVTELLDRYGDRVLDLTGVRPGW
FT                   EPADPSAGTVTLRDAVATSYHLLASADRAALRRLSAFRNRWSVELAEDLLADGGRRWDA
FT                   APMLDRLRELGLLSVRGTGPFRFRLLDAVRDFAAEQADLEGETARIRMRHAAVIAGLVH
FT                   RTAPGLVGAQMSGAVHVLDEATSDITAALAYAAEHAPETALLLAASLPRWWRLRGRDVS
FT                   GRRRLRRLLADPRTAGARPTLRAWAMLGAARLAAEHGAGAEELPAARAALVVFAEAGDV
FT                   TGELSARSVLCALLLGLGAHDEAREQAEAALASATRHHRVREMAVAQAHLTWHDVREGR
FT                   LAGARRRLATVDRLAAQCGDQRLRVLARADQAELTRLEGRYAEAVEQGRRVAAALAELG
FT                   DPGRRRRTVGAVGLALAHAGRTDEALATIAELWPSGVVPGRRRPPAVEMLDPPGPGGDA
FT                   RTEDALRGLIEGHVALHRGDRELAAEWFAAAADAAEGVADRRDLVEALVGLAVSTADPA
FT                   VLDRLDAARQVTGVSLLPQEEELLFSLTARRGR"
FT   gene            complement(80524..81015)
FT                   /locus_tag="Micau_0080"
FT   CDS_pept        complement(80524..81015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0080"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: stp:Strop_0030 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43649"
FT                   /db_xref="GOA:D9T481"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T481"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL43649.1"
FT                   /translation="MDQNVFDDPRITAVGLLVEAHAGLAARFAAQFEEHGLSPVEFEVL
FT                   TRLARSPNNQLRMTDLAAQTSLSTSGVTRVVDRMERDGLICRRACPSDRRSSFAVVTTA
FT                   GLSRLDDVLPGHLRIIEQWFTSQLDPAQLDGLLDGLRRVRDAVHPGATAGSTEPVEDAA
FT                   "
FT   gene            81117..81698
FT                   /locus_tag="Micau_0081"
FT   CDS_pept        81117..81698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0081"
FT                   /product="YceI family protein"
FT                   /note="KEGG: YceI family protein; PFAM: YceI family
FT                   protein; SMART: YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43650"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D9T482"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADL43650.1"
FT                   /translation="MTSSTEATTRDWEGLTIPTPGTYVLDAAHKRVGFVARHMMVSKVR
FT                   GEFADATATITVTDDPMQSSVTASIQAASINTAQADRDAHLRSPEFLDAEQFPTLEFRS
FT                   TEVKSREGNEFVLVGELTIKGVTRQVELEVEFEGVGRSPFGQDIFGFSASTEIDREDFG
FT                   LTWNVALETGGVLVGRKVKIEIEGEAIRQG"
FT   gene            81951..83429
FT                   /locus_tag="Micau_0082"
FT   CDS_pept        81951..83429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43651"
FT                   /db_xref="GOA:D9T483"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:D9T483"
FT                   /inference="similar to AA sequence:KEGG:Sare_0037"
FT                   /protein_id="ADL43651.1"
FT                   /translation="MGRDVEQGAFSREDRVRYRQKVRRCLDVFALMLDDFGFDADRPMT
FT                   GLEIELNLIDAAAEPAMRNDQILADIADPLFQTELGQFNLELNASPRLIEGSGFADYEQ
FT                   DLRSSLSRADERAAKSDATIMMVGILPTLTERHLVADNLSTNERYRVLNDQIVGARGED
FT                   IELDINGVERLRTHTDSIAPEAACTSLQFHLQVAPDSFADYWNASQAIAGVQVAVGANS
FT                   PFLYGRQLWAETRIALFQQATDTRPDELKAQGVRPRVWFGERWITSIFDLFEENVRYFP
FT                   PLLPICEEEDPVEVLHAGGVPTLGELRLHNGTVYRWNRPVYDIMNDRPHLRVENRVLPA
FT                   GPTVVDMLANAAFYFGLARGLAESDRPIWSQLTFSSAEENFHAAARRGIEAVLHWPRLG
FT                   DVPVTTLVLDTLLPVAAQGLDRFGVAPAERDRLLGVIEGRCRTGRNGAVWQTETVWAAE
FT                   RSRGLDREAALHHMVQRYAELQRGNEPVHTWPVD"
FT   gene            complement(83634..85022)
FT                   /locus_tag="Micau_0083"
FT   CDS_pept        complement(83634..85022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43652"
FT                   /db_xref="GOA:D9T484"
FT                   /db_xref="UniProtKB/TrEMBL:D9T484"
FT                   /inference="similar to AA sequence:KEGG:Sare_0038"
FT                   /protein_id="ADL43652.1"
FT                   /translation="MVRRGWGGSTAAALGVAAGAGAAQLGFGYGLGIINWVPDGAVRAE
FT                   AAWVASLAWATWIAATSVIVGAVCAQRLRGGDDESPGTLPRLGLALAAGVGAIVTVLLV
FT                   AVPARAARVPDVSSPQAVAAAYAGAGLVLGVLLAVWALHTRAAATNLIATTGWLWLLAV
FT                   VSVVDGVIAGRGLTTAQLGIWQISADRGAFWIRDYFYWPGALLSVLSALVIGLVAARRA
FT                   ARAPEIRVGAAASGAAGPLLVALAYLLAVPRLAGIAAEQLSAHLIAPYAVIAGVGGSMV
FT                   MAALAQRAERRSAERVTVPRQRTGEPDSVDGEPAIGEDTAEPDGGSTSDRSASDLSGRT
FT                   TLPDTEPNASAGSLRDAAVDDGPGVTSGRTETDRGRATRSTTGRRGRAVPPQRQPESPT
FT                   QAGSHDKGSTADEPNPRSTTASPQGDSSSPTASPGQTGSSGQAGSSGQADPPPPTETTR
FT                   RRGR"
FT   sig_peptide     complement(84954..85022)
FT                   /locus_tag="Micau_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.862 at
FT                   residue 23"
FT   gene            85108..85797
FT                   /locus_tag="Micau_0084"
FT   CDS_pept        85108..85797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0084"
FT                   /product="PASTA domain containing protein"
FT                   /note="KEGG: lxx:Lxx03600 penicillin-binding protein; PFAM:
FT                   PASTA domain containing protein; SMART: PASTA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43653"
FT                   /db_xref="GOA:D9T485"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:D9T485"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ADL43653.1"
FT                   /translation="MIGAGSMTDERQPAGDGSGPGRGRLLLGGGVAVALLAVIGASVGW
FT                   ILAGEPERSAAPGDSAPPAAASTSASATTAPPATAAQPSGTRTSAPAGLTVPEVMGADF
FT                   EQARRDLRERRLGWRLVFGTGTGRTVERTSPAPGTPVKRGTTVTVWVSGPAPAVTVPDV
FT                   GTLSCSDAADDLVEAGLYPRYATGRQGPVTAQEPVAGGTARWNDQVTLTCGDKASAPPT
FT                   VSLPPTP"
FT   gene            85895..86749
FT                   /locus_tag="Micau_0085"
FT   CDS_pept        85895..86749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0085"
FT                   /product="PASTA domain containing protein"
FT                   /note="KEGG: stp:Strop_0033 PASTA domain-containing
FT                   protein; PFAM: PASTA domain containing protein; SMART:
FT                   PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43654"
FT                   /db_xref="GOA:D9T486"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:D9T486"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ADL43654.1"
FT                   /translation="MSDDRQEPPAGDADATRALPPDADATRAMPRDAAGHDADATRAMP
FT                   RNAAEEDVEATRAMPRNAGDATRPLPGGPAGQGGPRRPLDATTPQEPVGAWSGRAGVPP
FT                   PRPAGYPEPGSEWYGDEQAGRRWWMPILLGILALLLLGLIGAGVWLALRAADRNSDPGP
FT                   PVPSASAQTSAAPTTAAPTSAAPSSSPPSTPATTAPVEVPMPPLVGLPEAAARAALDRL
FT                   DLDYRVQRRASDRPAGTVISTDPEAGYPVGEDDRVTIVVAVPAPPTSGPSTPGSAPATT
FT                   TTP"
FT   gene            complement(86753..87214)
FT                   /locus_tag="Micau_0086"
FT   CDS_pept        complement(86753..87214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43655"
FT                   /db_xref="GOA:D9T487"
FT                   /db_xref="UniProtKB/TrEMBL:D9T487"
FT                   /inference="similar to AA sequence:KEGG:Sare_0039"
FT                   /protein_id="ADL43655.1"
FT                   /translation="MVNLPAARRHHRSRIGYALGLFLFLVTATALALAVRHPAFSATQQ
FT                   LAEPVPAPEITVAGENGRTESGTADSDTAESDAAHSDGSDDEDGWAAADPAEDEDEPAA
FT                   GAGGGEGALAERPTGATDDLSRSLFYSGLLGLAISLAGLGLVGTRRRQW"
FT   sig_peptide     complement(87089..87214)
FT                   /locus_tag="Micau_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 42"
FT   gene            complement(87319..87606)
FT                   /locus_tag="Micau_0087"
FT   CDS_pept        complement(87319..87606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43656"
FT                   /db_xref="UniProtKB/TrEMBL:D9T488"
FT                   /inference="similar to AA sequence:KEGG:Sare_0040"
FT                   /protein_id="ADL43656.1"
FT                   /translation="MLPRSGDVLHVTRAASVQFLRPIMFRVIRVLDWPTYDGWLWLDGY
FT                   ELNAAGDAVNRRSIFVLQEGLRQLQAAPAPRQHTVRTARRPAVRTPVRVG"
FT   gene            88233..89114
FT                   /locus_tag="Micau_0088"
FT   CDS_pept        88233..89114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0088"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: saq:Sare_0041 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43657"
FT                   /db_xref="GOA:D9T489"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9T489"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL43657.1"
FT                   /translation="MSERRSPTIRRRRLGAELRRQREAAGITIEVVAEQLECSASKISR
FT                   IETGHTTATPRDVRDMLRIYGVVGAESDELVQIAREARQKGWWHPYSTVLVGAYVGLEA
FT                   AASSIRAYEQQVVPGLLETEEYAGAMIRAARPDFTDEQVDQRVRVRLGRQSLLTQDDPV
FT                   DLWVVLDEAVLSRPVGGDVVMRGQLKRLVEVAELPNVTVQVLPFEVGAHAGMDGTFTIL
FT                   SFPEPSDPDVVYAENATGGLFLEKSDELQKYSFIFDHIRAAAMRPEESIAHIAKLAEEP
FT                   LWKWRPRSSPWT"
FT   gene            89084..89305
FT                   /locus_tag="Micau_0089"
FT   CDS_pept        89084..89305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0089"
FT                   /product="protein of unknown function DUF397"
FT                   /note="KEGG: saq:Sare_0042 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43658"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D9T490"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ADL43658.1"
FT                   /translation="MATKEFPVDLTQATWFKSSKSGPNCDNCVEVAYVTGAVGVRDSKD
FT                   KTGPALVFAPGDWHAFVARARNGVFGRS"
FT   gene            89455..89853
FT                   /locus_tag="Micau_0090"
FT   CDS_pept        89455..89853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43659"
FT                   /db_xref="UniProtKB/TrEMBL:D9T491"
FT                   /inference="similar to AA sequence:KEGG:Sare_0043"
FT                   /protein_id="ADL43659.1"
FT                   /translation="MTTIGSENLTSGPGKPERFGGKYRGARRDTVLTEVVSGDGEDARE
FT                   SGVPEQATAPLSLPSLDPNPLTEPSFPPSGWPVEQQESLVDHPLLRGLLMELPPKGSVP
FT                   PPGWLDRWFEATRAILELLYVQGASRSR"
FT   gene            complement(89821..90423)
FT                   /locus_tag="Micau_0091"
FT   CDS_pept        complement(89821..90423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0091"
FT                   /product="uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="KEGG: uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43660"
FT                   /db_xref="GOA:D9T492"
FT                   /db_xref="UniProtKB/TrEMBL:D9T492"
FT                   /inference="similar to AA sequence:KEGG:Sked_22090"
FT                   /protein_id="ADL43660.1"
FT                   /translation="MDDRLALLLPVAAVWLAAGLVAEGLPGLDRARALRRRTGWLSVLV
FT                   LTGLALTAAVLAAGLQSAGDTTVDRAAAALGVAAVPAAVVAVCTVRRVRRLRSGAGAFA
FT                   AAPETPAPHGLRAAAAHPLIALPLQATAIAVLVAVLPAIGVDLFTAPGVAGPVITVGVL
FT                   GVCTIGVRHALRHNRLAERAMPAAEAVSARPARALHV"
FT   sig_peptide     complement(90355..90423)
FT                   /locus_tag="Micau_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.912 at
FT                   residue 23"
FT   gene            complement(90510..91316)
FT                   /locus_tag="Micau_0092"
FT   CDS_pept        complement(90510..91316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0092"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: stp:Strop_0040 WecB/TagA/CpsF family glycosyl
FT                   transferase; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43661"
FT                   /db_xref="GOA:D9T493"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D9T493"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADL43661.1"
FT                   /translation="MTTGTKRNVLGVGVDATDYARATEAVVAAAHERRPLALTALAVHG
FT                   VMTGVLDPAHNARLNSFDVVTPDGQPVRWALNLLHGAGLTDRVYGPELTLRVLARFAEE
FT                   GLPVYLYGSTEETLSRLVPALERKFPALKVAGVEPSKFRAVAPGEDAEIADRIRASGAR
FT                   LVLVGLGCPRQEVFAYAMRPLLDMPLMAVGAAFDYHAGLLRNPPPWMQRAGLEWFWRLG
FT                   LEPKRLWRRYVILNPAYLARLAAQKTGLWKANPPAPATGRPATFDV"
FT   gene            complement(91313..92386)
FT                   /locus_tag="Micau_0093"
FT   CDS_pept        complement(91313..92386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0093"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sna:Snas_0259 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43662"
FT                   /db_xref="GOA:D9T494"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T494"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADL43662.1"
FT                   /translation="MTVALVTGSGGLIGSEAARHFAGLGLDVVGIDNDMRRYFFGEDGS
FT                   TAWSLDRLAADLGSAYTHHAVDIRDRDGLEQVFKRYGKDIAVVIHSAAQPSHDWAAKEP
FT                   FTDFDVNAGGTLNVLENTRRHAVDAPFIHCSTNKVYGDRPNSLPLIELETRYELPEDHR
FT                   WYDGITEDMSIDESLHSIFGASKVASDVMVQEYGRYFDMRTACFRGGTLTGPAHSAAEL
FT                   HGFLAYLMRCVMEGRTYNLFGYKGKMVRDAIHSHDVLTAFEAFFREPRSAQVYNLGGGR
FT                   HSNTSHIEAFRVAQEITGREARINYVEQARTGDHQWYVSSMARFEEHYPSWKITYDVPM
FT                   ILREIYEANADKWVPKA"
FT   gene            complement(92494..92579)
FT                   /locus_tag="Micau_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(92494..92579)
FT                   /locus_tag="Micau_R0003"
FT                   /product="tRNA-Leu"
FT   gene            92816..93577
FT                   /locus_tag="Micau_0094"
FT   CDS_pept        92816..93577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0094"
FT                   /product="Forkhead-associated protein"
FT                   /note="KEGG: saq:Sare_0047 FHA domain-containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43663"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D9T495"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADL43663.1"
FT                   /translation="MSVLQRFEKRLEGLVEGAFAKVFKGVVHPVEILNAMQREAEAHKA
FT                   ILAGGRTLVPNRYVIDLSPYDHSRLAPYAAALAQELAQSQAEFIGEQAWTVYGDVIVEV
FT                   ERGEGLDTGMFRVTAEVYTGGDVAPVSAPGGYDAGPAYPAYDQGGGYGPPPGHGGGRNV
FT                   RLVSGDGRTYPLQMGSTVIGRGDQANLRLPDVGISRRHARLDFDGGQVVLTDLGSTNGT
FT                   MVNGQRVSAVALNPGDMIQLGTTTLTFRVDG"
FT   gene            93584..94069
FT                   /locus_tag="Micau_0095"
FT   CDS_pept        93584..94069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0095"
FT                   /product="Forkhead-associated protein"
FT                   /note="KEGG: stp:Strop_0043 FHA domain-containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43664"
FT                   /db_xref="GOA:D9T496"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D9T496"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADL43664.1"
FT                   /translation="MPELVITVARFGFLILLWIFVFTVVGVIRRDLFAGARSGRLVAAP
FT                   RGIGASTGQPGKPAKAKRGRAAHQLVVTAGQLAGTRITLGEAQITIGRAEDSTLVITDD
FT                   YASARHARLVPRDGQWYVEDLGSTNGTYLDRAKVTGPTPVPLGVPIRIGRTSLELRP"
FT   gene            94066..95502
FT                   /locus_tag="Micau_0096"
FT   CDS_pept        94066..95502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0096"
FT                   /product="Protein phosphatase 2C-like"
FT                   /note="KEGG: saq:Sare_0049 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43665"
FT                   /db_xref="GOA:D9T497"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9T497"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADL43665.1"
FT                   /translation="MTLTLRYAAHSDRGLIRDGNQDSVYAGPRLLAVADGMGGMAAGDV
FT                   ASNIVIGAMAPLDEDVPGDALVDALRSAVGTANQQLRDTVDANPQLEGMGTTLTATLFS
FT                   GSKLGMVHIGDSRAYLLRNGEFAQITKDDTYVQMLVDEGRISAEEASSHPQRSLLTRAL
FT                   DGRDIDPEYSVRQVLPGDRYLICSDGLSGVVSAETIADTMREYPDPQRCVERLVQLALR
FT                   GGGPDNITVIIADATDQDIVEASPIVGGAAARDRGMATSADDSTPAARASALSAPRPPA
FT                   PEEPADNRDDEPERRRRRPLRTVAMVLALAVIVGGGAFGGWTYTQRQFYVGATDDGQLA
FT                   VFRGVPGQVAGLDLSNVHERSEARLDDLTLAAQERVKQGIQARNEPDAERRLAELTSED
FT                   PANPNLKPLCPPDPSPGATSPSPAAGGLNPQVSGSPAPSVPPAGSPSPGASTPLTTITP
FT                   DAVPSDTVPPADPAGCRSPE"
FT   gene            95531..97021
FT                   /locus_tag="Micau_0097"
FT   CDS_pept        95531..97021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0097"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: saq:Sare_0050 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43666"
FT                   /db_xref="GOA:D9T498"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D9T498"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADL43666.1"
FT                   /translation="MTAAAVPAASPASTGEESGVRLARSRRNAELSLLLLAMVLVAAYA
FT                   AMIEAKALDTITPDFWIPAAALGLVFLGLHLVIRWLAPYADPALLPAVALLNGIGVGFL
FT                   RRYDLAKATPAEREDLAVFAGTGGRQLAWTLAAVVLAAALLAILRDHRSLSRYAYTLGL
FT                   AGIVLVMIPAVLPSRFSEINGAKLWIKFGGFSIQPGEFAKLALLTFFAYYLVRKREVLS
FT                   LASRRVLGIDFPRGRDLGPVLVVWLVSLLVLIFEKDLGTSLLYFGMFVVTLYIATERVS
FT                   WLLIGLILFFGGAYLAYVLGSTVGGPFANFYDRAQIWLDPFAEPYDRGYQLVQGLLTLG
FT                   TGGLFGAGPGGGQPALLPEVQTDFIFAGIGEEIGLFGLSALLVIYLLIVERGLRAALAV
FT                   RDSFGKLLAGGLAFTLGLQVFVIVGGISKLIPLTGQTTPFLSAGGSSLMANWLLIALLL
FT                   RVSDGARRPVTGGGGPAARPAGGPPEQLHGAPTEVIRP"
FT   gene            97018..98526
FT                   /locus_tag="Micau_0098"
FT   CDS_pept        97018..98526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0098"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: stp:Strop_0046 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43667"
FT                   /db_xref="GOA:D9T499"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D9T499"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADL43667.1"
FT                   /translation="MNAPLRRVGVVVMVLFGLLFANLNWIQAYKADEYRNSDYNGRVQV
FT                   AEYDRKRGNIEVGGTAYAVSKETGGELKYQRTYPGGAMYAHVLGWKPVNGSASGIERVE
FT                   NDFLAGTSDALIASRIKDMFTGDETGGGNVLLTLSKRAQETAYKQLNDNQVGATKGAAI
FT                   AIDPRTGAVQALVSMPSFDPNPLASHNSTEADRAYNTLEKDKDRPLANRALSETLPPGS
FT                   TFKIIMAAAALENGVGQQTRIPAGSSYTAPGAGQPIRNAAPSICPESQVTLREAVTESC
FT                   NTGFAQLGVRLGSDKVKEKAKQFGFEQEDLTVGQLGEGGLPVAASRTGDMQNPDGSTDQ
FT                   AALAQSSIGQNNVRMTPLQGAMIAAAVANKDGKQMRPYLVKQLLGPDRTTVYDAAQPRE
FT                   LRRPISGQVAADLRDMMQNVVKEGTGRRAAIDGFLVGGKTGTAQSGPNTPDHGWFIGFA
FT                   LDKDGTPLSAVCVELEQAGSGGSAEAARIAGRIMAAAIADSGRR"
FT   gene            98528..99913
FT                   /locus_tag="Micau_0099"
FT   CDS_pept        98528..99913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0099"
FT                   /product="Serine/threonine-protein kinase-like domain"
FT                   /note="KEGG: saq:Sare_0052 serine/threonine protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43668"
FT                   /db_xref="GOA:D9T4A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADL43668.1"
FT                   /translation="MLGPGVKLGNRYRLDERIASGGMGDVWRGTDQVLGRTVAVKSLLP
FT                   ALLDEPGFAERFRGEARTMATINHPGVVDVYDFGSDQHIAFLVMEYVEGDALSATLSRV
FT                   GRLTPARTMALLAQAADALHAAHEKGIVHRDVKPGNLLVRPNGTLVLTDFGIARSDLVG
FT                   QLTAAGSVLGTASYISPEQATGAVATPASDVYALGVVAYQCLAGRRPFEGDNPLEIAMK
FT                   HVRDTPRALPADIPPQVRAIVERAMAKDPAARWPSAAALASIARQAKLALSQAARSGHP
FT                   ISGVPASPAAPVARAQVPTAAPRPQPPAAAPRPQPRPPVSPARPPVAAPRPAVIAHPAP
FT                   QPRPPVAPRGAAPVPQPRPVPQHNPLGYARPPAAAPPRRSRSGLWTTAIVVAVLVILCS
FT                   GVISFLYRKYGATASASASVSVTSGAVQPYGGDYPVRTSYRREVRLLPAGGGTTTSEGR
FT                   ETR"
FT   gene            99910..101739
FT                   /locus_tag="Micau_0100"
FT   CDS_pept        99910..101739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0100"
FT                   /product="Serine/threonine-protein kinase-like domain"
FT                   /note="KEGG: saq:Sare_0053 serine/threonine protein kinase
FT                   with PASTA sensor(s); PFAM: Serine/threonine-protein
FT                   kinase-like domain; PASTA domain containing protein; SMART:
FT                   PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43669"
FT                   /db_xref="GOA:D9T4A1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADL43669.1"
FT                   /translation="MTAQARLLGGRYQVGELLGYGGMAEVHRGRDLRLGRDVAIKMLRA
FT                   DLARDATFQMRFRREAQNAASLNHPAIVAVYDTGEETAPTGETLPFIVMEFVNGRTLKE
FT                   VLGVEGRLQPRRALEICADMCAALEFSHRHGIIHRDIKPGNVMLTQTGQVKVMDFGIAR
FT                   ALASGATTMTQTSAVIGTAQYLSPEQARGEAVDARSDVYAAGCVLFELLCGHPPFVGDS
FT                   PVSVAYQHVREQPPTPSTINPDVNPAVDAIVLKALSKNPLNRYQSAGEMRADLLRAAAG
FT                   RPVLATPVMPAEETMPMGAAAGGYHQAQQTQMMGPQTRQQPVARVGDPGKRKSSSWVIA
FT                   AFAALGVLAVIALGTALWLNQAGAEKVSVPELVDSTQAEAQAALTRAGLRYVNGDPVQN
FT                   TECKKGTVVNQSPGPGLRVEKNTAVSVQICAGPGQVTIPKGLEGSQVANVQAQLQALGL
FT                   KVEVERVDDSAQKDIVINVEPSEGSTVAEASTVKLRVSRGNVAEVPDVVGLSEDQAVRQ
FT                   LQNAGYKVRVLDGEEVTEPDKVGRVSRQSPKSGSSYAREKQVTIYVDVAAPEQSESPTP
FT                   PSATPSGTPSMPPGGGGGGGLPIPTAPPTRSNG"
FT   gene            complement(102197..102328)
FT                   /locus_tag="Micau_0101"
FT   CDS_pept        complement(102197..102328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43670"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL43670.1"
FT                   /translation="MIRRLLQAMDPQLLTTAISVWLASRATATISTAGRAIAVESPI"
FT   sig_peptide     complement(102242..102328)
FT                   /locus_tag="Micau_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.735 at
FT                   residue 29"
FT   gene            complement(103895..104545)
FT                   /locus_tag="Micau_0102"
FT   CDS_pept        complement(103895..104545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0102"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: stp:Strop_0049 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43671"
FT                   /db_xref="GOA:D9T4A3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A3"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADL43671.1"
FT                   /translation="MRVLVIDNYDSFVFNLVQYLGQLGADCEVRRNDEIDVAEVGRVGA
FT                   AGVLLSPGPGSPDRAGICLDVIREYAGKLPIFGVCLGHQAIGEAFGATVARAPELLHGK
FT                   TSEVRHDGVGVLAGLPDPFTATRYHSLAVLPETLPDELEVTGRTASGVVMAMRHRTLPI
FT                   EGVQFHPESVLTEGGHLMLANWLAACGFPAALERAPELAAEVDARRRAAFATT"
FT   gene            complement(104551..104823)
FT                   /locus_tag="Micau_0103"
FT   CDS_pept        complement(104551..104823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43672"
FT                   /db_xref="GOA:D9T4A4"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A4"
FT                   /inference="similar to AA sequence:KEGG:Strop_0050"
FT                   /protein_id="ADL43672.1"
FT                   /translation="MYSWIWRKLPFGLPGKLVGSLVLATATVALLWFVVFPWAEPLLPF
FT                   DDVQVTQDSGVPGDGGITEPTGLPGEEELPYSTETNNAPPSTPNR"
FT   sig_peptide     complement(104704..104823)
FT                   /locus_tag="Micau_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.917 at
FT                   residue 40"
FT   gene            complement(104827..105726)
FT                   /locus_tag="Micau_0104"
FT   CDS_pept        complement(104827..105726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0104"
FT                   /product="sortase family protein"
FT                   /note="KEGG: stp:Strop_0051 sortase family protein;
FT                   TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43673"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A5"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADL43673.1"
FT                   /translation="MLPAVTRPPADPHLDATGLMGAVPPAPDTGDGDGGAEPPAEPPRP
FT                   RRGERVVQLRPEQTGDGYRSVYSELTRPTVGSRLRTVVRGTGELLITFGLVVLLFAGYE
FT                   IWGKAVIVEAHQSDLNSQLAQEWDAAADPTVGPTTGPTVKPKPPAEGRPVAGLYIPKFD
FT                   KHWVVVEGVSPEDIRYAPGHYPDSAMPGEVGNFSVAGHRIRSTFWRLDELKTGDAIVVE
FT                   TRTDWLVYRVYQQRIVKPSQVEVVAPVPGKPEAKATEKLLTLTTCNPKFDNYQRLIIHA
FT                   RLDHTQAKSAGRPAELEA"
FT   gene            complement(106518..107324)
FT                   /locus_tag="Micau_0105"
FT   CDS_pept        complement(106518..107324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0105"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   saq:Sare_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43674"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A6"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADL43674.1"
FT                   /translation="MEYTSGAASWQKVLRRAAAALLPRRARQRRPGWSVGVPLIAAAAG
FT                   LLFTTTATTAGGTSLREDRRPQLTQLIEDRREEVAASEAKAARLRAEVEEQTEALAGAD
FT                   GPIKTERDRAAASRQGAGFTALTGSGVTVELNDADRRPDQPLPKGASNDDLVVHQGDVQ
FT                   AVVNALWAGGAEAMSIMNVRVLSTSAVRCVGNTLLLHGRVYSPPFKIVAIGDPAELQRA
FT                   LAASEGVRVFKEVADHYQLGYVERVSTVTVPAFEDSTALQSATVPR"
FT   gene            107555..107818
FT                   /locus_tag="Micau_0106"
FT   CDS_pept        107555..107818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0106"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   stp:Strop_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43675"
FT                   /db_xref="GOA:D9T4A7"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A7"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADL43675.1"
FT                   /translation="MPKSQVRKKKVYTPPTDVRPTATASTRKPSPIWLPVTAVTLIVAG
FT                   IGWLVLYYLSEQAYPVASWGYWNLAVGFGAMVSSLILLSRWR"
FT   gene            107999..110197
FT                   /locus_tag="Micau_0107"
FT   CDS_pept        107999..110197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0107"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: saq:Sare_0059
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43676"
FT                   /db_xref="GOA:D9T4A8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A8"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADL43676.1"
FT                   /translation="MGSVQIVTTILAAAITAVAVWLAVRAVMKMTAVIRLGQPAPERFG
FT                   DKGARTKKMLVETAGHTRMLKWSVVGAAHWFVMVGFIVLSLLVLEAYFEVVSTGGGLPI
FT                   IGHWTIFGLVTEWIGILGLVGILVLMAIRLRNRPGRAENRSRFTGSTMWQGYFVEWVVL
FT                   LVLIFGFVIRGFKVATDHFEYPVWAAPLSHAVGSVLPDWEAGVSVAALIKIAISMTWLI
FT                   VISLNVTMGVAWHRFLAFPNIFFKRDPEKPAGSGLGPLRPMTSEGKPLDFEEADPEKDQ
FT                   FGVAQVEQFTWKGLLDFSTCTECGRCQSQCPAWNTGKPLSPKLLVLSLRDHAYAKAPYL
FT                   LAGGGKDLTGEEKATQEQLAGVDVLAMAEADRPLIGTAEEGGVIDPDVLWSCTTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVLIESSFPSEAGVMLRNLENKGNPWGAPQNTREDWTKGL
FT                   GFEVPRVGEVDDFEYLFWVGCAGAFEDRAKKTTRAVATLLNEAGVKFAILGEGETCSGD
FT                   PARRIGNEFVFQMLAQQNVETLNEAFEGREKSKRKIVATCPHCFNTLGNEYGQLGGEFE
FT                   VVHHTQLLAHLVSAGKLTPVQPVDGGVTYHDPCYLGRHNRIFAAPREVLGDSIQGELTE
FT                   MPRNSERSFCCGAGGARMWMEEKIGKRINVDRVEEAMSTGAKTIAVGCPFCSTMLNDGV
FT                   NGKGAGEQVEVVDVASVLLRSVKPEAPAGEPEVAPTAS"
FT   gene            complement(110265..110999)
FT                   /locus_tag="Micau_0108"
FT   CDS_pept        complement(110265..110999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0108"
FT                   /product="Golgi phosphoprotein 3"
FT                   /note="PFAM: Golgi phosphoprotein 3; KEGG: ami:Amir_0084
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43677"
FT                   /db_xref="GOA:D9T4A9"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4A9"
FT                   /inference="protein motif:PFAM:PF05719"
FT                   /protein_id="ADL43677.1"
FT                   /translation="MRVIVARARRWRTPRSVVRMDGLLLTDELVLLAYDDGGTNRLGSP
FT                   HLGYGLAGAVLLELALAGRVEVADKRLVVTDPTPTGVPLLDEALTTVGSGRPRKPKDWI
FT                   GKLAKGLPERVLGGLVDAGVLRRESDRVLLVFPRTRYPSPTGAEPAVETAARERMAAAL
FT                   TGDGPVDARTAALLTLTRAVGLDRKIFRELPKERVKARIDEIAAGDWASAAVKKAIEEM
FT                   QAALMVAMTAGTSAAIMTTTTS"
FT   gene            111025..112332
FT                   /locus_tag="Micau_0109"
FT   CDS_pept        111025..112332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0109"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: sna:Snas_6404 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF21; CBS
FT                   domain containing protein; transporter-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43678"
FT                   /db_xref="GOA:D9T4B0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B0"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADL43678.1"
FT                   /translation="MPLVGFVLLTAGNAFFVAAEFALVTVDRAEIDRRADEGDGRAATV
FT                   RRALRELSFQLSGAQLGITLTALLTGYLAEPALARLFAPLLHSLGGAERFSGLLALALA
FT                   TLISMLFGELVPKNLALARPMPAALATAAPMRAFSRTFGWLIRLLNESANRLVRRLGVE
FT                   PQEELASARSPEELGLLAAISARAGALPPDTAMLLRRTIRFGDKRAAEAMTPRVDVTAL
FT                   RATTTVAELLEASRRTGRTRFPVYEETLDLVTGVAGVPDALGVPLARRAATTVAAVARE
FT                   PVYVPESLNLNGVLAALKAAGADLAIVVDEYGGTDGVVTVEDLVEELVGEIADEFDPDA
FT                   VDGFGPVELTVPGGERTVLTDGVLRADELVEQTGFRLPDGPYETLGGFLMARLGHIPVP
FT                   GEAVDEAGYEFTVVEVDRHRIEQVRVVRPEEPDGGA"
FT   gene            112325..113329
FT                   /locus_tag="Micau_0110"
FT   CDS_pept        112325..113329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0110"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; KEGG: sna:Snas_6403 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43679"
FT                   /db_xref="GOA:D9T4B1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B1"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADL43679.1"
FT                   /translation="MPELLVAVGLLLGNAFFVGSEFALIASRRTVIEPLAATSKRARLA
FT                   LAAMNQIPLMIAGAQLGITVCSLGLGAIAEPALAHLLEPAFAALGLPASAVHPVSFVIA
FT                   LAVVVFLHTVVGEMVPKNITLAGPEPSALWLGPAMLAFCLATKPLLLAMKWASRQVLRW
FT                   WRVEATDAVKTVFTAEELAGLVSQARTEGLLDAEEHARITGALALHSRTAADALQPWST
FT                   VTTVAEDVSPASLEVLATRTGRSRFPVVQRATRRVLGFVHVKDVLGYAGASRRAPVPAE
FT                   IYRPLAVVPPDRTLADLLLAMRRERRHMVLVSDGRRPMGVVTLDDVLTAIVGR"
FT   gene            113500..114510
FT                   /locus_tag="Micau_0111"
FT   CDS_pept        113500..114510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0111"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: saq:Sare_0060 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43680"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B2"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL43680.1"
FT                   /translation="MATTPPQRHAPSAPPGRRAGFRRVVHGLVTLVAAAAVGAGMLTAP
FT                   AHAAPSVDEIDAQIDKQWQQLEPTIEQFNKVRSQLRANQKKSKALKDKMVPLELASTLA
FT                   MNKVGDIAARYYIQGPSQELGALLVNSKPGALAEQLVMLDRIAEDQRRQIAGVLKVRDE
FT                   YNKQKEKLDALIALEIKQQNDLAAKKKQIDSEIKRLTAMLPVTSIRPAGCPAVDGVVSS
FT                   AARTAIKTACAQVGDPYVWGATGPNSFDCSGLTQYAYKAAGISLTHFTGAQWNEGRRIS
FT                   RSEARPGDLVFFGSDLHHVGLYLGNGVMVHAPRTGKPVQVSSISTMPIAGFVRVA"
FT   sig_peptide     113500..113646
FT                   /locus_tag="Micau_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.919 at
FT                   residue 49"
FT   gene            complement(114581..116614)
FT                   /locus_tag="Micau_0112"
FT   CDS_pept        complement(114581..116614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0112"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="KEGG: sro:Sros_8138 negative regulator of
FT                   beta-lactamase expression-like protein; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART:
FT                   N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43681"
FT                   /db_xref="GOA:D9T4B3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B3"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADL43681.1"
FT                   /translation="MHLSAPPSGRRILLAAAVATATALATTGPVTAAPDTSAPASDRQQ
FT                   QYAAAAAEYGVPQNVLLGVSYLESRWDTHTGQPSTSGGYGPMHLTDAAHILAMPGSAHV
FT                   DEDEDPRGDDSRPLKLDPATAAAPKRETPLPPASLQTLDAAAALTGLDAGTLRTEPAAN
FT                   IRGGAALLASYQKALGGPVGAGTDPAAWYGAVARYSGADTSDAAAAFADEVYDQLGQGA
FT                   SRTTDDGQRVTLAATAAKPDRSRLARLGLRNAERPDGLECPVRLACEWIPAPYEQLSDD
FT                   PGDYGNHDLGDRPKQQKIEYIVIHDTEGYFGPSVDLVKRADYLGWHYTLRSVDGYIAQH
FT                   IKTKDVGWHAGNWYVNAKSIGLEHEGFAGQGTWYTEAMYRTSAKLVRHLALKLGIPMDR
FT                   QHIIGHDNVPGINAGAVGGMHWDPGPYWDWSHYFDLMKAPFRSTGTPRTGLVTIDPDFA
FT                   TNRPAFFGCNQQPPGVPTPRPPAEPCPSRGSSSVILRTAPSPDAPLVNDLGLRPDGTPD
FT                   TMYISDHGARASAGQTYALAGRQGDWTAIWYLGQKAWFLNPASAPTAKWATGFVVTPRP
FT                   GKATIPVYGRAYPEQAAYPDTIPYQTISPLQYTFAAGQRYAVGGVLPGEYYRAVSFDGS
FT                   APGDRTVVRGENRYVQVQFGHRIMFVNLDDVLILPSPVGAPR"
FT   sig_peptide     complement(116516..116614)
FT                   /locus_tag="Micau_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.990 at
FT                   residue 33"
FT   gene            117001..118032
FT                   /locus_tag="Micau_0113"
FT   CDS_pept        117001..118032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0113"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: stp:Strop_0055 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43682"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B4"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL43682.1"
FT                   /translation="MALHAPRPSSSRSVDRSTAVPRTRWSRFTTALAALVGTAVILTGG
FT                   ATAAHAEPSVAEIEAQIDRDWNKLEPVIEQVNAVREQLAARRKQADALGRQIAPLQARV
FT                   DAALGQVGGLAADAYKGDNLSTVNALLGSRSPGDLVNGLELLDRFAHRQHEQVRSVAAL
FT                   RDELAAKKKPLDEMIAGLARTEAQLAAKKKQIDAEIARLQKLRLKVYGNGGGGPLRPAP
FT                   CPAGYPGGAAGAAVKFACAQIGKIYVWGAAGPDHFDCSGLTLAAWAKGGVSLPHNARQQ
FT                   HGMTKRVSRAELRAGDLVFYYSDLHHVAMYVGDGWVVHASQSGKPITMKRVDDGDINSY
FT                   GRV"
FT   sig_peptide     117001..117156
FT                   /locus_tag="Micau_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.956 at
FT                   residue 52"
FT   gene            complement(118097..118675)
FT                   /locus_tag="Micau_0114"
FT   CDS_pept        complement(118097..118675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0114"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: stp:Strop_0056 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43683"
FT                   /db_xref="GOA:D9T4B5"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B5"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADL43683.1"
FT                   /translation="MLLSDRDLVSEIKAGTLALEPFEPTLVQPSSIDVRLDRLFRVFNN
FT                   HLYTHIDPSIQQDDLTSMVEVPEGQPFVLHPGEFVLASTLEVISLGDQLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVANLPITLWPGMKIGQLCIFRLSSPAEHPYG
FT                   SAVYGSRYQGQRGPTPSRSWQSWRTWPTR"
FT   gene            118754..119299
FT                   /locus_tag="Micau_0115"
FT   CDS_pept        118754..119299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0115"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: stp:Strop_0057 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43684"
FT                   /db_xref="GOA:D9T4B6"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B6"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADL43684.1"
FT                   /translation="MASWSEFAADEPRLADEIRLLMQQYGPGFGYLATVRADGGPRVHP
FT                   VSPVFTADGLWCFVIDSPKRRDLERDGRYALHSFPPEESDDEAYVAGRARPVTDPATVA
FT                   RLARIGRASPQGDWRLFEFTVEAAMLTRRDPVGQPGAAPPQVRVWLDPRGAEPARRDPL
FT                   AAEGRRGRHGFDTRRPAA"
FT   gene            complement(119369..120361)
FT                   /locus_tag="Micau_0116"
FT   CDS_pept        complement(119369..120361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43685"
FT                   /db_xref="GOA:D9T4B7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B7"
FT                   /inference="similar to AA sequence:KEGG:Sare_0063"
FT                   /protein_id="ADL43685.1"
FT                   /translation="MGLRPNLLTRRTAGVATSTLALLLSTAAVGVVPAASAFSAAPAGV
FT                   CAEPADAHADEHANARVAKGGNAKLDPNHLTAKQVRDREADLAAAQRERASFRTGAVAP
FT                   LATVTIPVVVHVIQENSTRAGGNITDSMINQQITVLNQSYAGSTGGAATAFGFQLTKIN
FT                   RVTNPSWYPIVQGSSAERSMKTSLREGGKNTLNIYLGELSNGLLGWATFPKRTLDKMDG
FT                   VVVLNESLPGGTATNYNQGDTGTHEVGHWLNLYHTFQGGCSGSGDSVSDTPAEASPAYQ
FT                   CPTGRDTCSTAGKDPITNFMDYTYDSCMYQFTAGQASRMLTAWNAYRAA"
FT   sig_peptide     complement(120242..120361)
FT                   /locus_tag="Micau_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.650 at
FT                   residue 40"
FT   gene            120606..120679
FT                   /locus_tag="Micau_R0004"
FT                   /note="tRNA-Gly1"
FT   tRNA            120606..120679
FT                   /locus_tag="Micau_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(120770..121018)
FT                   /locus_tag="Micau_0117"
FT   CDS_pept        complement(120770..121018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_2919 DivIVA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43686"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B8"
FT                   /inference="similar to AA sequence:KEGG:Tcur_2919"
FT                   /protein_id="ADL43686.1"
FT                   /translation="MARLPNGEVLVGQAPQIIKAFDIKSLGDVLLPWRIIERGIRGVTL
FT                   LVARDADGAGGAQQGPQPETTTGTANQGEPPQPSAGP"
FT   gene            121169..121588
FT                   /locus_tag="Micau_0118"
FT   CDS_pept        121169..121588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_5747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43687"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4B9"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_5747"
FT                   /protein_id="ADL43687.1"
FT                   /translation="MQLRLKYAPVPENAARFAGDIVVSAAQVSGVHLDYTPDSLAAVDA
FT                   ILDGFRAEGLAAGQVAETLFGFGCYVGEVLTRHAGGRWRATTADELAVVGWPMVVELAG
FT                   QGWCNPIAKAFKRLENGPEDSLRYFYAVFAPGGAR"
FT   gene            122206..122448
FT                   /locus_tag="Micau_0119"
FT   CDS_pept        122206..122448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43688"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C0"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_2335"
FT                   /protein_id="ADL43688.1"
FT                   /translation="MAAELTRDEAIALVERIMSVDYADDGELGGWLDQLERDLACPGGY
FT                   VSNLIYWSDPELTAVEVVDRALAYQPLQMRSTPWT"
FT   gene            complement(122509..123246)
FT                   /locus_tag="Micau_0120"
FT   CDS_pept        complement(122509..123246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_3115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C1"
FT                   /inference="similar to AA sequence:KEGG:Sros_3115"
FT                   /protein_id="ADL43689.1"
FT                   /translation="MIPDRTEVSDLLEKALAGAAATFQGMTAHRQESNCECHWGSAEEL
FT                   ALLKTPDVPLDEDLLRRTYWATDWRYPGPLLRRILPQLTRSLVAGRVMPMAGMESLGYL
FT                   FTTARWQEWPKGQRDALREFLDAWWLHALVEPDAKVPAHEALELIAEITGKLTPWLAVW
FT                   TESLADAVARRRLVTAVEEWVDDLVVDRLPWSSWHKEDTWGAALSLWVIRHAPTPLREH
FT                   NASSDVLDYIGLLALPYADRWDK"
FT   gene            123362..123907
FT                   /locus_tag="Micau_0121"
FT   CDS_pept        123362..123907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43690"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C2"
FT                   /inference="similar to AA sequence:KEGG:Sros_0198"
FT                   /protein_id="ADL43690.1"
FT                   /translation="MTPDASPTVDRLAGLFDWDGATETEIDWTALTEAAGHPFPEDYRR
FT                   FVERLPHGSIGFLEVLHPSDWGVPEFLRYARNWHHVMNKRAECTGGFPYHFGTSPGDLR
FT                   VWGAVNFDYLLCWHLDDGPPEQWPTVVCDTALIDPPEPYAGTATALLVEIAELRNPVPV
FT                   IGYVTEIDGVPFRLVRHE"
FT   gene            complement(123885..124187)
FT                   /locus_tag="Micau_0122"
FT   CDS_pept        complement(123885..124187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dia:Dtpsy_3245 DNA-directed RNA polymerase,
FT                   beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43691"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C3"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3245"
FT                   /protein_id="ADL43691.1"
FT                   /translation="MDFVELVIDGQIDIDRDDLEDALNEALVGRGEVTGAGTSEHGSHL
FT                   DVDVLATADRRAVLDAVFGVLAALDLGDSVRVRPGDGQTWIRPGQWTRSTRAGRA"
FT   gene            124265..124876
FT                   /locus_tag="Micau_0123"
FT   CDS_pept        124265..124876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0123"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: nml:Namu_1616 bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43692"
FT                   /db_xref="GOA:D9T4C4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C4"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADL43692.1"
FT                   /translation="MGKLIVTEFLTLDGVAQAPGEPDEDREGGFSHGGWQMPLLDEKSG
FT                   AVMFQQASSMDALLLGRKTYDIFAGYWPKAPADIPFTGLLNGVPKYVASRTLAEPLTWT
FT                   NSSLVKGDLAERVTEMNGRHGEVHVIGSLDLVQSLLRLGLVDRLNLWVYPVVLGTGKRL
FT                   FGEGTVPSALRLTESVTHAHGTLQLTYEPAGAPTYGDAAA"
FT   gene            complement(124855..125421)
FT                   /locus_tag="Micau_0124"
FT   CDS_pept        complement(124855..125421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0124"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: sna:Snas_3209 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43693"
FT                   /db_xref="GOA:D9T4C5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C5"
FT                   /inference="similar to AA sequence:KEGG:Snas_3209"
FT                   /protein_id="ADL43693.1"
FT                   /translation="MPELERLAAHHAPAVLRFERENRAYFARYVPDRGDDFFTGYAARH
FT                   AALLDEQERGTCHFHVLVGDHGAVLGRFNLVDVAGGSAELGYRVAERAAGRGLAGEGVR
FT                   HVCELARTEYGLRRLVASAALANPASLAVLKRAGFVLDGSVRGDSVHDGSVRSGSVSGC
FT                   EVDLNGEPGLRHVLDLGAPYAAASP"
FT   gene            complement(125431..125826)
FT                   /locus_tag="Micau_0125"
FT   CDS_pept        complement(125431..125826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0125"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sro:Sros_0848 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43694"
FT                   /db_xref="GOA:D9T4C6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADL43694.1"
FT                   /translation="MHNHLVTVTGFDHLVLSVSDVERSLDFYCSTLGLAPVRVDRWRAG
FT                   EVPFPSVRVDASTIIDLIKGDPTGSNVDHFCLVVEPVDWQRVVDSGVFTVLTGPVPRFG
FT                   ARGTATSIYVSDPDGNTIELRCYPADA"
FT   gene            125915..126808
FT                   /locus_tag="Micau_0126"
FT   CDS_pept        125915..126808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0126"
FT                   /product="LysR substrate-binding"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sro:Sros_0846 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43695"
FT                   /db_xref="GOA:D9T4C7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADL43695.1"
FT                   /translation="MLERYEVETFLTLAEELHFGRTAERLRVSTGRVSHVVRKLERRIG
FT                   APLFERTSRVVRLTPIGARLVEEMRPLVAGIEAAVQRAVDAGRGLTGELRVAYVGESTA
FT                   PVLLRAVALFTERHPDCEVHVHEAPLASTRSSLLDGTIDVLIASYPFDGMANGPVLLRE
FT                   RRVLAVAADHPLAAEESVSLEVLGDHPVVQYPAVTSAAFKQDRTPDRTPSGRPVPKGPV
FT                   GGSFSEMLALVAMGRGVLPVGEQARQFYARPDVAYVPIHDAPPISRGPVWPAGNTTSRV
FT                   REFVRAAADANPLPPD"
FT   gene            126839..127405
FT                   /locus_tag="Micau_0127"
FT   CDS_pept        126839..127405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0127"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: kfl:Kfla_6947 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43696"
FT                   /db_xref="GOA:D9T4C8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL43696.1"
FT                   /translation="MRDEIRGLVEELPPGDELEARHREAALAWLAGTDDIFRRAKPRTP
FT                   SPHLVAYFLLRDPADGAVLLVDHRLAGMWLPSGGHVEPGEHPADTVRRELREELGVAAV
FT                   FAPPFGERPAFLTVTETVGPPEHRHTDVSLWYVLSADRDQRFTPDPVEFAGIRWWTPAE
FT                   VSEAPTGTIEPHLDRMLAKLATATP"
FT   gene            127482..128534
FT                   /locus_tag="Micau_0128"
FT   CDS_pept        127482..128534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0128"
FT                   /product="Phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: regulatory protein MerR; Protein phosphatase
FT                   2C-like; KEGG: stp:Strop_2316 regulatory protein, MerR;
FT                   SMART: regulatory protein MerR; protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43697"
FT                   /db_xref="GOA:D9T4C9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4C9"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADL43697.1"
FT                   /translation="MRLLTIGAFARATGLSAKALRIYDDCGLLPPAAVDPHSGYRYYAP
FT                   EQADRARLIAGLRRAGMPLAEIRTVCGLPPAAAAEALDAWWRRVSADTAARGRAVALLV
FT                   DRLSERGTTMSETTFRYATRCETGTVRDSNEDTAYASAALLAVADGVRGPAGATAGAAA
FT                   VDALRPLEQADAPGADLLAALADAVTRADRAVRAHATDADQPATTLTALVRRGTRLALV
FT                   HVGDSRAYLLRGGELSRLTQDHTYVQTLIDQGRLTPAEALAHPQRALLARALGAGAEVE
FT                   ADLALRTALPGDRYLLCSDGLSAVVDPGALHAALAEADDPESAVERLVEQAYAAGAPDN
FT                   IACVVADLAA"
FT   gene            128556..129467
FT                   /locus_tag="Micau_0129"
FT   CDS_pept        128556..129467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0129"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: saq:Sare_0082
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43698"
FT                   /db_xref="GOA:D9T4D0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADL43698.1"
FT                   /translation="MSGPGRTLAIMRIGIVILPDQRWSEARRRWAQVDEWGFDHAWTYD
FT                   HLGWRDLVDGPWFDSWTTLTAAAGVTSRVKLGTLVASPNFRHPAAFARQVTALDDVSDG
FT                   RVLLGLGAGGIGFDSAVLGGETLPPRQRVDRFAEFTELLDLILREDGTTWRGEWFTAVD
FT                   ARNKPGCVQQPRVPFVMAANGPRSMRLVARFGQGWVTTGLGGDDIEAWWGTVAELSDRM
FT                   TRTLEQAGRDPATLDRYLSLDSAPVFSLTSADFLAEQVARAARLGFTDVVTHWPRASSW
FT                   YAGDEAVLVDAAALLPELRRAG"
FT   gene            complement(129464..129877)
FT                   /locus_tag="Micau_0130"
FT   CDS_pept        complement(129464..129877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0130"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   sco:SCO4741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43699"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D1"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ADL43699.1"
FT                   /translation="MWPRIGGLRALALGTPGELRTRLNTLVLSGAKTATAGLVQEYDDE
FT                   NEELEYVGERLVLVDDNDALVGVVEVTGVEVVRFADVPWDFARAEGEGDRSIEEWREGH
FT                   GAYWARQGTPVTDDTRIVCLRFRLVSTEGSVGT"
FT   gene            complement(129918..130457)
FT                   /locus_tag="Micau_0131"
FT   CDS_pept        complement(129918..130457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0131"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   stp:Strop_0086 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43700"
FT                   /db_xref="GOA:D9T4D2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D2"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADL43700.1"
FT                   /translation="MLSRRLVELFEWIDPGPGSTHLVSDISGWWRDPDVLAQVGPALAG
FT                   LFPEDRPTVVIAPEVTGLLLGPLVAVAAGAGFLPAYKNGGERRRAGPTRWAETPPDYRG
FT                   RRLRVGVDGRRLNPGDRVLLVDDWVDTGAQLDALCRVVRDAGAGLIGAAALVATCPPEV
FT                   AARLRLRALLTGADLP"
FT   gene            130626..131273
FT                   /locus_tag="Micau_0132"
FT   CDS_pept        130626..131273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0132"
FT                   /product="rare lipoprotein A"
FT                   /note="KEGG: saq:Sare_0084 rare lipoprotein A; TIGRFAM:
FT                   rare lipoprotein A; PFAM: Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43701"
FT                   /db_xref="GOA:D9T4D3"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D3"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADL43701.1"
FT                   /translation="MAARHLRTRKFSSPAAIAATAAVGVALAVGGTVGAVRLTSAEPPA
FT                   EPAVVETLPSTPAPTSAAPTSAAPSPSASASPSASLSPSPKATPSPKASRTQAASRSKA
FT                   RTASPSPTAKKTSSPKVVDSGSCGASFYAEGQMTANGETFNPDALTAAHKTLPFNTKVR
FT                   VTNPANGKSVVVRINDRGPFIDGRCLDLSRAAFATIAATSLGHVNVRYEVLG"
FT   sig_peptide     130626..130712
FT                   /locus_tag="Micau_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 29"
FT   gene            131342..132448
FT                   /locus_tag="Micau_0133"
FT   CDS_pept        131342..132448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0133"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: saq:Sare_0085 protein serine/threonine
FT                   phosphatase; PFAM: Stage II sporulation protein E; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43702"
FT                   /db_xref="GOA:D9T4D4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D4"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADL43702.1"
FT                   /translation="MLSDVRTQPFQPGRGPLSPGSRAGLGAALALLAIVVAVELADGRP
FT                   AHYLALMVVAPFLAAALASWRVVLAVGGLATAIGIGFAVAERGSPLVTVVNVTAVGVAT
FT                   AAIRQRQADRIAELSRLASVAQQAVLRPLGPQVGTLAVAARYISSTATAEIGGDLYEVM
FT                   DTPYGVRMIIGDVRGKGLDAVRLASIVLGSYRHVAYERADLRAVVTDLDRAVARNVGDE
FT                   DFVTAALVEERGGTLTIVNCGHPSPLLLRRGAVIPLEPPAPAPPLGFMPVVRPRVERLE
FT                   PGDRLLLFTDGLGEARRDGEFFPTADRAWRLLGHGTVADGLASLETALVEWVHGRLDDD
FT                   IALVLMEYVGARNTTATPVPSWEVGAAD"
FT   gene            132568..134424
FT                   /locus_tag="Micau_0134"
FT   CDS_pept        132568..134424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0134"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; Acyl-CoA dehydrogenase, N-terminal, bacteria;
FT                   KEGG: stp:Strop_0089 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43703"
FT                   /db_xref="GOA:D9T4D5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D5"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADL43703.1"
FT                   /translation="MTHYKSNVRDLEFNLFEVFGADRTLGQAPFTDLDVDTARSFLGEV
FT                   DRLAREDLAASYSDSDRNPPVFDPATFTAPLPESFKKSYKAFMDSEFWRLDLPESLGGT
FT                   NAPRALWWSLAELVLGANAPIWMYASGPSFAHVLHVEGTEEQKKWARLFIDKQWGSTMV
FT                   LTEPDAGSDVGAGRTRAIQQPDGSWHIEGVKRFITSGEHDLSDNIVHYVLARPVGVEGV
FT                   GGPGTKGLSLFVVPKYHFDAETGELGERNGVYATNVEHKMGLKVSNTCEVTFGEHGVPA
FT                   KGWLLGEKHDGIRQMFMIIEYARMLVGTKAIATLSTGYLNALEYAKNRVQGADLVQMTD
FT                   KTAPRVTITHHPDVRRSLLLQKSYAEGLRALVCYTASWQDKVAIAEAAGDEKATKLAKR
FT                   VNDLLLPLVKGVGSERAYELLGHESLQTYGGSGFLQDYPLEQYVRDAKIDTLYEGTTAI
FT                   QSLDLIFRKIVRDNGKALMAVAAEIQEHIASEAGNGQLKEERQALGKALAEIQNILGVM
FT                   TGWLGEAQGGDTRALYKVGLSSRRFLLAIGDLVVGWLLQKQADVALKALAGEVSAADKS
FT                   FYTGKVAAARFFAREVLPRIGADRRIIEGTDLEIMDLPEEAF"
FT   gene            134609..134878
FT                   /locus_tag="Micau_0135"
FT   CDS_pept        134609..134878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43704"
FT                   /db_xref="GOA:D9T4D6"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D6"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADL43704.1"
FT                   /translation="MGIGSAIFLIALGAIMTFAIRANVWWIDLRAVGWVFILAGLGVLL
FT                   TTLWFWQDRRKRARTLIVEENRLSHPTAMMPPPPDPPPPTAPPS"
FT   sig_peptide     134609..134677
FT                   /locus_tag="Micau_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.786 at
FT                   residue 23"
FT   gene            complement(134888..135754)
FT                   /locus_tag="Micau_0136"
FT   CDS_pept        complement(134888..135754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0136"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: cai:Caci_5769
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43705"
FT                   /db_xref="GOA:D9T4D7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADL43705.1"
FT                   /translation="MARTTLPGGTWTLGDLTVTRFGYGAMQLAGPWVMGPPADHDGALA
FT                   VLREAVALGITHIDTSAAYGPYVTNRLIREALHPYPESLHVVTKVGADRDEQGGWPTAR
FT                   DPQSLRRQVRENLETLGVDALGLVNLRLGDATGPQPGSLAEALETLVALRQEGLIRHLG
FT                   LSNVTPEQVAEAQTIAPIVCVQNRYNLAHRGDDDLIDELARQGVAYVPFFPLGGFTPLQ
FT                   SSALSAVAERLGATPMGVALAWLLRRSPNILLIPGTKSVAHLRENVAGAGLALSGDDLA
FT                   ELDRIGR"
FT   gene            135905..136312
FT                   /locus_tag="Micau_0137"
FT   CDS_pept        135905..136312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0137"
FT                   /product="helix-turn-helix HxlR type"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   cai:Caci_5768 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43706"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D8"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADL43706.1"
FT                   /translation="MSKAEYDAFLAQCPSRQLLDRIADKWVTLVLAALRSDGSHRFGAD
FT                   CAGVPRPMRYSELSRTLAGVSQKMLTQTLRALERDGLVTRTVEPTVPVTVTYELTALGL
FT                   SLLKTIQGLKVWAEAHMDDVFANREAYDSRV"
FT   gene            complement(136323..136859)
FT                   /locus_tag="Micau_0138"
FT   CDS_pept        complement(136323..136859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0138"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="KEGG: saq:Sare_0088 putative phosphohistidine
FT                   phosphatase, SixA; PFAM: Phosphoglycerate mutase; SMART:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43707"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4D9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADL43707.1"
FT                   /translation="MTDGRNGQRTLVLLRHAKAEQSADGPDAERSLTARGHADAAAAGA
FT                   WLARQGLLPDVVLCSPARRTRQTWHDVAMGMTGSPPEGGPAGSRPAVRYEAAAYDAHPD
FT                   QLLALVRTVEPTAGTVLLVAHNPGVSLLSALLDPQRADPDGLRTTDLVVHRPTTRWAEL
FT                   APGGAPLTARHTARA"
FT   gene            136977..137267
FT                   /locus_tag="Micau_0139"
FT   CDS_pept        136977..137267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43708"
FT                   /db_xref="GOA:D9T4E0"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E0"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADL43708.1"
FT                   /translation="MGIGASIFLIALGAIFAFAIDADLGWLNLNVVGWVLMLAGVAGLL
FT                   TTLYFWNSRRRVVAAPVREQVVAEPVVPVRDDRVVREEYREVRRPGSGYPA"
FT   sig_peptide     136977..137036
FT                   /locus_tag="Micau_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.747 at
FT                   residue 20"
FT   gene            complement(137332..138009)
FT                   /locus_tag="Micau_0140"
FT   CDS_pept        complement(137332..138009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0140"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="manually curated; TIGRFAM: channel protein,
FT                   hemolysin III family; KEGG: saq:Sare_0093 hemolysin III
FT                   family channel protein; PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43709"
FT                   /db_xref="GOA:D9T4E1"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E1"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADL43709.1"
FT                   /translation="MTTSAPFRLRPADIGKPRMRGWLHAYAFFAALVCGIVLCSIAAGR
FT                   PGWAPLVSCLIYSFTVCGLFGTSALYHRRVWTERGYQIMRRMDHSMIFVFIAGTYTPFC
FT                   ALLLDNRQATIMLSLVWGGAIAGVAVKLIWPHAPRWVSAPLYLALGWVAVAMLPQILHS
FT                   GGVTALVLLSVGGAIYSVGAVFYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
FT   gene            138085..138699
FT                   /locus_tag="Micau_0141"
FT   CDS_pept        138085..138699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0141"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: stp:Strop_0097 allophanate hydrolase subunit
FT                   1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43710"
FT                   /db_xref="GOA:D9T4E2"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E2"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADL43710.1"
FT                   /translation="MRIRPVGAYALLLDCDDAEQAQAWRAELWHRREAGELTATEIVPG
FT                   AVTVLLDGVPDPEAAAARIAAWHPRTAASGAATTEVRVPVVYDGEDIPLVAGHWNVDVP
FT                   AVVDRLRRTEFRVAFCGFAPGFAYLTGLPPELAVPRLATPRTRVPAGSVALAGPYAGIY
FT                   PAASPGGWLLVGRTDLPLFDVHADPPARLTPGTRVRLVDAS"
FT   gene            138696..139565
FT                   /locus_tag="Micau_0142"
FT   CDS_pept        138696..139565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0142"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: stp:Strop_0098 UreA
FT                   amidolyase related protein; SMART: Allophanate hydrolase
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43711"
FT                   /db_xref="GOA:D9T4E3"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E3"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ADL43711.1"
FT                   /translation="MIEVLRAGALTTVQDQGRPGWAHLGVPRSGALDPAALRLANRLVG
FT                   NDEHAAGLEITVTGCTLRFTRAVAVALTGAPADVVVEWRAGSAQRRPGDVGRPLALPAG
FT                   AVLRVGPARAGVRTWLAVSGGIAVEPVLGSRATDTLSGLGPPPLRDGDRLPVGTPAGPP
FT                   APVDLAVTRPVPDELRLTVRPGPRQDWFTPEALDVLCRTAYTVSPESNRVGARLAGATL
FT                   SRAVAGELLSEGLVLGAVQVPPDGRPLVFLADHPTTGGYPVIGVVDDVTALAQARPGTT
FT                   VTFHGPQR"
FT   gene            139549..140298
FT                   /locus_tag="Micau_0143"
FT   CDS_pept        139549..140298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0143"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: saq:Sare_0096
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43712"
FT                   /db_xref="GOA:D9T4E4"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E4"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADL43712.1"
FT                   /translation="MDLNADLGEGFGSWRLGDDHALLDLISSANVACGFHAGDAATMHR
FT                   VCAGAAERGVAVGAQVGYRDLAGFGRRHIAYDFAELRDETIYQLGALDAFCRMYRTRVR
FT                   YLKPHGALYHAAARDEGQAAALVAAISGYDHELPVLCQPGTVLAQLAAGAGLRVVAEGL
FT                   ADRNYLPNGTLVPRSSPDALVTDPEQVAVRAVRMAVERTLVAVDGTVIPAPVESICLHG
FT                   DTPGAVRCAELVRAALIDAGVTLTPFA"
FT   gene            complement(140359..142194)
FT                   /locus_tag="Micau_0144"
FT   CDS_pept        complement(140359..142194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0144"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   KEGG: saq:Sare_0097 alkyl hydroperoxide reductase/thiol
FT                   specific antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43713"
FT                   /db_xref="GOA:D9T4E5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E5"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADL43713.1"
FT                   /translation="MSARVRAPELRGRAWLNTGGKAVTLADLRGKIVLLDFWTFCCINC
FT                   LHVLDELRPLEDKYGDVLVVIGVHSPKFEHEKDPAALAAAVERYGVHHPVLDDAEMDMW
FT                   QQYAAKAWPTLAVVDPEGYVVATMAGEGHAEGLARLIDELIAGHEAKGTLHRGEGPYVP
FT                   PAEPDTVLRFPGKALPLDGGNLLVSDSARHSLVELAADGETVVRRIGAGSRGRTDGPAS
FT                   AATFAEPQGLCLLPPHVAEVAGYDVVVADTVNHLLRGVRLSSGEVVTVAGTGRQWRSTV
FT                   DDHAHDARAVDLSSPWDVAWYDDRVVVAMAGIHQLWWFDPIKRTAGMYAGTTVEALRDG
FT                   PLPDVWMAQPSGLSVSADGSRLWVADSETSAIRWVSDGEMHTAVGQGLFDFGHVDGPAD
FT                   QALLQHPLGVCALPDGSVLIADTYNGAVRRFDPETGQVGTVADGLAEPSDLVLTGEGDV
FT                   LVVESAAHRLTRLAPGALTSAGANTVDGPRHRLERKPTDVAAGELTLDVIFTPAPGQKL
FT                   DDTYGPSTRLVVSASPPELLVEGAGTTTDLSRKLVVSGDVAQGVLQVTAQAATCDADIE
FT                   HAACHLTRQDWGVPVRVVTGGATRVPLVLRGMDES"
FT   gene            complement(142314..145091)
FT                   /locus_tag="Micau_0145"
FT   CDS_pept        complement(142314..145091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43714"
FT                   /db_xref="GOA:D9T4E6"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E6"
FT                   /inference="similar to AA sequence:KEGG:Sare_0105"
FT                   /protein_id="ADL43714.1"
FT                   /translation="MTSEAPHRPGQEPGEVSPGTGGPVPYGDQPAQQDNGYNGAPDLGW
FT                   APPPPAGRPAQPAPAWAANDDQPPAWAPPAGQPVTGRATAQVPQPAWGGNDQGNPAWAG
FT                   SGGPSWGNQEQSGPDRGAEQAPPAWAATPPGSPAEPSQAPWAAEQNRPGWGSGEQPGWS
FT                   PSGDPAARGTGYVPAPATVPNETWVTPAPADDPHRSGGFAPTGGQHEDASGRAGGWAAA
FT                   QQQDDPNRSGGWNPRDEQPAASDDPNRSGGWNPRESQPAWAPGQQTGATWPPADPPARA
FT                   AAAVSVPGAARPDNAWSTPEQSDQDNRSAEDSGGWRATGGPQHDEGQRSGGWPAPQAEN
FT                   RSGGWDEPARTEDPDRSGGWAAGRAASPAEAAQPGGWEPNQSRQAGGWGDGTAVPQQRD
FT                   SGEQAGAWSGAASVPQQHEPGRPSDEPAQPAWGAAAPAEARASVSVPSPDAPAGWGGNQ
FT                   DERPAAPSPEPWSPAEAWGRSEDSAPAYQPAPAPGISPGNAVPLPAQQQRVPGAALAAS
FT                   SPADHPGPEPQGYEPERGDGGWNEPQSPAVPGPRTSPEGGPVSASASVPVASRVTPPSD
FT                   QPLPTSGPAPQPRVYGRPARPEPDEAPEQDESGFPGQDGPHGNGFPGPQSRSEDADGPH
FT                   GYAGAPSSPAAPPAFPVGVPSFVDTPGNTRPANGVHPGGEQPDSARDPFGGPQSPYGAP
FT                   GGQDAFGGPGGRPDPFGAPGGQQDAFGGPGQQDPFGGPGGQQAPFGSPAGRPEPFGEQD
FT                   RFGPSAGGRASVAVPGQGPAGGGNAFPPPPQQAPPAWSQDGPGTEPEQGRFDAFKPDAA
FT                   ESQTEAPPPKVRNGRVLAAVLIAAVLILAVPLGLLTLLGKVGDDKSAGFDPAVGSCVKQ
FT                   SGTSAVAADCGEPGAFSVVSKVDNKDKCADLAQPSVSVESGGTTRVLCLKPAGQ"
FT   gene            complement(145440..145577)
FT                   /locus_tag="Micau_0146"
FT   CDS_pept        complement(145440..145577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43715"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E7"
FT                   /inference="similar to AA sequence:KEGG:Sare_0106"
FT                   /protein_id="ADL43715.1"
FT                   /translation="MSMIERIRTRRDANRRARAIEHALRSANSPAVREELLAIAQRHMS
FT                   "
FT   gene            complement(145802..147271)
FT                   /locus_tag="Micau_0147"
FT   CDS_pept        complement(145802..147271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0147"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain-containing protein of
FT                   components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein; KEGG: saq:Sare_0107 dehydrogenase
FT                   catalytic domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43716"
FT                   /db_xref="GOA:D9T4E8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E8"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ADL43716.1"
FT                   /translation="MSRIKEFNLPDLGEGLTEGEILAWLVKVGDDIELNQPIVEVETAK
FT                   AAVEIPAKWAGRVQAIFHPEGSTVEVGVPIIAIDTDPNAGPIEESTTATPASELPAPSA
FT                   ASLAAVQVAPAEGMVEPGLIGGVAPGGRTAVLVGYGPRNAPAKRRPRKGDAPAAAPVQA
FT                   AAPVAPAPVAPAPVAPAPAPAVNGNGRVSGPVLAKPPVRKLAKDLGIDLATLTGSGPLG
FT                   SITREDVQRAASAAPAAAEPLTVAAPAASAASFGADREQRIPVKGVRKLTAENMARSAF
FT                   TAPHVTEFLTVDVTRAMKALDRLRDRREWRDVRVSPLLLVAKAVLLAVKRHPMVNSTWA
FT                   GDEIVVKEYVNLGIAAATERGLIVPNIKDAGRLSLRELADAMTELVQTAKSGKTSPADM
FT                   SGGTLTITNVGVFGVDTGTPILPPGESAILAFGAVREQPWVHKGKVKPRLVTTLGLSFD
FT                   HRIIDGELGSKFLRDIGDFLADPEAALLAWT"
FT   gene            complement(147277..148266)
FT                   /locus_tag="Micau_0148"
FT   CDS_pept        complement(147277..148266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0148"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: saq:Sare_0108 transketolase central region;
FT                   PFAM: Transketolase central region; Transketolase
FT                   domain-containing protein; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43717"
FT                   /db_xref="GOA:D9T4E9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4E9"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADL43717.1"
FT                   /translation="MATETLTLGKALNTGLRRALENDPKVVIMGEDVGKLGGVFRITDG
FT                   LQKDFGDQRVIDTPLAESGIIGTAVGLAIRGFRPVCEIQFDGFVYPAYDQIVSQVAKMH
FT                   YRSQGKVRIPMVIRIPFGGGIGAVEHHSESPEAYFAHTAGLKVVSCANPQDAYVMIQQA
FT                   IASDDPIVFLEPKRRYWEKGPVDLDAPIADAYPLHSARVARPGADATVLAYGPMVRTAL
FT                   DAATAAAEDGRELEVIDLRTISPLDLTAAYESVRRTGRCVVVHEAPGNLGLGSEIAARI
FT                   TEECFYSLESPVLRVTGFDTPYPAARVEEEYLPDLDRVLDAVDRTFGW"
FT   gene            complement(148266..149444)
FT                   /locus_tag="Micau_0149"
FT   CDS_pept        complement(148266..149444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0149"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; KEGG:
FT                   saq:Sare_0109 pyruvate dehydrogenase (acetyl-transferring);
FT                   PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43718"
FT                   /db_xref="GOA:D9T4F0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F0"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ADL43718.1"
FT                   /translation="MAKGDPGAATRSKRAAPRTRRAAATGEPELVQLLTPEGERIESAL
FT                   GPDGTEYRVDFTDEEYRGLYRDLVLVRKLDAEATALQRQGELGLWASLLGQEAAQVGSG
FT                   RALRTQDMAFPTYREHGVLYCRGIDPIMPLGLFRGVDQGGWDPNEFKFNMYTIVIGAQT
FT                   LHATGYAMGVAMDGKTGGEDGEAVIAYFGDGATSQGDVNESFVWASVFNAPLVFFCQNN
FT                   QYAISEPLERQTRVPLYRRAGGFGFPGVRVDGNDVLASYAVTRHALDNARNGQGPSLIE
FT                   AYTYRMGAHTTSDDPTRYRIASEVEAWQAKDPIARMKAFLTKQKIADESFFTEVDEQAR
FT                   TESVHLRERVLAMPDPQPVTMFDHVYPNGSPELDEQRARFTQYMESFEGSAH"
FT   gene            complement(150055..150654)
FT                   /locus_tag="Micau_0150"
FT   CDS_pept        complement(150055..150654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43719"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F1"
FT                   /inference="similar to AA sequence:KEGG:Sare_0110"
FT                   /protein_id="ADL43719.1"
FT                   /translation="MWETDGLAGSDGPAEPDGSAGPDGSAGPDGSDGLDGSDEPAEGVG
FT                   SAVVTDGSGLGLGSGVGVAGSDGECDGDGEGTGDGRGGRTGVGRTGAAGGGGAATGRDR
FT                   CREPRSLSSGRAGAAGSTGRAGGTDVTSTAGVGVDGAGAWVPWGIGMTTGPTEGVGRNG
FT                   VLVSGRALLPTVADPVLIAARIGIDAVPASNATVSR"
FT   gene            complement(151286..152512)
FT                   /locus_tag="Micau_0151"
FT   CDS_pept        complement(151286..152512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43720"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F2"
FT                   /inference="similar to AA sequence:KEGG:Sare_0111"
FT                   /protein_id="ADL43720.1"
FT                   /translation="MATPQTPYDAVLHAARDVTRLDSALDAEMLGAALLGSVYAVAEHD
FT                   RERAVREFVSGFLAATSRRRSAAATTLRAVFAALVPDAEGAARVRPGAYAPSWAGQLGR
FT                   VRVTGAWAYGDVYGDQTSYLATFAYDDEEEGGPEHALVALVDHNIGITKDVFVGGPAGR
FT                   IVEQAREICTEDEFTWFRTEDPARMHAEVSRHLAVTDDLTELPAQGSLATDRALVGARL
FT                   AVLPGPTPPAGPAVVPPPTDEERTRLVRAFLDSPEAARFGLPEVADGELASLHFCLGLL
FT                   LDHAASFPDADPMRWSPMVAELFLLDWVHRRAVLDMDDAAMLPRVLRAWAAYAARQRGL
FT                   SQSAAARTDEAITEMVPEFARLYSTGERRSPATAAVAQLMADGVDPDDPEALNAWIEAN
FT                   RHRLTDDPA"
FT   gene            complement(152565..154268)
FT                   /locus_tag="Micau_0152"
FT   CDS_pept        complement(152565..154268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0152"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: mkm:Mkms_1571 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43721"
FT                   /db_xref="GOA:D9T4F3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F3"
FT                   /inference="similar to AA sequence:KEGG:Mkms_1571"
FT                   /protein_id="ADL43721.1"
FT                   /translation="MSASKDGTVGNIVGRMREAMRGEQRVDPDTLIERLTAIQRFLGAV
FT                   DGHVPDAQLVAAHTVVERAGDRLALSGRHTVVALAGATGSGKSSLFNSLARLDLSPVGV
FT                   RRPTTGVAHACVWGPLDGAVRLLDWVGVLPRHRFVRESPLDADDESNLHGLVLLDLPDF
FT                   DSVQHGHRLEVDRLLGLVDLVVWVVDPQKYADRVIHTSYLREFHRHKDVTVVVLNQADR
FT                   LHPTELPKVLDDLRRLLDADGLGGVPLLPTVAVDPNGLEGLRTELERTVAERQAALRRL
FT                   SGDVDAVVADLEPLVGPEPPRTRPGDASAQELTRALAGAAGVPTVAAAVEGAYRHRAVS
FT                   NTGWPLLRSWRKLRPDPLRRLHLPGRDPDAPAESLVAATSVPDPTAAQRSALTLAIRAV
FT                   AERSGIGLPAPWPTAVTAAARARQADLPGALDHAVAATDLGMDRRPGWWRVVGVLQWVV
FT                   TLAALAGLVWLLLGYAVRLLGLPPLEHPTLGVVPWPTVLLLGGLLAGLLVAAVTRPVVG
FT                   WAARRARRRAEERLLTSVGSVGEKYVLDPVWAVLARYGTARDALREAGRR"
FT   gene            complement(154384..156201)
FT                   /locus_tag="Micau_0153"
FT   CDS_pept        complement(154384..156201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0153"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: gob:Gobs_0079 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43722"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F4"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0079"
FT                   /protein_id="ADL43722.1"
FT                   /translation="MTTHGDSATRAGAPAVAARTGATTGDDQPAHAADGLPAALTGLRA
FT                   AIGAARFPLALPSAEPARHAATSLTDQLDDYLLPRLARLDAPLLVVVGGSTGAGKSTLV
FT                   NSLVQARVSAAGVLRPTTRSPVLVCSPTDAAWFRQGELLPGLTRTTEPSEQPGTLHLVT
FT                   APALPPGLAFLDAPDIDSVVDANRALAGQLLAAADLWLFVTTAARYADAVPWELLRSAR
FT                   ARGTAVAMVLDRVPPEAADEVAAHLSEMLAEQELGASPLFVLPETWVDGQGLLPDRITA
FT                   PLSDWFARLAADAEARAAVVRQTLDGALAAVHPVVEGLAEAADEQVTAADALDERVQAA
FT                   YRSAERSVDQGLRDGRLLRGEVLARWQEFIGTGDFFRGLEARIGRLRDRVVAAVTGRHA
FT                   PAAELRTAIESQLVTLLRGVAAEAAENAYTGWKAHPAGAALLEPDLAHPSADLPERAEQ
FT                   LVRDWQRGVLELVRVEGGDRRFVARTAAYAVNATGLAVMIGVFASTAFIPTGLEVAAGT
FT                   GTAVAGQTVLQAIFGDQAVRNLARKARVDLLDRVGKLLAEEAERYLSRTEAERPAANAG
FT                   AALRWAAVEVERARHRSGLFPAPEQDGRP"
FT   gene            156412..158274
FT                   /locus_tag="Micau_0154"
FT   CDS_pept        156412..158274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0154"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: saq:Sare_0112 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43723"
FT                   /db_xref="GOA:D9T4F5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F5"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADL43723.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVIANAEGSRTTPSIVAFARN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKREIGTNWTVDIDGKKYTPQEISARTLMKLKRDAE
FT                   AYLGEQITDAVITVPAYFNDGQRQATKEAGEIAGFNVLRIVNEPTAAALAYGLDKGSKE
FT                   QTVLVFDLGGGTFDVSLLELAEGVVEVKSTSGDNQLGGDDWDQRIIDHLVKTFRGEHGI
FT                   DLSQDKMAMQRLKEAAEKAKIELSAATTSNINLPYITAGSAGPLHLDVTLSRAEFQRMT
FT                   QDLLDRCKGPFEQAVKDAGIKISDVDHVILVGGSTRMPAVTDLVKQLTGRDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSEVFT
FT                   TADDNQPSVLIQVFQGERDIAAYNKKLGTFELTGLPPAPRGVPQIEVTFDIDANGIVNV
FT                   HAKDLGTGKEQKMTITGGSSLPKDDIERMRRDAEEHAGEDKRRREEAETRNVAEALQWQ
FT                   TEKFLAESGDKLPGENRDQLNEALGELRSALGGQDIEKIKSAHEKLAQVSQQAGSLLYA
FT                   QQQEGEQTAPGAAGPGAGAGAAGGPKAGGDDDVVDAEIVDEDKK"
FT   gene            158323..159060
FT                   /locus_tag="Micau_0155"
FT   CDS_pept        158323..159060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0155"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: stp:Strop_0114 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43724"
FT                   /db_xref="GOA:D9T4F6"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F6"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADL43724.1"
FT                   /translation="MTDKPRAAGPGATGSAPGAGKDTGDEPRVVIRDKRKLGKVTEQPA
FT                   NDASAADAAADAPAEGLVEEAEVVVDEIGGEAEVSGPTVVDSPAEPNGGTGPDAPLGAE
FT                   LESLRTDLEERTRDLQRVTAEYANYRKRVDRDRNLVQEQATGAVLTALLPILDDLDRAR
FT                   EHGDLVGPFGSVAEQLTGALAKFGLTAFGETGDPFDPTRHEAVAHQTSADVTEPTCVQV
FT                   MRRGYQLGERLLRPAMVAVADPE"
FT   gene            159140..160327
FT                   /locus_tag="Micau_0156"
FT   CDS_pept        159140..160327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0156"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; heat shock protein DnaJ domain
FT                   protein; DnaJ central domain protein; KEGG: saq:Sare_0114
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43725"
FT                   /db_xref="GOA:D9T4F7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F7"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADL43725.1"
FT                   /translation="MSSKDWIEKDYYAALGVDKSASSDEIKKAYRKLARESHPDHNPGD
FT                   TGAEERFKTVSEAYAVLGDEKKRREYDEMRSLFGSGAFRRSARGAGQPGGMPFDVSDLF
FT                   GGGAGGGDSRFSGGGFTDLFSSIFSGGAGGGGPARPRGPARGRDVETEVALDFEDAVRG
FT                   VTLPLTLRAPGVCDTCHGNGAKPGTQPVACPVCHGAGVTTRNQGSFSFSEPCRNCQGVG
FT                   TIVEEKCPECHGTGGVTKTRTLHVRFPAGVSDGQRIRLAGRGEPGERGGPAGDLFVQVK
FT                   VRPDELFGRTGDDLTLNVPITYAEAVLGTDLRVPTLDGTVTLRVPPGTPSGRVLRARGK
FT                   GVVRKDGRAGDLLVTLDVVVPAKISDEARAALETFAAQTPPAAREHLDARVRRFS"
FT   gene            160352..160792
FT                   /locus_tag="Micau_0157"
FT   CDS_pept        160352..160792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0157"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: saq:Sare_0115 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43726"
FT                   /db_xref="GOA:D9T4F8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F8"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADL43726.1"
FT                   /translation="MSEEYVGSGDQAYEAKVLMISVAARMAGMHPQTLRQYDRLGLVQA
FT                   GRASGGGRRYSVRDVVLLREVQRLSQDDGINLAGVKRIIGLERLLEEAQQRVARLEAEL
FT                   DAAYRRIAELESLGGFPRGDLVPTNRTSTALVVWRPRRAPDR"
FT   gene            160969..161175
FT                   /locus_tag="Micau_0158"
FT   CDS_pept        160969..161175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43727"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4F9"
FT                   /inference="similar to AA sequence:KEGG:Strop_0117"
FT                   /protein_id="ADL43727.1"
FT                   /translation="MTEPAKKVAERAEERLEKVAENVRERFDRVTEGRFSDKVKEGRFA
FT                   DQTDHGVDRARDDERRKKQGGST"
FT   gene            complement(161406..161834)
FT                   /locus_tag="Micau_0159"
FT   CDS_pept        complement(161406..161834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43728"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G0"
FT                   /inference="similar to AA sequence:KEGG:Strop_0118"
FT                   /protein_id="ADL43728.1"
FT                   /translation="MSVQEETFRGFANPVDPSPAELRAWAYQPDSVPLTSMPPDWDLLV
FT                   AGDHLVQTLFDLAMDQGCPARRFTLHCLYIYAADGIRTNFRAHPKRRFRRLVEQAEKSG
FT                   DDLMRNWAHNSRVLLARPDLFVYRDWCEGGLVRENRRL"
FT   gene            complement(161999..163216)
FT                   /locus_tag="Micau_0160"
FT   CDS_pept        complement(161999..163216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0160"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   stp:Strop_0119 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43729"
FT                   /db_xref="GOA:D9T4G1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G1"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADL43729.1"
FT                   /translation="MHETTILLIEVGALLLLLGLLGRLSRRFGVSPIPLYLLAGLAFGH
FT                   GGLLPLNASEEFFAVGAEIGVILLLVMLGLEYSANELVGNLRSAAPAGLIDAVFNALPG
FT                   FAFALLLGWGWVAAVVLAGVTWVSSSGVIAKVLGDLGRVGNRETPVILSVLVIEDLAMA
FT                   LYLPLVTALLAGVGLMKGGIALAVAVFTVVVVLAVAIRYGHLISAALSAKDPEALLLGV
FT                   LGLTLLVAGVAAKLQVSAAVGAFLVGIALSGPVAHHATELLSPLRDLFAAVFFVFFGLV
FT                   TNPLDMPPVLLPALLLAVVTMATKVATGYLAARRAGIAEPGRWRAGLALTPRGEFSIVI
FT                   AGLAVAAVYPVEPKLAALATAYVLITVVTGPLLARLPDSPWFKQWLRTRAAAARPPAPL
FT                   PLGTGD"
FT   gene            complement(163222..163722)
FT                   /locus_tag="Micau_0161"
FT   CDS_pept        complement(163222..163722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0161"
FT                   /product="TrkA-C domain protein"
FT                   /note="KEGG: saq:Sare_0119 TrkA domain-containing protein;
FT                   manually curated; PFAM: TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43730"
FT                   /db_xref="GOA:D9T4G2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G2"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADL43730.1"
FT                   /translation="MRVRVEQTALPGIGVRHDLMTESGRRLGVVSHRNGRRDLVLYDPD
FT                   DPDSCQHDIPLTDDEAEALADILGASLMLGQLSGLREQAAGLLTEQIAMPAGSKYVGRR
FT                   LADTKARTRTSASIVAVLRQGAVNVSPDPTFRFEAGDVVVVVGTRQGLDGVTAILAETD
FT                   PDG"
FT   gene            complement(163804..164022)
FT                   /locus_tag="Micau_0162"
FT   CDS_pept        complement(163804..164022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0162"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="KEGG: saq:Sare_4773 regulatory protein GntR HTH;
FT                   PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43731"
FT                   /db_xref="GOA:D9T4G3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL43731.1"
FT                   /translation="MPKQQYQVLADELKSKIDSGEWPPGTKLPSRAQLCKEYGVSDTVV
FT                   GKAMMILRATGLTETLEGVGVFVAERT"
FT   gene            164227..164544
FT                   /locus_tag="Micau_0163"
FT   CDS_pept        164227..164544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0163"
FT                   /product="DivIVA domain"
FT                   /note="TIGRFAM: DivIVA domain; KEGG: stp:Strop_1519
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43732"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G4"
FT                   /inference="protein motif:TFAM:TIGR03544"
FT                   /protein_id="ADL43732.1"
FT                   /translation="MRNILRIRPKRRNARPPDSAPGGPYRSASYLPLRPWQVRGHSFRT
FT                   CRRGLDPAEVAAFLDRVAGDLAAAYAEVARSRDETARIKGALREWQSRQAPSMRDLAGR
FT                   P"
FT   gene            164541..164807
FT                   /locus_tag="Micau_0164"
FT   CDS_pept        164541..164807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43733"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G5"
FT                   /inference="similar to AA sequence:KEGG:Sare_4346"
FT                   /protein_id="ADL43733.1"
FT                   /translation="MTGRYVIHLPVRAADLARAKMLGRTAGRSLAFLAVVELGGITVST
FT                   EDDQSVRHWVFCDRKLDGGRRCVLRADHETPCLARLPGRTGGR"
FT   gene            164893..167484
FT                   /locus_tag="Micau_0165"
FT   CDS_pept        164893..167484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0165"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; AAA ATPase central domain protein;
FT                   Clp domain protein; Clp ATPase-like; KEGG: saq:Sare_0120
FT                   ATPase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43734"
FT                   /db_xref="GOA:D9T4G6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G6"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADL43734.1"
FT                   /translation="MNTERLTTKSREAITGAVALANQRGHATVEPWHLLLSLLDTEGST
FT                   AAGLLRAVGADPAELRRVAQRSVDALPAARGSSIAEPTLAREFVNAIGAAEQIARPLGD
FT                   EYTSTEHLLAGLARVGGAVSVALKNSGATEENLVAAFPTVRGGDRRVTTADPEQTYQAL
FT                   AKYGVDLTASARDGKIDPVIGRDSEIRRVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVAGDVPESLRDKKLVSLDLGAMVAGASYRGQFEERLKSVLEEIKNSDGQVITFLDE
FT                   LHTVVGAGKGEGSMDAGNMLKPMLARGELRMVGATTLDEYREHIEKDPALERRFQPVLV
FT                   GEPTIEDTIGILRGLKERYEVHHGVRITDAALVAAASLSDRYITDRFLPDKAIDLVDES
FT                   ASRLRMEIDSRPVEVDEIERAVRRLEIEEMALAKEPDAASAERLERLRKELADKREQLT
FT                   ALSERWQTEKSHITKLSTAKEELERLGGEAERAERDGELERAAELRYGRIPALRTELKQ
FT                   AEEELARLQADGAMLKEEVGADDIAAVVASWTGIPAGRLLEGETAKLLRMEETLRGRVV
FT                   GQAEAVGAVSDAVRRARAGVADPDRPTGSFLFLGPTGVGKTELAKALAEFLFDDERAMV
FT                   RIDMSEYGEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVILLDEVEKAHPDVFDV
FT                   LLQVLDDGRLTDGQGRTVDFRNAILILTSNLGSSVISDLTLTENERREGVLAVVRSHFK
FT                   PEFLNRLDDIVVFAALQGEDLRSIVDIQLDRMRRRLADRRLGLEITDAARTWLAEHGYD
FT                   PIYGARPLRRLVQSAIGDQLAKALLAGDIRDGDTVRVDLSDSKESLAVTAA"
FT   gene            167701..168081
FT                   /locus_tag="Micau_0166"
FT   CDS_pept        167701..168081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_8651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43735"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G7"
FT                   /inference="similar to AA sequence:KEGG:SCAB_8651"
FT                   /protein_id="ADL43735.1"
FT                   /translation="MSGSWERELDAAARELDGADTLAFGGVGLAGQILPATEAYRTLEQ
FT                   GLREHPEEARKRVDRLLRKGSPAGRAYAATLLEAVDPAAGRDAWARLRGDDGEFTTFSG
FT                   CLMGRATLGEYAADRLAAADSS"
FT   gene            168118..168801
FT                   /locus_tag="Micau_0167"
FT   CDS_pept        168118..168801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43736"
FT                   /db_xref="GOA:D9T4G8"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G8"
FT                   /inference="similar to AA sequence:KEGG:Sare_0121"
FT                   /protein_id="ADL43736.1"
FT                   /translation="MRLLPFPPSTLGEAVVNGSLAWVLATLGCLVGVAGVVIAVIAWRK
FT                   SQSASRPKTKAAPGDPFRDRDADALRGDPRALKPGDIVEIRAVPYTVRGSVHLVEGGWS
FT                   WAEHLLDDAGGVKRWLSVEADPDLEMVLWTSEPGATVTPGAPTLEIAGRRYNWDESGQA
FT                   RYTATEGTGLDPNGTMRYYDYQAPGGARLSFEAYGEAGWEVNLGEELRRAEVMIYPQGG
FT                   PDTVR"
FT   gene            168803..169297
FT                   /locus_tag="Micau_0168"
FT   CDS_pept        168803..169297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43737"
FT                   /db_xref="InterPro:IPR024486"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4G9"
FT                   /inference="similar to AA sequence:KEGG:Sare_0122"
FT                   /protein_id="ADL43737.1"
FT                   /translation="MLVCLDAPYVDTSAADLSLALGGPELPALAVRDIDLPGLPRLRLR
FT                   LLGASHQVVLGTLTETVACLPGRPPHLPGTLHDETAGYRFLATVLRPEGDGLRTRVAAL
FT                   RAELAEDPYALIGVFPGDEDAVTALSVRPAPPDGVLAWRTWHAYPQTNELVLTETVVEE
FT                   L"
FT   gene            169294..169719
FT                   /locus_tag="Micau_0169"
FT   CDS_pept        169294..169719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43738"
FT                   /db_xref="GOA:D9T4H0"
FT                   /db_xref="InterPro:IPR025341"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4H0"
FT                   /inference="similar to AA sequence:KEGG:Sare_0123"
FT                   /protein_id="ADL43738.1"
FT                   /translation="MTYRRWFVVGVAVAVIGALIAAFTIFYGNFSPRGYVEDNFSRATG
FT                   RDIGSNAIAYTSNKAPSDVSKQITDTWKPADQYVDGSGVYLRYDDDSVVILPLAVGSVI
FT                   LLEKMTTAYPRYHSVVGNSWGWGRGSTVRGGGPGSGK"
FT   sig_peptide     169294..169359
FT                   /locus_tag="Micau_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.649 at
FT                   residue 22"
FT   gene            169751..170173
FT                   /locus_tag="Micau_0170"
FT   CDS_pept        169751..170173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0170"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   saq:Sare_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43739"
FT                   /db_xref="GOA:D9T4H1"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4H1"
FT                   /inference="protein motif:PFAM:PF03994"
FT                   /protein_id="ADL43739.1"
FT                   /translation="MQHLVTDLLVTLAYGAVGVVLMAIGYVLVDLATPGKLHDLIWTER
FT                   NRNAALLLSSNLLGVGTIVVAAIVASDDDFTLGLVGAAAYGILGLVIMAAAFVLLDVAT
FT                   PGKLGELLVDPEPHPAVWVSATVHLATGAIIAAAII"
FT   gene            170173..170946
FT                   /locus_tag="Micau_0171"
FT   CDS_pept        170173..170946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43740"
FT                   /db_xref="GOA:D9T4H2"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4H2"
FT                   /inference="similar to AA sequence:KEGG:Sare_0125"
FT                   /protein_id="ADL43740.1"
FT                   /translation="MSGKPAQHSAGKDKRTQTVIWSVVVGIVVVVCAIGVFSGDSDTSV
FT                   PAPAADERSGTVPILRAAADSQGICYGWELLDVYDEVSVGSNLGDGTTVVDAPGCTRWI
FT                   AVSANVRYTSSSSESEDSATIRIKGSDDIEFADLAAIETRLGRFGLDEEAFVDDPGWAV
FT                   TRAATILPLLAAERGLAEPAATPTAAPSTAAAPLPDAGNDFWRDRWIYVLSSLGLFLLA
FT                   ALFLVVGVRQRRNHRGRVPAQRAGAGAAGRTRSRR"
FT   gene            170943..172511
FT                   /locus_tag="Micau_0172"
FT   CDS_pept        170943..172511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0172"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: saq:Sare_0126
FT                   spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43741"
FT                   /db_xref="GOA:D9T4H3"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T4H3"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ADL43741.1"
FT                   /translation="MTVDVAARPRWRLARAAVLLAVFVCAACGLVYELALVALGSYLIG
FT                   DTVGQASIVLGVMVFAMGVGALVAKPLQSRAVVSFAVIELTLALLGGLSVLGLYAAFAW
FT                   LDLYGPALVGTAFVLGLLIGAEIPLLMVMLQRIREQSAGSAVADLFAADYVGALLGGLA
FT                   FPFLLIPVFGQLKGALVVGAVNAVAGVVLVFTVFRAELGRRARAALGAATVVVGLLLGY
FT                   AWVTAHDFEVTTRQQLYRDPVVHAERSRYQEIVLTRSVREPGHSDTDLRLFLNGDLQFS
FT                   SIDEYRYHEALVHPAMRGAHGDVLVLGAGDGLAAREILKYPDVRSVTLVDLDPAVVELA
FT                   RREPQLRELNRESLTDPRVRVLNLDAFAWLRTATDRFDVVIADLPDPDETATAKLYTIE
FT                   FYTLIRPVLAPGGRLVVQSGSPYFAPRSYWSIERSVREAGFATVPYHVDVPSFGDWGFV
FT                   LAAPGDVAPELALPDDPPPLRFLTPAVLAAAGTFPADRARIDVPASTLLRPRVLDYARE
FT                   EWRGY"
FT   gene            172522..173577
FT                   /locus_tag="Micau_0173"
FT   CDS_pept        172522..173577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43742"
FT                   /db_xref="GOA:D9T587"
FT                   /db_xref="UniProtKB/TrEMBL:D9T587"
FT                   /inference="similar to AA sequence:KEGG:Strop_1603"
FT                   /protein_id="ADL43742.1"
FT                   /translation="MPPESSSRHRPGIGWLVRRLPTRAVEAASYLQAFVLSGVVTVLAV
FT                   RAYLKATDYPQLGGGGLHIAHVLWGGLLLAVGLGIPLVFLGGGARSGGAVIGGIGFGLF
FT                   IDEVGKFVTTGTDYFYAPAAAIIYVAFALLVLLIQAVRGRTGRSRLTPAERTANALDMV
FT                   LSGLPGGLTDRRRIAVLRLVQGTGPATETAVAHLLEAVPHREPPPVPLWQRAADRARRL
FT                   AVWAAGRRWLVWPVVVYLVVEPVLTVVAVFLDGVTGKLDQEREWGAVLGVSATALITAV
FT                   LGLWAAWLLRRNRAEAFRLFKLALLVDLLFGQVFNFTVNQFGAVSAVALDLALLGVVTA
FT                   EHRRLRRAAER"
FT   gene            173647..174426
FT                   /locus_tag="Micau_0174"
FT   CDS_pept        173647..174426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43743"
FT                   /db_xref="GOA:D9T588"
FT                   /db_xref="UniProtKB/TrEMBL:D9T588"
FT                   /inference="similar to AA sequence:KEGG:Strop_0122"
FT                   /protein_id="ADL43743.1"
FT                   /translation="MVDAPGTPPRTRPGVVTLSSWLLILVAAIQVLNLIVALTVVGKIR
FT                   DVLTDAYAGTSAEGAGDIAYAFSIITAVVSLLIAAGLVVLALLNNRGKNGSRITTWVLG
FT                   GILFCCTGGGLLTGLTGGMTGGGNTTGDVPSSEEIQRRLEDALPSWYTPVNLLLGLVAL
FT                   LALLAALILLALPKANEFFRKPKAGWEPPVPGGAYPAYPSHPGQSGDPAYPSYPPAPGT
FT                   PPSTPGGQPPSAPGGQPPSAPGGQPGERRDPEPPSGS"
FT   gene            174499..175227
FT                   /locus_tag="Micau_0175"
FT   CDS_pept        174499..175227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43744"
FT                   /db_xref="GOA:D9T589"
FT                   /db_xref="UniProtKB/TrEMBL:D9T589"
FT                   /inference="similar to AA sequence:KEGG:Strop_0123"
FT                   /protein_id="ADL43744.1"
FT                   /translation="MSYPDRAAPRRPGTVLAAAALLLVMAVGAVAYAVVNLAVGGGTVD
FT                   RFRDAAAERTGASGGDVDQVAGLLRGSTVLAAVLGVLAALLLVGLALGLLAGRSGARTA
FT                   TWVVAGTGLLCGCCGLAVLVGQRAAPLRLGADDRITADLLGLVGDAYPSWWIPVNATLS
FT                   VAQILGYLVVAVLLTLPSSGAFLRRRTAPLRLSGYGSTVSGAAAPGPTPWGPPPGLNPP
FT                   PSVPPATPPGGFPPPPEDSR"
FT   sig_peptide     174499..174594
FT                   /locus_tag="Micau_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.575 at
FT                   residue 32"
FT   gene            175224..176033
FT                   /locus_tag="Micau_0176"
FT   CDS_pept        175224..176033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0176"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   stp:Strop_0124 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43745"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T590"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL43745.1"
FT                   /translation="MTGDTHPSRRRALVTGASLGIGEAFARRLAADGWDLVLVARDAAR
FT                   LDALAAELTGRHGGDAETIAADLSTEDGCAAVEQRLTAGTPIELLVNNAGISLSTSFVR
FT                   SSVADEARLVRLNVLAVLRLTHAALGPMIERGHGAVINVSSVAGFGVPMPGSTYSASKA
FT                   WVTNFSESIGQSVAPLGVRVMALCPGYTRTGVHERAGIDMSRLPAWAWLRADDVVAEGL
FT                   RDLRKGKSVSVPDWKYKVAVAGLRHAPKRLLRGFRRDTRGAVGRQRG"
FT   gene            176188..176727
FT                   /locus_tag="Micau_0177"
FT   CDS_pept        176188..176727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0177"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   saq:Sare_0130 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43746"
FT                   /db_xref="GOA:D9T591"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9T591"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADL43746.1"
FT                   /translation="MGDHDDLRKFITDLAVVHGRVVLSSGREADWYVDLRRVTLHHEAA
FT                   PLIGRVMRDLTADWAYDAVGGLTLGADPVAAAMLHASAGTGHAVDAFVVRKEGKAHGLQ
FT                   RRIEGPDVSGRRVLAVEDTSTTGGSVLTAVDALREAGAEVVGVAVIVDRGAGDTVRAAG
FT                   LPYRAAYTLADLGLVA"
FT   gene            176785..177162
FT                   /locus_tag="Micau_0178"
FT   CDS_pept        176785..177162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0178"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: stp:Strop_0126 regulatory protein, ArsR; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43747"
FT                   /db_xref="GOA:D9T592"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T592"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL43747.1"
FT                   /translation="MEYVGTALAEMTMPQISPLAGEPIERADAERLAGVLKALADPARL
FT                   RLLSLIQSAPEGEACVCDLTAPLGLSQPTVSHHLRILTEAGLLEREKRGVWAYYRLVPS
FT                   AIATIADLLTPPRKRATKKAR"
FT   gene            complement(177335..178180)
FT                   /locus_tag="Micau_0179"
FT   CDS_pept        complement(177335..178180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0179"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   tcu:Tcur_0208 SNARE associated Golgi protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43748"
FT                   /db_xref="GOA:D9T593"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D9T593"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADL43748.1"
FT                   /translation="MPDRAGVPCVAVDTAEKTRMFSESVALNPLDPKDLIHTFGMIGVW
FT                   VILFAETGLLVGFFFPGDSLLFLAGVAASPVADAIFGDGTRLSLAGLMIGGPLCAIAGA
FT                   QLGHWLGARYGRRMFEKPNSRLFKREYVEKAEYYFQKFGPAKAVVLARFIPIVRTFLNP
FT                   VAGVLGMPARQFFVWNVVGAVLWVDGILLIGYLLARQIYDAIGDKIDRYILPVVALIIV
FT                   ISVLPIFFEFLRDRRARKRGEAVAVITAATVAGTVEAAREGIEEHRPGHGDGHGGQHRR
FT                   "
FT   gene            complement(178204..180720)
FT                   /locus_tag="Micau_0180"
FT   CDS_pept        complement(178204..180720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0180"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /note="KEGG: cai:Caci_5514 metallophosphoesterase; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43749"
FT                   /db_xref="GOA:D9T594"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024028"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:D9T594"
FT                   /inference="protein motif:PRIAM:3.6.1.17"
FT                   /protein_id="ADL43749.1"
FT                   /translation="MTVLDIPELALVALVGVSGSGKSTFARRHFAPSQVLSSDTFRGLV
FT                   ADDENDQSASADAFDALHHVAAIRLRRGLLTVVDATNLQPHARAGLIRVAREHDVLPVA
FT                   IVLDVPEAVAWERTEARADRTHGRQVLNRMRRDLRQSYGRLAREGFRKVHVLRGVDEID
FT                   AAEVRYEKLFNDRRELTGPFDVVGDVHGCRTELEALLSRLGYVLRHDDAGRPVDAAHPS
FT                   GRTAVFVGDLVDRGPDSPGVLRLVMGMVAAGHAICVPGNHEQKLLRKLRGRDVRLTHGL
FT                   AETMEQLAAESPEFVAGVETFIDGLVSHYVLDGGRLVVAHAGLKEAYHGRASGRVRSFA
FT                   LYGETTGETDEYGLPVRYPWARDYRGSAMVVYGHTPTPEPEWVNNTICLDTGCVFGGQL
FT                   TALRYPEKELVAVPAVKEWYAPARPLVPVTPSRPDTVLDLADVTGRRHLTHAYGSLTVP
FT                   AENAAAALEVMSRFAVDPGRLVWLPPTMAPCSTSAVDGFLEHPAEAFADYRAAGVERVV
FT                   CEEKHMGSRAVVLVEREPGRFGGGVVHTRTGRPFFDPPLDGELLTRVRAAVTGAGLWAE
FT                   LDTDWLLLDAELLPWSAKASGLIREQYAGVGAAGRAALPAVLAALDTAAGRGLPVAGLR
FT                   DRMAGRAAEITAYSAAYRAYVRPTDGLRGVTLAPFAVLAGAGVSYADRDHGWHLALADR
FT                   LCAADPEFFTPTRRRVVDLADESAVADATEWWLALTAAGGEGMVVKPYAGLAARSPKGS
FT                   LLQPGIKCRGREYLRIIYGPGYTEAGQLAALRRRSLGRKRGLALREHGLGLAALDALAE
FT                   DAPLWRRHELVFAILACESEPVDPRL"
FT   gene            complement(180717..182207)
FT                   /locus_tag="Micau_0181"
FT   CDS_pept        complement(180717..182207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0181"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: sro:Sros_6753
FT                   ubiquinone/menaquinone biosynthesis methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43750"
FT                   /db_xref="GOA:D9T595"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:D9T595"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADL43750.1"
FT                   /translation="MLLTLTTTHRPATDLGHLLVKHPDRVQSFDLPAGAAHVFYPEADE
FT                   ARCTAALLVEVDPLKLGGGRRNRAPEGFALGQYVNDRPYAASSLLSSALSKVFRSALRG
FT                   ESRDRPELAASAIPLTVRVPVLRCRGGAELAVRIFAPLGWTVTATPIPLDETYPEWGDS
FT                   RYVDLTLTGTLRLADALNHLYVLLPVLDDAKHYWVAPDEVDKLLRAGAGWLAGHPERGL
FT                   ITRRYLAHRRALAGEAMARLTELRLADEPPADDSIEPSTGEPAGSSGGGAGTAEDVRRA
FT                   SLAVRRREAVLAALRDSGASRVLDLGCGGGALLTALVADRRFTEVVGVDVSDRSLGLAA
FT                   RRLRLDRLPERQRDRIRLWQSALTYRDDRLRGYDAAVLMEVVEHLDPPRLPALEDAVFG
FT                   HARPGTVVVTTPNVEYNVRYEGLAPGRFRHADHRFEWTRAEFAAWVDRVAAAHGYTAVL
FT                   GGVGDEDPEAGTPTQIAVLTRDDRNENTSNDRKEATNR"
FT   gene            182326..182807
FT                   /pseudo
FT                   /locus_tag="Micau_0182"
FT   gene            182807..183859
FT                   /locus_tag="Micau_0183"
FT   CDS_pept        182807..183859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0183"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family"
FT                   /note="KEGG: saq:Sare_5021 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43751"
FT                   /db_xref="GOA:D9T596"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D9T596"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADL43751.1"
FT                   /translation="MIEDELRAAFARLEESTPPVGPVRAAVDRAVISRRRRRRRVRLAG
FT                   TALAVAAVALVGFTAMAPRPPAPAAAPAPPTPVPEPGGALNLLLLGVDQSVGSRRADSV
FT                   LLVHLPADRSRLHLVSFPRDLLVPVPPQGGTEKLNATFSRAAGSGTDLAAGYRATRQAV
FT                   AGLTGVRVDAGAVLTYPGARELTDAVGGVPVCLPAPVRSVHTERRFPAGCQRLDGAAAV
FT                   DLLRQRYGLRDGGLDRDRNAARYAAGLLRQLREQGTATDPAQLGRLLLRIGPAVTADTG
FT                   DLSLPALVAAAGRTSAAEPVALAFPVRDEWNGRGYEPDPELAPGFLDALRADRLAQWAA
FT                   EHPGQVTALR"
FT   gene            complement(183873..184082)
FT                   /locus_tag="Micau_0184"
FT   CDS_pept        complement(183873..184082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43752"
FT                   /db_xref="UniProtKB/TrEMBL:D9T597"
FT                   /inference="similar to AA sequence:KEGG:Strop_0129"
FT                   /protein_id="ADL43752.1"
FT                   /translation="MGQPDEDFAPSDHLAPEERDLEAEPADAVEQATTVTDETDGEPHR
FT                   GMEVDDWDAMEQARVVAADEDDYR"
FT   gene            184221..184604
FT                   /locus_tag="Micau_0185"
FT   CDS_pept        184221..184604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0185"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43753"
FT                   /db_xref="GOA:D9T598"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:D9T598"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADL43753.1"
FT                   /translation="MGFLIRLAITAVALWIATLIVPGVEVSGRNTGSNVLTLIVVALVF
FT                   GVVNAVLKPLIKVFGCVFYLLTLGLFALVVNALLFLLTDWIAGVLKLPFHVDGFWAAFW
FT                   GAIVVAVVSWLISVIVPDRLENR"
FT   gene            184800..185822
FT                   /locus_tag="Micau_0186"
FT   CDS_pept        184800..185822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0186"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: saq:Sare_0135 fructose-bisphosphate aldolase;
FT                   TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43754"
FT                   /db_xref="GOA:D9T599"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9T599"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADL43754.1"
FT                   /translation="MPIASPEAYAEMLDRAKAGRYAYPAINVTSSQTLNAALKGFADAE
FT                   SDGIIQVSTGGAEYLSGPSVKDMVTGAVAFAAYAHEVAKKYPVNIALHTDHCPKDKLDK
FT                   FVRPLMAISQERVKGGQEPLFQSHMWDGSAVPVAENLEIAEQLLAEAAKGKIVLEIEVG
FT                   VVGGEEDGVENAINDKLYTTVDDGLAMVDALGLGEKGRYMAALTFGNVHGVYKPGNVKL
FT                   RPEVLKQIQDAVGAKYGKDKPLSLVFHGGSGSLLSEIREALDYGVVKMNIDTDTQYTFT
FT                   RPVADHMFRNYDGVLKVDGEVGNKKMYDPRVWGKAAEAGMAARVVEACEHLRSTGTTMK
FT                   "
FT   gene            complement(185915..187195)
FT                   /locus_tag="Micau_0187"
FT   CDS_pept        complement(185915..187195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_4735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43755"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A0"
FT                   /inference="similar to AA sequence:KEGG:Kfla_4735"
FT                   /protein_id="ADL43755.1"
FT                   /translation="MPAGLLSFSPPVSALAARGQDGLVPTPPPADVIEPHAPHVNEIET
FT                   RTAFEQRLAGGTLAGLTVQGLRLDLDPVPDLRDVDVTGTLFVGCRFAGREVGADLVRRG
FT                   ANVVPPFSGLPYPTQPSHLYTADELAAGFAEGGFAGMYDTRVYAHFREHGGALPDVREA
FT                   LGQRLHDHGVDNALADATRSWLAAHGPQSVVGVMGGHAVPRGSVAYRMAAVLGWELARA
FT                   DRLVVTGGGPGVMEAANLGAFLAAWPAEELSAAIDVLAVAPDFTDHDRYTAAALAVRKR
FT                   YADGPSLPSPRPSVPGTGWARSGGLAIPTWLYGHEPANLFAGRIAKYFSNAIREDTILR
FT                   LARGGIVFAPGKAGTVQEVFQAATKTFYGTDGASGAYVFLDRTYWTTELPVESLLRPLF
FT                   AASPFGDLSHTIHLTDDVRDAVRVLVQ"
FT   gene            187389..187817
FT                   /locus_tag="Micau_0188"
FT   CDS_pept        187389..187817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0188"
FT                   /product="protein of unknown function DUF3151"
FT                   /note="PFAM: protein of unknown function DUF3151; KEGG:
FT                   saq:Sare_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43756"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A1"
FT                   /inference="protein motif:PFAM:PF11349"
FT                   /protein_id="ADL43756.1"
FT                   /translation="MQNLLPEPPATLLPVHEEADAALAAAAEQGTDEAYAEVAARFPTY
FT                   SAAWAALAGRALTAGQVVTAYAYARTGYHRGLDQLRRSGWKGHGPVPWSHKPNRGFLRC
FT                   LYVLSRAAGEIGEADEAARCAQFLRDCDPAAGDALSGD"
FT   gene            complement(187869..189803)
FT                   /locus_tag="Micau_0189"
FT   CDS_pept        complement(187869..189803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0189"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="KEGG: saq:Sare_0137 chromosome partitioning ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43757"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A2"
FT                   /inference="similar to AA sequence:KEGG:Sare_0137"
FT                   /protein_id="ADL43757.1"
FT                   /translation="MVHENDDRAHVPGRPQVPQRDVEPLWPPEETDAAAATIPPWASVP
FT                   WPLPPADAPTPVAADVPAPQAPVAADVPAPQAPAVDLDLPFTLDRATSAPSPAQPEPAA
FT                   SGSPAVPGTPTAPVPATTPATGTTGPGTTGEGAGNGRPGSPWAQPPQRAGSDSATTPDP
FT                   ADATAPPSEAVEADGIASGRATVAPPPPEALSTDGTASGRATVAPPPPPDALPEDGTVS
FT                   GRATVAGTQPSPDSGTGPAGTGAPEQAPRLGPFPPSPGVPAQPSPYGNGYPSPGYQPQP
FT                   GQPGWYPPPGWTPQTGVPQPGGPLPPQAPVSGPVVPPPPQPGAPHPEQGWTPQQAVPPT
FT                   AEDFARRRQARPVDPVATMGVRAVVNKIGLVRLAPGRHEQEMKRDIEMVRRNFGGLRQV
FT                   TVVNPKGGAGKTVAILLLAMTFGQKRGGYVLAWDNNETQGTLGMRAQQDFHARTVRDML
FT                   RDLAQFQGPHGRVGDLSQYVRSQGEGMFDVLASDESATGGEMLTAAAFAEIREVVSRFY
FT                   KLIFVDTGNNVRAQNWQAAMDATDQLVVTMSARNDSAETAARMLDHLEQSGRQRLVRQA
FT                   VTVVSMPPSRKEIDLPAIQAHFAARTRAVLLAPYERLIDTGEPLRYGQLSSATRDAWLK
FT                   IAASVAEGL"
FT   gene            complement(189878..190876)
FT                   /locus_tag="Micau_0190"
FT   CDS_pept        complement(189878..190876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43758"
FT                   /db_xref="GOA:D9T5A3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A3"
FT                   /inference="similar to AA sequence:KEGG:Sare_0138"
FT                   /protein_id="ADL43758.1"
FT                   /translation="MYDVVLLTLGSERDAPGGGCGSGGACCGGADDTAAESGEERCETP
FT                   RVPVLACADELTARGARVTTVTARSDSEIDEVLARLDGPPRADGLTWPDSDGKTRLIVA
FT                   TASDGQLRAVLRRLVRRYAPPPSRRPADLAANRTVPDLPPVGVLPLDPARSGTARDLAA
FT                   QLGLPRDPAGVAAAVLDGTARRLDLLRNDGGSVTLDGALLGAADDAGRPLHWRARVEVD
FT                   GTVLSDGSEPITACAIGNAGGYARLGEVDLLGGPDPADGRVTVGVAVPVVTRSALGRKK
FT                   VRLEVRRARGRAVAVVPRDEKVPFLDDGVEGELSRKRSWWTEPGAWAVWTG"
FT   gene            190998..192287
FT                   /locus_tag="Micau_0191"
FT   CDS_pept        190998..192287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0191"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: saq:Sare_0139
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43759"
FT                   /db_xref="GOA:D9T5A4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A4"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADL43759.1"
FT                   /translation="MPAIVLLGAQWGDEGKGKVTDLLGERVDYVVRYSGGNNAGHTVIT
FT                   PDGQKYALHLMPSGALSPSAMIVIGNGVVVDPKVLLQEIDGLAERGVDVSRLRISGDAH
FT                   LIMPHHRALDRVVERYLGSSRIGTTGRGIGPAYGDKVARMGIRLQDLLDPGILRKKLEL
FT                   ALREKNQLLFKVYNRKAIDVEETVEEYLQYAERLRPYIAETRVMLWDALDRGETVLLEG
FT                   AQATMLDMDHGTYPFVTSSNPTAGGACVGAGIPPTAITKVIAVSKAYTTRVGSGPFPTE
FT                   LFDDNGQHLRKVGHEYGTTTGRERRCGWFDAVVARYACRLNGVTDLVVTKLDVLTGLAK
FT                   VPICVGYEINGERFDDMPMTQTDFHHATPIYEELDGWWEDITKARTEDELPENARRYIA
FT                   RIEELTGTRVSVVGVGPGREENVLRHSLLP"
FT   gene            192504..193427
FT                   /locus_tag="Micau_0192"
FT   CDS_pept        192504..193427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_0865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43760"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR018547"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A5"
FT                   /inference="similar to AA sequence:KEGG:Bcav_0865"
FT                   /protein_id="ADL43760.1"
FT                   /translation="MGEFGELTRLAATQGGFVTAGQALRLGLGREQIRYLVRSGRWTRV
FT                   SRGCYLPSPAVLTPVALRRAMIRATVASLGRGAVAVLGTAAELHGIAGLPPTAAIHVSV
FT                   PPDRPHVQRRAEPGLTVHQLTLAEADVCRAGGVPVTTPARTVADVLLRARRYPAVCVLD
FT                   SALNQRILAENDLSLVLTHLTGRRGAAAARGYLAEADGRAQSPLETRARLRCVDGGVPP
FT                   DVLQLPVRDEDGYLLGVGDLAWRGARLIAEADGRGPHLTLQAVYADRFRQNRLVNAGWR
FT                   ILRFTWSDTLRPDYIPQTVKRALKRR"
FT   gene            193518..194765
FT                   /locus_tag="Micau_0193"
FT   CDS_pept        193518..194765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0193"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="PFAM: Phosphoribosylglycinamide synthetase,
FT                   ATP-grasp (A) domain; Phosphoribosylglycinamide synthetase,
FT                   N-domain; Phosphoribosylglycinamide synthetase, C-domain;
FT                   manually curated; KEGG: saq:Sare_0140
FT                   phosphoribosylamine--glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43761"
FT                   /db_xref="GOA:D9T5A6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A6"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADL43761.1"
FT                   /translation="MRVLLVGGGGREHALALGLAGDPAVEALVAAPGNPGIAAVAELRE
FT                   VTPTDPAAVAALAVEVAADLVVIGPEAPLVAGVADAVRAKGIAVFGPSAEAARLEGSKT
FT                   FAKDVMTAAAVPTARAYTCEDAAAVGRALDEFGAPYVVKDDGLAAGKGVVVTDDRAVAE
FT                   RHAAECGRVVIEEYLSGPEVSLFVVTDGEAAVPLLPAQDFKRVGDGDTGPNTGGMGAYA
FT                   PLPWAPPNLVDDVMRDVVRPTLAELRRRGTPFAGLLYVGLAITPSGPRVIEFNARFGDP
FT                   ETQVVLALLETPLAGLLHAAATGTLGAHPPLRWRDGAAVTVVVAADGYPAGPRTGDVIT
FT                   GADRAGIIHAGTRRDADGTLRSAGGRVLCGTATGPDLAAARDAAYALVRNVELAGSHHR
FT                   TDIAAAAVDGRVTIPG"
FT   gene            complement(194749..196251)
FT                   /locus_tag="Micau_0194"
FT   CDS_pept        complement(194749..196251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_47721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43762"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A7"
FT                   /inference="similar to AA sequence:KEGG:SCAB_47721"
FT                   /protein_id="ADL43762.1"
FT                   /translation="MDRLRRRTALGLLVGGASAAALGPFDPVLGGRPDDSPTRWPVPPV
FT                   ERENRAAGEPWWPEHGGRAADDRRRQIQGYASTTSVAPGEEIDFHVAVNPGGRFRISVH
FT                   RLGWYDGAGARTMLTSPELRGVPQPVPVADPDTGVLDCRWPVSWRLSVPHGWTSGLYQA
FT                   VFTSADGWRACTPFVVRDDRRPAALCVVLPVTTWQAYNQWPRDRRTGKSLYNGYRADGR
FT                   RDPALRARAVTFDRPYSGAGLPTHFDRDEAAIRWLERNLYDVSYATSFDLHSGRLDPAR
FT                   YRGLVFCGHDEYWSAEMRRATEVGLDGGTSLAFLGANSVYWHARVRAAADGRPERLVEC
FT                   AKTLPDPGAGIGDPTVTWRNLDRPEQALLGVQYNGIVLTPQPLVVRAADNWVWAGTGVA
FT                   DGDRIPGVVAGEADGLHAALPRPAGTTLSSSPYPAQQGGRRLQSSYVHETARGAVVFAS
FT                   GTLGWTLALDRQGHRDPRIERATANVLNRMAGRRPGPVSPES"
FT   sig_peptide     complement(196192..196251)
FT                   /locus_tag="Micau_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.266 at
FT                   residue 20"
FT   gene            complement(196329..197894)
FT                   /locus_tag="Micau_0195"
FT   CDS_pept        complement(196329..197894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0195"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   tcu:Tcur_4678 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43763"
FT                   /db_xref="GOA:D9T5A8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR037337"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADL43763.1"
FT                   /translation="MDLPFIAATLTRRGLLAPGGPIRVVSQLNALRRWGWSLAGELRQA
FT                   AARDPGRVAVVDEQGATMTYQELLDRSERLARSLRSHLGVQTGDRVGVLCRNHHGLIEA
FT                   IVAAMLLGADAVLVNTGLSAAQLVTVAEEQGLRVLVHDGEFTERVLGLPAELHRVDERR
FT                   QEELIAAAVPGEKLQPPERDGRTIVLTSGTTGAPKGARRPTPHGFGPLVSIIDRIPLHA
FT                   RDTVMIAAPIFHTWGYAALQVSFALRATVVLHRRFDPAATLAALAAQPCDAMFAVPVML
FT                   QRLMEVAPPQPRPPLKVVAVSGSALPGNLATAFMDRYGDVLYNLYGSTEVSWASIAGPA
FT                   ELRAAPTTAGRPPHGTRLAILDETGRPVRDGEVGRIFVGNEMLFEGYTSGAGRESRDGL
FT                   LDTGDLGRLNADGLLFVDGRADDMIVSGGENVFPSEVEDLIARLPQVREVAVIGVPDPD
FT                   YGQRLAAFLALRTGETLDPEAVREYVRRYLARFSVPRDVVFVKYLPRNATGKVLTRELR
FT                   RYFD"
FT   gene            complement(198062..199276)
FT                   /locus_tag="Micau_0196"
FT   CDS_pept        complement(198062..199276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0196"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: saq:Sare_0142 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43764"
FT                   /db_xref="GOA:D9T5A9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5A9"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADL43764.1"
FT                   /translation="MAEFSLDLNEEQRDLRDWVHGFAAEVVRPAAAEWDAREETPWPII
FT                   QEAAKVGLYGFEFLATCWADPTGLSLPIASEELFWGDAGIGLSIFGTSLAVAAIYGAGT
FT                   PEQLVEWVPQCFGDVDSPAVAAFCTSEPEAGSDVGSMRTRAVYDEATDEWVLNGQKAYA
FT                   TNGGIAGVHVVTASIEPELGSRGQAAFVVPPGTPGLTATRKLRKLGLRASHTADVFLDD
FT                   VRVPGRCLLGGKDALDERLARARSGQRASGQAAMRTFELSRPTVGAQALGVARAAYEYA
FT                   LDYAKERVQFGRPIISNQAVAFALADMKMEIDAARLLVWRASWMGRNNRPFTAGEGSMS
FT                   KLKAGEVAVSVTDKAVQLLGGAGFLRDHPVERWYRDAKIYTIFEGTSEIQRLVISRAIS
FT                   GMQIR"
FT   gene            complement(199278..199730)
FT                   /locus_tag="Micau_0197"
FT   CDS_pept        complement(199278..199730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0197"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   saq:Sare_0143 sterol-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43765"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B0"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADL43765.1"
FT                   /translation="MTDFDPANFANVGPKEFAQLVKSTPDAKINEIMSGEARGKILSEV
FT                   FNRMPTLFRADRAGATNAVIHWNITGRPDGGTDTYEIVIENGTCTVSETATRDPKLSLT
FT                   MGPVEFLKIVSGGANPVMMFMTGKLKAKGDLGLAANIANLFDIPKA"
FT   gene            199797..200450
FT                   /locus_tag="Micau_0198"
FT   CDS_pept        199797..200450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0198"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: saq:Sare_0144
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43766"
FT                   /db_xref="GOA:D9T5B1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL43766.1"
FT                   /translation="MLARVSSTPTFKRLPRAVREQQMLDAAVKVFSRRGFHAASMDEIA
FT                   DDAGISKPMVYAYLGTKEELFIACLHRESTRMMEAIAGAAAPDLPADERLWRGLRAFFG
FT                   FVGAHRDGWAVLYRQARGSQPFAAELAAMRGRLVEVVAGMLDHALRASGREVGATDLEV
FT                   VAYGLVGASESLADWLADHPEADAGKTATRMMNVAWLGADQLLRGVTWHPPAAG"
FT   gene            complement(200496..201119)
FT                   /locus_tag="Micau_0199"
FT   CDS_pept        complement(200496..201119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0199"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   stp:Strop_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43767"
FT                   /db_xref="GOA:D9T5B2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B2"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADL43767.1"
FT                   /translation="MGDVLDLLHHTVTSPWVYLVIIAVTAVDAFFPAVPGETVVITAGV
FT                   FAAGGEPNLVLVIVTAAFGALAGDHISYAIGRGGGAHRLARFPADSRRRASSEWARRAV
FT                   DRRGGMILTTARYVPGGRTAVTLTMGAVRYPARTFLLYDGLACATWGVYCGLLGYFGGL
FT                   AFEHNPLSGLLAGVAISLAVTGLFEAVRWGRRRAHRRAAARRDC"
FT   gene            complement(201144..202403)
FT                   /locus_tag="Micau_0200"
FT   CDS_pept        complement(201144..202403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0200"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   sro:Sros_8967 adenylosuccinate synthase; SMART:
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43768"
FT                   /db_xref="GOA:D9T5B3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B3"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ADL43768.1"
FT                   /translation="MNHVTVVDLGYGDAGKGTVVDLLCATRQVHTVVRFNGGAQAAHNV
FT                   VLRDGRHHTFAQFGAGTFRPGVRTHLARHVVVDPLALAAEADHLASVGVPDALDRLTVD
FT                   GEALLATPYHRAANRAREIARGADRHGSCGLGVGEAVAYGLAHPDEAPRVADCRRPAVL
FT                   RRRLTALRDRLTAELGPLDAPPVDDCLPAYAAFARRVAIVDRTWLAGALREGTCVFEGA
FT                   QGVLLDEWHGFHPYTTWSTTTFANAETLLAEAGMAGTAQRLGVLRTTTTRHGPGPLVTE
FT                   DAALPFRDRHNGTNPWQGRFRFGHFDAVAHRYALEVAGGVDGLALTHLDLARPELRICR
FT                   RYEGLDRLVPGPAGDLDRQAALTERLMRARPVLSESPSDWPAAVSEALGAPVVLTSRGP
FT                   TAEEKEGPLVNAFCMGRAPA"
FT   gene            complement(202400..203359)
FT                   /locus_tag="Micau_0201"
FT   CDS_pept        complement(202400..203359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43769"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B4"
FT                   /inference="similar to AA sequence:KEGG:Sros_8966"
FT                   /protein_id="ADL43769.1"
FT                   /translation="MGSGIWSTDVYDAADRYRRRTGKSAFSYSDSGARKVHPALDPRDA
FT                   LRESRDSAEHPQSTPIAVLFDVTGSMGHVPRVLQSKLPQLLGLLLRQGYAKDPQVMFGA
FT                   IGDATCDRVPLQVGQFESDNRMDDDLGRIVLEGGGGGQMMESYELALYFMARHTATDSW
FT                   DKRGRRGYLFIIGDELAYPAVKTAEVSRLIGDGLGEDMPVRQMVDEVTARWDTYYLLPA
FT                   GSHYAGNRKVLDFWRGLLGQNAVELDDLDAVCETIALTVGLGEQAIDLDAGLRDLDRAG
FT                   STATRTVSKALAQVGSGRRAVATLPFSPADGGSGVTRL"
FT   gene            complement(203370..204353)
FT                   /locus_tag="Micau_0202"
FT   CDS_pept        complement(203370..204353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43770"
FT                   /db_xref="GOA:D9T5B5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B5"
FT                   /inference="similar to AA sequence:KEGG:Ndas_0835"
FT                   /protein_id="ADL43770.1"
FT                   /translation="MRTEEAIRLVTAARTDADLFGTQEPARRYRELVGALHPDRLGAAD
FT                   PGVRAAAADALVTVTTRWRTPAPTYTGDVATLHERKEGPPVNASGRGGAPSYHLAKVCR
FT                   HPSDNDLMAREARALRRIAERGDAKHLAYVPRLVDSYPARDPSTGVQRQVNELVTVPGL
FT                   RSLDDVRRAYPDGLDPRDAAWMWRRLLVALGLAHRAGVVHGAVLPRHVLIEPDAHGLVL
FT                   VDWCFSAEPGGLVPALVPGHEDWYPPEVAAKRQCGPGTDIALAARCMTWLMGDRAPREL
FT                   RAFADGCQGTALATRPDDAWRLLRELDEVLHRLYGPRTFRPFTLNP"
FT   gene            complement(204350..205108)
FT                   /locus_tag="Micau_0203"
FT   CDS_pept        complement(204350..205108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0203"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: tcu:Tcur_3138 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43771"
FT                   /db_xref="GOA:D9T5B6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL43771.1"
FT                   /translation="MAVNEQEFLAGYDPRDYPAVAVTVDVVALTIREGALHLLLIRRGA
FT                   PPYEGHWALPGGFVQPDEDLAAGARRELAEETGLGGERLRRVHLEQLGSYGAPDRDPRM
FT                   RVVSVAHLAFAPDLPDPVADTDADEAIWLPVTALTSRQLAFDHGRIIDDGLERARSKLE
FT                   YTPLATRFLAPEFTVTELREVYETVWGHPLHAGNFHRKVLSVPGFVESTGASTERGGAR
FT                   GGPRAKLYRAGDARLLHPALLRPAREETVR"
FT   gene            complement(205189..206277)
FT                   /locus_tag="Micau_0204"
FT   CDS_pept        complement(205189..206277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0204"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   stp:Strop_0140 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43772"
FT                   /db_xref="GOA:D9T5B7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B7"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADL43772.1"
FT                   /translation="MAPRDHEDDDLTLHDLIEGPTRDLTAARAAAQAQSHPTQAHPSSD
FT                   DHEVDGTSGDPQGSQPHDRRGEGEREEAGSEGRRRVALSRLPASGALYRRALLGVVPGV
FT                   GGRRGADVPGLELGVSGVAVDQRHLADYDRVCGFRLTDRLPATYLHVLGFPLSLRLMTG
FT                   PGFPIPLTGVVHVANRITVHRPVEVGESVDFHTYAENLRPHERGRQLDVVLVGSIGGEE
FT                   VWRGVSTYLGKERAAGGGPRRDRGDRPAPPAASARWRVTPRVGTDYARVSGDHNPIHTS
FT                   KLGARLFGFPRPIAHGMWSKARCLAALEPRLPEAYTVDVSFKLPVPLPSTVAFSASPTG
FT                   EGWDFALHSARDGRPHLVGSVR"
FT   gene            complement(206277..207635)
FT                   /locus_tag="Micau_0205"
FT   CDS_pept        complement(206277..207635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0205"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   saq:Sare_0147 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43773"
FT                   /db_xref="GOA:D9T5B8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL43773.1"
FT                   /translation="MTDRYASFVQTGAGRALVKRLGLPDPPRLRRHTPGDPLVPGPVLL
FT                   GSSASGRIAEPAGKILTAAGVELADPVAAHDADRRFAALVYDASGITDSAGLRQLYDFF
FT                   HPQARSLLPSGRVIVLGTPPAECGSPREATAQRALEGLTRSIGKEFGRGVTAQLVYVTR
FT                   EGDAGTPVSLESTLRFLLSGRSAYVSGQVVRVGTGTAVAPADWDRPLSGQVVLVTGAAR
FT                   GIGAALAKVLARDGAQVVALDIPAAGDELAAVANDIGGSAVQLDLTAPDAPTRLAEHLA
FT                   SRHGRVDVVVHNAGITRDKTLGRMDADRWDSVIDVNLSSQERINDVLLERDLIPAGGRI
FT                   VSVSSIAGIAGNRGQTNYATSKAGVIGLVDSLSPVLRERGISLNAVAPGFIETRLTARI
FT                   PLTIREAGRRMNSMAQGGLPVDVAETIGWLSWPATGAVSGNVVRVCGQSLLGA"
FT   gene            207691..208983
FT                   /locus_tag="Micau_0206"
FT   CDS_pept        207691..208983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0206"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   stp:Strop_0142 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43774"
FT                   /db_xref="GOA:D9T5B9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5B9"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADL43774.1"
FT                   /translation="MQSVRRVAVIGGNRIPFARSNSRYAHASNADMLGAALDGLVARFG
FT                   LAGERVGEMVAGAVLKHSRDFNLTREVVLGSRLDPHTPAYDIQQACGTGLEAAILVANK
FT                   IALGQIEVGIAGGVDTTSDAPLAVNEDMRRTLIQLNSARTLGERLKIAAKLRPHQPFKP
FT                   EIPRNAEPRTGLSMGEHAARTALRWNVDRAAQDELALRSHQRLAAAYDKGFFDDLMTPY
FT                   LGLTRDQNLRPDTSLEKLGSLKPVFGASGADAERATMTAGNSSPLTDGASTVLLASEEW
FT                   AKAHNLPVLAWFSWSEAAAVDFVHGDEGLLMAPAYAVPRMLARAGLSLQDFDFYEIHEA
FT                   FASQVLATLAAWESPEFCKERLGLDAPLGSIDRDKLNVNGSSLAAGHPFAATGGRIVAT
FT                   LAKLLDQKGSGRGLISICAAGGQGVTAILER"
FT   gene            209077..209592
FT                   /locus_tag="Micau_0207"
FT   CDS_pept        209077..209592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0207"
FT                   /product="RNA polymerase sigma-70 factor, sigma-E family"
FT                   /note="KEGG: cai:Caci_1784 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43775"
FT                   /db_xref="GOA:D9T5C0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C0"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADL43775.1"
FT                   /translation="MTGRDEEFRDYVTARLEPLRRTAYLLCRDWHTADDLVSITLSKLY
FT                   RNWRRALGADNLDAYVRGMLTNAWLDERRRPWRRERSTDEVPDRADLAAGEPSVGEREM
FT                   LLELLGRLAPRRRAVVVLRFYCDLSVEETAQILGVSTGTVKSQAARALETLRLLASHHS
FT                   AAESGRQR"
FT   gene            209589..210335
FT                   /locus_tag="Micau_0208"
FT   CDS_pept        209589..210335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43776"
FT                   /db_xref="GOA:D9T5C1"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C1"
FT                   /inference="similar to AA sequence:KEGG:Cfla_2180"
FT                   /protein_id="ADL43776.1"
FT                   /translation="MTYRQIFDEAIGDAPPTTVDVDALVAREGRRRRRTVGAYASATAV
FT                   LALALGVGVVVQPGASGGPAPAHSAASAAARTEPERLRAAMLAAFHREAPDLRWVQGAS
FT                   TGDRETWDGPVTDEPPWWVQRLQWESATGWLAVGVAARGEVRSYLNINVGRVRPGHTSG
FT                   PDRCRPGEVTCRSFTGPGGELVVAHDAEGRNLAKPVTKRTVLRTVTVKRADGAFVSVQT
FT                   VSSTDRHLMTVEEMAAVALDPEIRLG"
FT   gene            210424..211848
FT                   /locus_tag="Micau_0209"
FT   CDS_pept        210424..211848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0209"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: saq:Sare_0154 adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43777"
FT                   /db_xref="GOA:D9T5C2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C2"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADL43777.1"
FT                   /translation="MTTIPNVLANRYASPELVALWSPEEKVRMERRLWLAVLKAQRDLG
FT                   VPVPDGVVEAYERVVDQVDLASIAARERVTRHDVKARIEEFSALAGHEHVHKGMTSRDL
FT                   TENVEQLQIRASLELIRDRVVATLARLGWHAGEYSALVMTGRSHNVAAQATTLGKRFAS
FT                   AAEELLIAYERLEDLIGRYPLRGIKGPVGTAADQLDLFDGDAAKVAELEQRVAGHLGFR
FT                   RVLDSVGQVYPRSLDFDVLSALAQVAAAPSSLATTIRLMVGQELVTEGFKPGQVGSSAM
FT                   PHKMNTRSSERVNGFAVIIRGYLSMVGELAGDQWNEGDVSCSVVRRVALPDAFFAADGL
FT                   FQTFLTVLDEFGPYPAVINRELERFLPFLATTKILVAAVRRGVGREVAHEVIKEHAVAV
FT                   ALAMREKGAAENDLFDRLAADGRLGLTRAEIDTLVADRNAFVGAATDQVARVTARITRV
FT                   VESHPQAAAYSPPPIL"
FT   gene            complement(211952..212401)
FT                   /locus_tag="Micau_0210"
FT   CDS_pept        complement(211952..212401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0210"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   stp:Strop_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43778"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C3"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ADL43778.1"
FT                   /translation="MTTDQLPGYEIRQILGEVVSSMARTRNPYREGVKNLRGGAYDPMA
FT                   PDNLTRWRTDSVARLGEEARRLGANAVIGMRFDSRDCGEMWMEICAYGTAVIVAPKMPD
FT                   VMPPDQPAIAAETAHEPEIASAPGGIAEPASAPNLSSAAETPTGP"
FT   gene            complement(212540..213223)
FT                   /locus_tag="Micau_0211"
FT   CDS_pept        complement(212540..213223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0211"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="KEGG: saq:Sare_0156 peptidase S1 and S6
FT                   chymotrypsin/Hap; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; SMART: peptidase S1 and S6
FT                   chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43779"
FT                   /db_xref="GOA:D9T5C4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C4"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADL43779.1"
FT                   /translation="MRLRPLLAVLTTALAGVLATASGATAAPAGPQPIIGGGTVSSAPW
FT                   AAAVFSNGSFTCSGSVIAPQWVLTARHCVSGTMSVRVGSVYYASGGVTRTVSASYTRYD
FT                   LALLRLSSTVSTSAVSLASSNPPVGSTNTIYGWGMTCYSGCGASPQLKTASVRVTSTSV
FT                   TDAYGGQAIRSTRVNGNAWRGDSGGPQFYNGRQVGVASTADGQSIQDYGSVAYNRAWIT
FT                   STAGV"
FT   sig_peptide     complement(213143..213223)
FT                   /locus_tag="Micau_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 27"
FT   gene            213694..213957
FT                   /locus_tag="Micau_0212"
FT   CDS_pept        213694..213957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0212"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: saq:Sare_0157
FT                   phosphoribosylformylglycinamidine synthase, PurS; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43780"
FT                   /db_xref="GOA:D9T5C5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C5"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADL43780.1"
FT                   /translation="MPRVVVDVMLKPEILDPQGQAVANALPRLGVSDVASVRIGRRIEI
FT                   EFTGEPDLDRAREIADKLLANPVIEDFTVHVVTADETAGAQS"
FT   gene            213954..214637
FT                   /locus_tag="Micau_0213"
FT   CDS_pept        213954..214637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0213"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: saq:Sare_0158 phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43781"
FT                   /db_xref="GOA:D9T5C6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C6"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADL43781.1"
FT                   /translation="MTARVGVVTFPGSLDDGDAARAVRIAGAEVVRLWHGDPDLHGVDA
FT                   VVLPGGFSYGDYLRCGAIARFAPVMETIVQAARGGLPVLGICNGFQILCEAHLLPGALT
FT                   RNQHLHFRNRDQVLRIESTGTAWTNAFQPGQEVLIPVKNGEGCYVADPATLDRLEGEGR
FT                   VVARYVGGNPNGSQRDIAAITNEAGNVVGIMPHPEHAVEALTGPSLDGLGFFTSVLKHL
FT                   VGAPA"
FT   gene            214702..217413
FT                   /locus_tag="Micau_0214"
FT   CDS_pept        214702..217413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0214"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; KEGG: saq:Sare_0159 phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43782"
FT                   /db_xref="GOA:D9T5C7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C7"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADL43782.1"
FT                   /translation="MTTHPDPALREPQGVVPQAGPTDDWALGVDTVPRAADSPEELQPY
FT                   AELGLRDDEYDRIRHILGRRPTQAELAMYSIMWSEHCSYKSSKVHLRQFGEKAPPSDRL
FT                   LAGIGENAGVVRVSDELAVTFKVESHNHPSFVEPYQGAATGVGGIVRDILAMGARPVAV
FT                   MDPLRFGAADHPDTARVLPGVVAGVGGYGNCLGLPNIGGEVVFDPCYQGNPLVNALCLG
FT                   VLPVDRLQKKDATGPGNIVVLMGAKTGRDGIGGVSVLASATFDEGSEQRRPSVQVGDPF
FT                   MEKLLIEACLELYDAELVVGIQDLGGAGLTCALTETAASAGTGMRVWLERVPLREPSME
FT                   PHEILASESQERMLLVVSPDKLDAVLKTAEKWGVWATAIGEVTAPSADGQPGRLVVTWR
FT                   DQLVVDVPPGSLVDDGPVYARPMREPADLILLQADRAETLPRPSTPEALRETVLRMIAS
FT                   PNLADKTWVTEQYDRYVLGNTVLAQPEDSGVIRIDERSGLGVALSVDGNGRYARLDPYH
FT                   GTKLALAEAYRNVAVTGAKPIAVTNCLNFGSPEDPGVMWQFAEAVRGLADGCLELGIPV
FT                   TGGNVSFYNQTGAAAIHPTPVVGVLGVLDDVADRVPIGFVPRPAGDHDQLFLLGETHVE
FT                   LSGSEWAWVTHEHLGGIPPQVDLARERQLAELLAEAARVGHLSSAHDLSDGGLAQSLVE
FT                   SALRRGVGARVVVPEHFAGGSMPFVFLFSESAGRVLVSVPRGHEKAFTALCAERGVPWE
FT                   FIGVTDPASGGLEVHGQFRIGLDELREAHTGTLPRLFGAAEAARVEVEATRTGTTTVLP
FT                   ATAEQPVGVDPAAVDAEPIAKAGRDTPAADAEASAPAAAAEPEASAAASDEAEPAEGTA
FT                   TPAVDGNPAQDESAPADGSDAPAPGEPAPGQR"
FT   gene            217424..218173
FT                   /locus_tag="Micau_0215"
FT   CDS_pept        217424..218173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0215"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: saq:Sare_0160 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43783"
FT                   /db_xref="GOA:D9T5C8"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C8"
FT                   /inference="similar to AA sequence:KEGG:Sare_0160"
FT                   /protein_id="ADL43783.1"
FT                   /translation="MAVFAQPGAGARFDWGLTGAAELGRVCAALVVVDVLSFTTAVEVA
FT                   VSRGMRVHPFPWGEQAADYARRVGAVAAVGRRKTTAEHQWSLSPAALRAAPVVADLVLP
FT                   SPNGSAISAAASATGVPVVAACLRNAPAVGRWLRTEGYGSKDAPVGVVAAGERWPDGSL
FT                   RPCVEDQLGAACVLDALADVPGGLSVEAAMALAALASTPDVPAAVRGCVSGRELAEGGF
FT                   AEDVTVATEVGVSDVVPVLRQGYFAPA"
FT   gene            complement(218264..220576)
FT                   /locus_tag="Micau_0216"
FT   CDS_pept        complement(218264..220576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43784"
FT                   /db_xref="GOA:D9T5C9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5C9"
FT                   /inference="similar to AA sequence:KEGG:Strop_0153"
FT                   /protein_id="ADL43784.1"
FT                   /translation="MSTHRRAWKQRAGVVVALVFGALLTVPAAPAFAEPPEVSVNPSSL
FT                   TISADSDASIQVRVKVTDSGPTQVTIRVAGLPSGVTCSAGCNAPVAVVGQRNVPVTLKA
FT                   SSGASATDGANVQFTAETPTDSNSAALSLTVRAAAPPSQQPQTVKTVSGKVVNADGDPI
FT                   EGALVMLRDSAGKERRTNTSGNGNFSFSGSESNPIAPGRIDLGASTDGASPVARSINAN
FT                   AGQSVTGVRLSIQVKASASPSATPSASESAPPSEEPLDEEATDTPSAEAPAAQQPAANE
FT                   DSGGFGSWLLILLGGLFVAVGVGTIVLLYMRRKNEGDDGDGDGPGGPTGPGGPGAAGAI
FT                   PAARGAYHGTDDQTRVVNGMGAPAATMVGGPSISDAPTMLQRPVVDDVPPDPYGAPPGP
FT                   AYGAGGGQGGYGYGDDAAGQGGYGGAGGYGNAPSSGGGYGNGPSSGAGYGNPDYAAGAA
FT                   AGAAGYAAQGGGYGNERFDEPTGRYTGDSTQYAPAADPYPTSTYQPEQDRGYDQSGSAP
FT                   YGRGPEQGDAYGAAGGYGAASGGYDNGATGGYDSTRQQGGYGEPTGAYGNAAGGGYGDN
FT                   PTGGYGDAPAYGGGRAAGGGYGDAPTGGYDNAPAGGYGDAPAGGYDSTRQQGGYGDAPA
FT                   GGYDNPAGGYDSRSQAGYDKGAGGYDSGATGGYDSTRQQGGYGDAPAGGYGNAGGGYDG
FT                   GHQAGGYGQQGGGYGEGYGQNPQGGYGQQGGYGQEPPQQRGGGYDNGYPNDPAQAGRAR
FT                   PDGQADRSGRRLDWLDD"
FT   sig_peptide     complement(220475..220576)
FT                   /locus_tag="Micau_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.992 at
FT                   residue 34"
FT   gene            221259..222776
FT                   /locus_tag="Micau_0217"
FT   CDS_pept        221259..222776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0217"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: saq:Sare_0163 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43785"
FT                   /db_xref="GOA:D9T5D0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D0"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADL43785.1"
FT                   /translation="MPRGDGRLSHDLDPQRPGPQDACGVFGVWAPGEEVANLTYFGLYA
FT                   LQHRGQEAAGIAVSDGSGVVVYKDLGLVAQVFDEPTLASLRGHVAIGHARYSTTGGSTW
FT                   ENAQPTIRATTAGTTIALAHNGNLVNTAELQREAAVRGLDSDGSTNDTSLVTMLLASRP
FT                   DLSVEAAALEVLPQLRGAFSFVFMDESTLYAARDAHGVRPLVLGRLERGWVVASETAAL
FT                   DIVGASVVREVEPGELIAIDENGLRSSRFASPEPKGCLFEYVYIARPDATIAGRNVHAA
FT                   RVQIGRQLAKEHPVEADLVIPVPESGTPAAIGYAEESGITYGQGLMKNPYVGRTFIQPS
FT                   QTLRALGVRLKLNPLRQNVRGKRLVVVDDSIVRGTTQRAIVRLLREAGALEVHVRISSP
FT                   PVSWPCFYGIDFATRAELLANGLDNDGIRRSIGADSLGYVSLPGLIAATEQPKSRLCRA
FT                   CFDGEYPIELPAGNLIGKHVLEGVGRRVAAEAAGPTGPLVATPTHHP"
FT   gene            222834..223988
FT                   /locus_tag="Micau_0218"
FT   CDS_pept        222834..223988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0218"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: stp:Strop_0155
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43786"
FT                   /db_xref="GOA:D9T5D1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D1"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADL43786.1"
FT                   /translation="MTHVSERSGAGSSPTGAGGDRQPWSAGSGRTQRKRSVSYADAGVS
FT                   IEAGDRAVELLKSKVKETRRPEVMGDLGGFAGLFRLDTKKYKNPILASSTDGVGTKLVI
FT                   AQQLDIHDTVGIDLVAMVVDDLVACGAEPLFLLDYIATGEVVPDKVAEIGAGIADGCRY
FT                   AGCALLGGETAEHPGVLRPDEYDISATGVGVVEESEILSPERVEVGDVVIAMRSSGLHS
FT                   NGYSLVRHVLLGAGRMRLDVVIDDFGRQRTLGEELLTPTKIYAQDCLKLIAEAEVRALA
FT                   HVTGGGIPGNLVRVLPEHVDAVVNRSTWKPQPIFDLIQSKGRIEDPEMEATFNMGVGMF
FT                   AIVSAEDADRALATLTGRGVDAWQAGEIIEGSGNVQMVGQHTRG"
FT   gene            224092..225207
FT                   /locus_tag="Micau_0219"
FT   CDS_pept        224092..225207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0219"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: saq:Sare_0165 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43787"
FT                   /db_xref="GOA:D9T5D2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL43787.1"
FT                   /translation="MAARTPGGMRGISAVPSYVVMQPTTLCNLDCAYCYLPFRAVDRRM
FT                   PVAVAEAVAASVNPWAAGGRFSVVWHGGEPLAAGREHLAALLAPFGPDVEHHVQTNATL
FT                   IDDAWCAFFAEHRVRVSISVDGPRARNGERVTRGGRPAYDRIVAGVAALRRHGLPFSAL
FT                   AVVSRPEPGLATELYDYFLDLGCDVLGVNIEETEGVNTRTNARDEGAVTGFWAELVAAW
FT                   RRDPRIHLREVEWSLRYAGAVLAGTADDLLPRSLDPIPTVGHDGSVVVLSPELAGFTDP
FT                   RYGDFASGNVLTTPLGDILAGAAGTPWVGEFLTGVEACRASCAYFGFCGGGHAANRYFE
FT                   LGRFDGTETEHCRNSKIRLLEGVLEHARDHQ"
FT   gene            225188..225400
FT                   /locus_tag="Micau_0220"
FT   CDS_pept        225188..225400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43788"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D3"
FT                   /inference="similar to AA sequence:KEGG:Sare_0166"
FT                   /protein_id="ADL43788.1"
FT                   /translation="MPETISDTDREAVADRVRDAAAGLTALLREAEAARLLRAEVSGGD
FT                   GADAVCAWNHFENIPTFYNWNNRPR"
FT   gene            complement(225551..225766)
FT                   /locus_tag="Micau_0221"
FT   CDS_pept        complement(225551..225766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0221"
FT                   /product="Protein of unknown function DUF3073"
FT                   /note="PFAM: Protein of unknown function DUF3073; KEGG:
FT                   stp:Strop_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43789"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D4"
FT                   /inference="protein motif:PFAM:PF11273"
FT                   /protein_id="ADL43789.1"
FT                   /translation="MGRGRAKAKQTKVARELKYHSPNTDLTALQRELAGSGKSEHNFDD
FT                   DYKEYVDDDDEDHADDDPDTWARPTR"
FT   gene            complement(226058..227140)
FT                   /locus_tag="Micau_0222"
FT   CDS_pept        complement(226058..227140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0222"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerization
FT                   region"
FT                   /note="KEGG: saq:Sare_0168 Glu/Leu/Phe/Val dehydrogenase
FT                   dimerization region; PFAM: Glu/Leu/Phe/Val dehydrogenase
FT                   dimerization region; Glu/Leu/Phe/Val dehydrogenase; SMART:
FT                   Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43790"
FT                   /db_xref="GOA:D9T5D5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D5"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ADL43790.1"
FT                   /translation="MGVFASTDDPVSTGHEQVVFCQDKQSGLKAIIGIYSTALGPALGG
FT                   TRFYPYASEAEALADVLDLSRGMAYKNALANLDLGGGKAVIWGDPEQIKSEALLRAYGR
FT                   FVEALNGRYYTACDVGTYVADMDVIARETRYVTGRSVEHGGAGDSSILTAWGVFQGMRA
FT                   AAEHVWGSPTLAGRRVGVAGLGKVGKYLTAHLLDDGAEVVATDVSPRALEWARTTHPQV
FT                   TLVDDTEALVTSDIDVYAPCALGGALNDDTVPVLRAKVVTGAANNQLAHPGIEKVLADR
FT                   GILYTPDYVVNAGGVIQVADEIEGFNFDRAKLRATRIFDTTRQILQLADDEGVPPAVAA
FT                   DRLAERRMAEVGRLRTIHLR"
FT   gene            227316..228155
FT                   /locus_tag="Micau_0223"
FT   CDS_pept        227316..228155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43791"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D6"
FT                   /inference="similar to AA sequence:KEGG:Sare_0169"
FT                   /protein_id="ADL43791.1"
FT                   /translation="MPSLFASYLRVYEPLTAFDRDRQSYWRRYVSEGRAIAPLEGPVRQ
FT                   RTAVIEALGAGWTRLPDLPDEAYVLESDDALLVCPWNLRIRVAEAALSARDGVPSVLAD
FT                   AFVPPVLAGQAKAVVEDWRSGARVLEHGVPRVHEQIATWGVPLRWFVLFEAGERHLVTE
FT                   PERRALRYRTEISKARRRASRALSVLRKSIGEAPITEAVEEAARWLEEFHPRSVVELDY
FT                   GGLVQLLPDETLEADDSTELVATGLSGLGRGEAEEASAAYDKLVARWRAVQLLERCN"
FT   gene            228412..228621
FT                   /locus_tag="Micau_0224"
FT   CDS_pept        228412..228621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0224"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: saq:Sare_0170 DNA binding domain-containing
FT                   protein; TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43792"
FT                   /db_xref="GOA:D9T5D7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D7"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADL43792.1"
FT                   /translation="MASRTHEPEPLLTPAEVASMFRVDPKTVTRWAKAGKLSAIRTLGG
FT                   HRRYRESEVRALLQGQIPQQRQGD"
FT   gene            complement(228693..229085)
FT                   /locus_tag="Micau_0225"
FT   CDS_pept        complement(228693..229085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0225"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: stp:Strop_0162 hypothetical protein; TIGRFAM:
FT                   putative F420-dependent enzyme; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43793"
FT                   /db_xref="GOA:D9T5D8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D8"
FT                   /inference="protein motif:TFAM:TIGR03666"
FT                   /protein_id="ADL43793.1"
FT                   /translation="MTDLDRLAAEKYVLLTTFRKDGRAVPTPVWAVRDGDGLAVWTVAD
FT                   SGKVKRIRRDGRVTVAPCDVRGRPHGEAVPGHATIADPESTNRVRGLLKRKYRLIGRLS
FT                   LLGSRLRRGERGTVGLRIVLDGPGRD"
FT   gene            229141..229920
FT                   /locus_tag="Micau_0226"
FT   CDS_pept        229141..229920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0226"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ami:Amir_3934
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43794"
FT                   /db_xref="GOA:D9T5D9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5D9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL43794.1"
FT                   /translation="MTGEPEIGDVFGEMIRDAYAVATGIGPRPMAGGRLPRPVIEIIER
FT                   DDGLVNGAPAEHYLDPPQRWQPHDHRAVDRVRGHVLDVGVGAGRIALHLQDRGVPVTGL
FT                   DTSLGALRVSRHRGVRDLVHGTVDEHAADGRRYDTFLLLGNNLGLFEGRERAPAMLAAL
FT                   AALARPGARVIAHGTDPYGTTDPVHTAYHERNRRRGRIGGQLRLRLRYRLLGTDWFDYL
FT                   VCSPEEFAELVHGSQWRLTDVDDTDHPYYLATLELRR"
FT   gene            complement(229974..230261)
FT                   /locus_tag="Micau_0227"
FT   CDS_pept        complement(229974..230261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43795"
FT                   /db_xref="GOA:D9T5E0"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E0"
FT                   /inference="similar to AA sequence:KEGG:SGR_5033"
FT                   /protein_id="ADL43795.1"
FT                   /translation="MSQAPESAESTETVETRGDERVDLLRADTNNDGKTDVWVVDTDGD
FT                   GKADLFQFDTDGDGKVDITMVDIDEDGTPDEVVDGDGGLPPEQTTPTVQV"
FT   gene            230424..231281
FT                   /locus_tag="Micau_0228"
FT   CDS_pept        230424..231281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0228"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   KEGG: stp:Strop_0163 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43796"
FT                   /db_xref="GOA:D9T5E1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E1"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADL43796.1"
FT                   /translation="MSGRFVVVGAGTMGLGIAYVAAGAGYAVELVEVDPARGAEALRRL
FT                   GELWDRGVQRGKLTEEAATANRERVTLRAGLAEVAEGADVIVEAVPERLDLKRAVLREA
FT                   ESRRPALLGSNTSSIPIAELAAGLDRPADFVGLHFFNPVWAMALLEVVVGPATAPETTE
FT                   AAVALAARLGKDPVVVRDMPGFATSRLGVTLGLEAIRMVADGVASPADIDKAMVLGYRH
FT                   PIGPLELTDLVGLDVRLDIARTLQAAYGDRFAPPPLLVEMVAAGKLGKKSGRGFYTWKD
FT                   GVKQ"
FT   sig_peptide     230424..230507
FT                   /locus_tag="Micau_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.272 at
FT                   residue 28"
FT   gene            231334..232077
FT                   /locus_tag="Micau_0229"
FT   CDS_pept        231334..232077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0229"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   saq:Sare_0173 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43797"
FT                   /db_xref="GOA:D9T5E2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E2"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADL43797.1"
FT                   /translation="MSGLRIEELPDRLVVTLDRPEKRNAIDADLVGELHAVCADLEARP
FT                   RLLLLTGGTAGIFAGGADIAQLRERGRLDALAAINQGVFARIRALPMPTVAAVDGPALG
FT                   GGAELAYACDLRVCTDRAVFGQPEVRLGILAGAGATYRLPALIGEARAKELLFTGRRVD
FT                   AEEALRIGLVNRVVADPAELLPTAHGLLDEMAKGSALALRLTKMAVDAPAAAHPQLDLL
FT                   SQAVLFEDEEKHRRMTEFLDRRRAR"
FT   gene            complement(232141..233478)
FT                   /locus_tag="Micau_0230"
FT   CDS_pept        complement(232141..233478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0230"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   saq:Sare_0174 ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43798"
FT                   /db_xref="GOA:D9T5E3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADL43798.1"
FT                   /translation="MLRTRTSRAALSMACAALLLATSACGSDEPEETPATQVRLYGTDG
FT                   NMLNSYAAELKDRADLVNGMKGTTPLTPLAESFKERLLAVDPKLGDFLYSAESYDAVVI
FT                   SALAAQLAGTTAPAEIAKQIVGVTTGGERCDDVTACLQLARAGRDIEYRGVSLTRAGFT
FT                   DTGEPATASYGTMHFDNQKIDDSKTEFVGAGEESGASTKAPPRGRKPRDGKAKDAPLVL
FT                   GGLLPKTGDLALANPPLAAGAALAIREVNAAGGVLGEPVKWIEGDDGTNPEVAKATVAS
FT                   HVSKGVQVIIGAGGSGISRAVLPDVVAAGRILFSPSNTDAGLSAVDDKGLYFRTAPPDS
FT                   LQGRALADVMLRDGPRKIAILARKDSYGEGLQENVRSELEKAGIGADRIKLLTYEPPAD
FT                   PKTPVDFSGTAKEIKAFGPEALLLIGFAESAPAITALDDAGVDIKH"
FT   sig_peptide     complement(233398..233478)
FT                   /locus_tag="Micau_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 27"
FT   gene            233645..234034
FT                   /locus_tag="Micau_0231"
FT   CDS_pept        233645..234034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0804 hemolysin-type calcium-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43799"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E4"
FT                   /inference="similar to AA sequence:KEGG:RPB_0804"
FT                   /protein_id="ADL43799.1"
FT                   /translation="MNDEAQQTLDDATAVLRSALAGDGAGVVGTFDAVVDRSGLAGAYG
FT                   VAWCLAATMLGDDTPGGGAALDFPGIDQADYDTRWVARFVSACANDDADTGEALFGAAA
FT                   ADGLLPDCLLTLAGSTIATLRSRSD"
FT   gene            234080..234784
FT                   /locus_tag="Micau_0232"
FT   CDS_pept        234080..234784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_1141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43800"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E5"
FT                   /inference="similar to AA sequence:KEGG:Franean1_1141"
FT                   /protein_id="ADL43800.1"
FT                   /translation="MSEAMLSKVRKLLAQAEDPACTPAESAAFMAKATELIARYGVDRA
FT                   LLAARDPAADPVGDRTVDVVAPYARDKAGLLAAVAEPLRCRCVRRRQGNGFVMHLFGFA
FT                   SDLERVELLFTSLLVQAAHGLAGAVVPAGEHPAAFRRTWLAGFAYVVAERLRAAESKAV
FT                   AESGGTSTALVLADRSDRVQRRVAEAYPRLRTAPRRRLAGGGFGSGADAGRRADLGGTG
FT                   VAGTGAAPGIAG"
FT   gene            complement(234810..235313)
FT                   /locus_tag="Micau_0233"
FT   CDS_pept        complement(234810..235313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0233"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: saq:Sare_0175 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43801"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E6"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADL43801.1"
FT                   /translation="MADPDEVRQESDRFSLRSSLLVPASAERAYAVFTGALADWWVREY
FT                   TWSGPEALAAIGIEPRAGGMLYEIGPYGFRNDWGRVLTWDPPRRLVFTWQIGPDRVPVP
FT                   DPARASEVEVLFHAGGPERTRVDVEHRYFDRHGTAAEGYREALTAGWHELLCRYLATVA
FT                   RTSA"
FT   gene            235584..236342
FT                   /locus_tag="Micau_0234"
FT   CDS_pept        235584..236342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_7270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43802"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E7"
FT                   /inference="similar to AA sequence:KEGG:SACE_7270"
FT                   /protein_id="ADL43802.1"
FT                   /translation="MTDSRATEPVPDPGDELTGSPAGPESEPDVLLDVPELTVDEIRLA
FT                   VDGLDADLSLRARLANLLQLDAGVRVHLEGVELDITGVSAEALLKVRLEKLVQILDRAL
FT                   TTIDRNPQLIDALARSAGVTLDDVHRLAAPVVDQTGRTVAAAGEVVERTAPAVSGPIEA
FT                   PEPPGRPARTESERAAGSGQGAGAGPSAERPTEKKRGSERPGGAGQPASAAAEAAQLAG
FT                   QAGQALRQAGRSVWEAIQGSPTQNRRPPET"
FT   gene            complement(236400..236780)
FT                   /locus_tag="Micau_0235"
FT   CDS_pept        complement(236400..236780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: transcriptional regulator, MarR/EmrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43803"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E8"
FT                   /inference="similar to AA sequence:KEGG:Cfla_0611"
FT                   /protein_id="ADL43803.1"
FT                   /translation="MSTVDDPRAGGPFPTNGLDDTVHQRHRLGILTIAAEGERVEVAYL
FT                   REALELTAGNLSRHLTVLEEARLIQVEKGYHGRRPRTWIRITREGRQALQSEIAALQEL
FT                   LRRHQQAAQPSTSAGPDDFPPA"
FT   gene            complement(236777..237529)
FT                   /locus_tag="Micau_0236"
FT   CDS_pept        complement(236777..237529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_0083 carbohydrate kinase, YjeF
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43804"
FT                   /db_xref="GOA:D9T5E9"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5E9"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_0083"
FT                   /protein_id="ADL43804.1"
FT                   /translation="MPSESPREDDAQELLASMTTLRRQARAARQAYWLPLLLFGVLIAA
FT                   AAPLYVESAEPPALRAGSDGPVLTGLGGGFLEKSTALGWYWLAALVGGYLAGLAWYRWH
FT                   GRRAGVQTPTRAYVIAGIAGTLVGLTLPVVLEFLLFNTSAPVSGGTSWLTGPLLGLANR
FT                   GMLPHLVIAVGLAVLAHLERSRSLWVVVGLYTVVLVAVNAWFQVSDLQPGDLTRFSFML
FT                   AAMLPAPVLLIGGGLTLAAAKKQHNGYA"
FT   gene            237710..238147
FT                   /locus_tag="Micau_0237"
FT   CDS_pept        237710..238147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0237"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_4433
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43805"
FT                   /db_xref="GOA:D9T5F0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F0"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADL43805.1"
FT                   /translation="MSRVQLALRVSDLEGSVAFYSKLFGVEPAKRRPGYANFAVENPPL
FT                   KLVLLEGEPGLPTVMDHLGVEVSTTEEVNAATNRLTESGLITLEENDTECCYALQDKVW
FT                   VRGPGDEPWEVYTVKADSPQLAKATESACCASDAAEQPAAV"
FT   gene            complement(238212..239177)
FT                   /locus_tag="Micau_0238"
FT   CDS_pept        complement(238212..239177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0238"
FT                   /product="WD40-like beta Propeller containing protein"
FT                   /note="PFAM: WD40-like beta Propeller containing protein;
FT                   KEGG: sal:Sala_2007 peptidase S9, prolyl oligopeptidase
FT                   active site region"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43806"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F1"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADL43806.1"
FT                   /translation="MRALRTALTPVLVLAVILLGGCGRVSGLLDRVSLFHPVWAADGWV
FT                   YYLREVTSTSGSGVAEVWRQRPDGSAEEPVLKRAPAVSTCEAGLFSFLFAGPGGDLGVA
FT                   LECGWDETELLSYSPADRTFEPLASTRFLAEAALVNRGGGGYVEAPRECGPGGVQLLAD
FT                   GKAYEFGSPVTVGGVTFNLSGGDTDCESTVLARSPAALGERLFFITAPDSLGRLPLPPE
FT                   VSPDDLTWHLTEWAVGSATARFITELPGLADLAVSPDGRSVIAAVASDHVGGVWSVDVR
FT                   TGKKTRIAGGARAYHPSFSPDGKRFVYVEKLERLKFAEAR"
FT   gene            239335..239862
FT                   /locus_tag="Micau_0239"
FT   CDS_pept        239335..239862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43807"
FT                   /db_xref="GOA:D9T5F2"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F2"
FT                   /inference="similar to AA sequence:KEGG:Sare_3881"
FT                   /protein_id="ADL43807.1"
FT                   /translation="MKLRAAILLALTALSLGLVVVASPAEPAWACSCARTGADERADLI
FT                   VVGTITEVTDTGVQLAVESVEKGSLRAGATLRLRVGRQEESCGYDFRTGTRYRVNSRDG
FT                   VTGLCAGITAAPAQVQTTPSAPAAAPTLVTALPAPAQVPGRLWLVGGAVLTVLAAGLVA
FT                   VSMRRRRIEAKR"
FT   sig_peptide     239335..239403
FT                   /locus_tag="Micau_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.655 at
FT                   residue 23"
FT   gene            complement(239959..240032)
FT                   /locus_tag="Micau_R0005"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(239959..240032)
FT                   /locus_tag="Micau_R0005"
FT                   /product="tRNA-Phe"
FT   gene            complement(240106..240182)
FT                   /locus_tag="Micau_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(240106..240182)
FT                   /locus_tag="Micau_R0006"
FT                   /product="tRNA-Asp"
FT   gene            complement(240216..240288)
FT                   /locus_tag="Micau_R0007"
FT                   /note="tRNA-Glu4"
FT   tRNA            complement(240216..240288)
FT                   /locus_tag="Micau_R0007"
FT                   /product="tRNA-Glu"
FT   gene            complement(240432..241220)
FT                   /locus_tag="Micau_0240"
FT   CDS_pept        complement(240432..241220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0240"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   stp:Strop_0292 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43808"
FT                   /db_xref="GOA:D9T5F3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F3"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADL43808.1"
FT                   /translation="MRPRALSALALGLVLLVTGCGEAGKSPEKAAAPPSASASPSPTPV
FT                   TKPSPTPTTPAKPKLRPLPKKLPAGLHRASGSNGVALTFDDGPDPRYTPQILAQLRAAH
FT                   VKATFCVVGKQAKRYPELVARIVREGHQLCNHSWHHDVNLGRRSAAEIRSDLERTNEAI
FT                   HAAAPKAPITWFRQPGGRWTAEEVTIAQQMGLRPLHWSVDPQDWDHPPAKTIIKRVKGA
FT                   TRHGSVVLMHDAGGDRAQTMAACRHLIPDLKRRYGIALPR"
FT   sig_peptide     complement(241149..241220)
FT                   /locus_tag="Micau_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.734 at
FT                   residue 24"
FT   gene            complement(241297..242244)
FT                   /locus_tag="Micau_0241"
FT   CDS_pept        complement(241297..242244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0241"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: saq:Sare_4927 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43809"
FT                   /db_xref="GOA:D9T5F4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F4"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADL43809.1"
FT                   /translation="MADEALSAGAVARRLGVAVTTLRTWHQRYGLGPSEHVPGHHRRYT
FT                   PADLARLEIMRRLTTEGVAPAEAARWARQAPAVLPPERLGLKARASTVRDGGGTTIPVG
FT                   RAGPAARGLARAAMRLDSVTIGRTIADALAADGVVATWEGLLRPVLAGIGERHAATSAL
FT                   IEVEHLMSRCVSEAFATVARTYPMTGPPRILLSCADEEQHSLPLEALAAALAEVGVSYR
FT                   MLGARVPVPALVEAVNRTGPAAVVLWSHIRATADPCQLTALLAVPRRPLLVLAAGPGWR
FT                   ADSLPAGVVRPVDLAEALSLAVAVRDSLDQSTTS"
FT   gene            complement(242234..242827)
FT                   /locus_tag="Micau_0242"
FT   CDS_pept        complement(242234..242827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0242"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 1"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 1; KEGG: stp:Strop_4438 isopentenyl-diphosphate
FT                   delta-isomerase; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43810"
FT                   /db_xref="GOA:D9T5F5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F5"
FT                   /inference="protein motif:TFAM:TIGR02150"
FT                   /protein_id="ADL43810.1"
FT                   /translation="MSERETHLVELVDDDGLVIGETTVATAHQPPGRLHRAFSVLLVDP
FT                   DGRVLLQQRAAVKTRFPLRWANSCCGHPLPGQSLTEAANRRLAEELGVDAVDLTEVGVY
FT                   LYYAEDPATGRVEFEYDHVLRADVPADLVTRPDPDEVADLRWVDPGAVVADLDAHPREY
FT                   APWLGGVVNRLLHPTDASRPGVPATEAPERSGGR"
FT   gene            complement(242824..244338)
FT                   /locus_tag="Micau_0243"
FT   CDS_pept        complement(242824..244338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0243"
FT                   /product="phytoene desaturase"
FT                   /note="KEGG: stp:Strop_4439 phytoene dehydrogenase-related
FT                   protein; TIGRFAM: phytoene desaturase; PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43811"
FT                   /db_xref="GOA:D9T5F6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F6"
FT                   /inference="protein motif:TFAM:TIGR02734"
FT                   /protein_id="ADL43811.1"
FT                   /translation="MMSNFVSKGAGMRTVKGRTDRVVVVGAGLGGLACALHLAGSGRQV
FT                   TVLEREPVPGGRAGRLSVDGYEFDTGPTVLTMPDLIAEALGAVGEELTDWLDLTPLDPA
FT                   YRAYYPDGSTLDVITDTTRMAAEIARVCGPREADGYLRFVEYARNLWQWERADFIERNL
FT                   DAPTDLLTGNLLKLFASGAFRRLQTKINQFFRDPRTQRIFSFQAMYAGLSPHDALAIYA
FT                   VIAYLDSVAGVCFPRGGIHAVSRGMAGAAEKHGVQIRYGTTVTRVETANGRATGVVTAD
FT                   GDFIPADTVVLNPDLPVAYQDLLPPSRQRKLTYSPSCVVLHIGSTQGYGKIAHHNIHFG
FT                   RSWKGTFDEVIRRGELMTDPSLLVTNPSRTDPSVAPAGRHTYYVLAPVPNLERAPFDWT
FT                   GDLTQRYADQLVTTLEERGYVGFGDGIEVMRAVTPADWAAQGMAAGTPFAASHSLFQTG
FT                   PFRPSNLHRTLENVVFVGSGTQPGVGVPMVLISGKIAAARITGAMS"
FT   gene            complement(244335..245489)
FT                   /locus_tag="Micau_0244"
FT   CDS_pept        complement(244335..245489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0244"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: saq:Sare_4930
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43812"
FT                   /db_xref="GOA:D9T5F7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F7"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADL43812.1"
FT                   /translation="MANDAVAGNALRVAPAQPGATDDPVRGVLAAFTKDLIKGVDETLA
FT                   AFLAAEVESLTEIDAAMGGFATTARDCVLAGGKRVRPTFAYWGWRGVVGGEEPLCSVLP
FT                   ALSALELLHTFALVHDDVMDASDTRRGLPTAHRAAAARHRAAGHTGDPDRYGEAVAVLI
FT                   GDLCMVWADRLMAHAAVPAERLLDVRRCYDQMRVETVAGQFLDVLGENDSASWTVDRAL
FT                   RVARYKTASYTVQRPLLFGACLAGADADDPLIAAYTRYGLAVGEAFQLRDDLLGVYGDP
FT                   ETTGKPAGDDLRTGKPTALLMLARQLADPAQRRVLERAGSVTSATEVDRLADVVRDTGA
FT                   TARVERMISDRVTEALAALGTAPIDETARTALTGLATAATARRA"
FT   gene            245554..246480
FT                   /locus_tag="Micau_0245"
FT   CDS_pept        245554..246480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0245"
FT                   /product="Phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="KEGG: saq:Sare_4931 squalene/phytoene synthase;
FT                   PFAM: Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43813"
FT                   /db_xref="GOA:D9T5F8"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F8"
FT                   /inference="protein motif:PRIAM:2.5.1.32"
FT                   /protein_id="ADL43813.1"
FT                   /translation="MDTDLTAAYDRCRELHRRHGRTYYLATRLLPAWKRRHVHALYGFT
FT                   RYADEIVDRTEDLPPAERAARLREWSDRFVAGLHGASVDDPLLPAVLHTIAVFDLDRDD
FT                   FASFLRSMAMDLTVMSYPTYDDLLDYMEGSAAVIGTMMLPILGSSDPAAAREPARQLGF
FT                   AFQLTNFIRDVAEDLDRGRTYLPDEDMAKFDLTRDDLLAAKAAGRTTPRIRELIEYEVT
FT                   RAQAHYVAAAPGIPLLDPASQACMRTAYALYGGILDEVAAQDYDVFVRRALVPQRRRMA
FT                   VAARALLTPPGTPVRVPGPALEPALAG"
FT   gene            246477..247799
FT                   /locus_tag="Micau_0246"
FT   CDS_pept        246477..247799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0246"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: sro:Sros_1613 deoxyribodipyrimidine
FT                   photo-lyase; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43814"
FT                   /db_xref="GOA:D9T5F9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5F9"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADL43814.1"
FT                   /translation="MTGRTAVVLFTRDLRVHDHPALAAACSAFDRVVPLYVLDPALQKL
FT                   SPNRTRFLHQSLADLREALRKRGGDLVIRRGDPVAETVKLARKVGAEGVGLSADVSRYA
FT                   HRRERRLRAECDRHRMFLRLFPGLTIVEPGALRPGGGDHYRVFSPYFRAWQGVRWRDEL
FT                   AAPKRVRLPDGVDPGRLPDPPKGDSPDAAVGGETVARRRLTAWLPTLDRYDDIHDDMAG
FT                   DETSRLSPYLRFGCVSPLAVANRAGDRDGPFVRQLCWRDFYHQVVAGFPDLSTVAYRRG
FT                   AREDWRDDPHAFDAWAEGRTGMPIVDAGMRQLRAEGWMHNRARLITAGYLTKHLGLDWR
FT                   PGLEIFFRWLLDGDRVNNSGNWQWVAGTGNDTRPYRGFNPVRQAERYDPDGAYVRRWVP
FT                   ELASVAGKAVHQPWRLPDEVRHTLDYPPPLEVPGADPVWLR"
FT   gene            complement(248170..249270)
FT                   /locus_tag="Micau_0247"
FT   CDS_pept        complement(248170..249270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0247"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sen:SACE_3662
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43815"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G0"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADL43815.1"
FT                   /translation="MHARFTPVRDCFHDLFTTGRETGASLSVWHDGVPVVKLVGGTTAT
FT                   VPPGTVVPAAGADRPWRPDTLVDVYSAGKPVVALCLLLLVDRGRVDLDAPVSAYWPGFR
FT                   APATVRQVLTHTAGLPAFPVPRPAAAIADWDLLCADLAAAEPEWMPGAVAAEHAWTYGH
FT                   LVGELVRRVDGRSVGRFLAEEIAGPWRLDLAFGLGEADRRRCADLSYADPAWPDAMRGE
FT                   PGSLRARALDNPPGGRDVAMVNSDLWRAAEIPAVNLHATAAGLARLYAGLLACGTLDGV
FT                   RLFSPELVTEATRVQYSGPDLLLDRPVDWTLGMQWEPDGSWGMGGIGGSSAWADPERGY
FT                   TFAYATARLADHDRVEELVEALHSCL"
FT   gene            249363..250847
FT                   /locus_tag="Micau_0248"
FT   CDS_pept        249363..250847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0248"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerization region; KEGG: saq:Sare_4957
FT                   pyridine nucleotide-disulphide oxidoreductase dimerization
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43816"
FT                   /db_xref="GOA:D9T5G1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADL43816.1"
FT                   /translation="MAEPELVDVVVVGLGVGGEEVAGRLAEAGLTVVGIERDLVGGECP
FT                   YWGCVPSKMMIRAANALAEAHRVNELAGSAQVRPDWAPVAKRIRAEATDTWDDKVAVDR
FT                   FTGKGGRFVRGSGRLDGPNRVRVGDQVFQARYGVVLGTGTRPSVPPIDGLADTPYWTNH
FT                   QAIEVEELPASLLVLGGGAIGLELAQVFARFGVRVTVVEAADRVLAVEEPEASALAADA
FT                   LRADGVEIHTGVKASRVSHDGTTFTVHADGAEFTGEKLLVVTGRKAHLEELGLDTVGVD
FT                   AGQRYLPVNDRMHVTDGIWAVGDLTGEGAFTHIAMYQAGIVVPDVLDHMRRTKGGPDAS
FT                   GTASVVGGAAGVVSAVGGAMSAGGSTAAPGSVPVADYRALPRVTFTDPEVGAVGLTEQQ
FT                   ARERGVNVQVGYADLTSSARGWIHKTGNAGFIKLIADADQGVLVGATSAGPAGGEVLSA
FT                   LVVAVHAAVPISQLRHMIYAYPTFHRAIEDALRALK"
FT   gene            complement(250852..251616)
FT                   /locus_tag="Micau_0249"
FT   CDS_pept        complement(250852..251616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0249"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   saq:Sare_4961 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43817"
FT                   /db_xref="GOA:D9T5G2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G2"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADL43817.1"
FT                   /translation="MGVRVEHAGAVTTVILDRPEARNAVDGPTARALADAFRAFDADPD
FT                   AAVAVLWGAGGTFCSGADLKAVGTPRGNRVEPGGDGPMGPTRMRLSKPVIAAISGYAVA
FT                   GGLELALWCDLRVAESDATLGVFCRRWGVPLIDGGTVRLPRLIGESRAMDLILTGRAVG
FT                   ADEAYAMGLVNRLVAPGEARAAAEELAAAIARSPQTCLRNDRAAVRDGAGQPEPEAMAT
FT                   ELAYGLESLAVDGVRGAGRFADGAGRHGAPAG"
FT   gene            251700..252551
FT                   /locus_tag="Micau_0250"
FT   CDS_pept        251700..252551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0250"
FT                   /product="Rieske (2Fe-2S) iron-sulphur domain"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   gob:Gobs_4736 Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43818"
FT                   /db_xref="GOA:D9T5G3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G3"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADL43818.1"
FT                   /translation="MRELLTKLEQATGLDRVGDRLQRAVQGTLRSQRVRDALHGVWLGH
FT                   PLHPAMVQVPVGAWISAAVVDLLPGQRRAATALVGLGTVSAVPAAVAGLNDWATLTRDQ
FT                   RRVGLVHAAANTVGLALFAGSLAARLNGRHGLGRTLSYLGLSAASGGAYLGGHLAYKQG
FT                   AQASQSVSELHLISDGWHRVGDLSSLPRHELVTKKIDDVPVILYRDGDDVSVMLERCPH
FT                   QSGPLGEGTVEQIDGHACVVCPWHGSAFRLDGGEVVHGPAANDQVVLPSRVVSGRVEAR
FT                   LP"
FT   gene            complement(252553..253569)
FT                   /locus_tag="Micau_0251"
FT   CDS_pept        complement(252553..253569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0251"
FT                   /product="Peptidoglycan-binding lysin domain"
FT                   /note="KEGG: stp:Strop_4449 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43819"
FT                   /db_xref="GOA:D9T5G4"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G4"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADL43819.1"
FT                   /translation="MGAPRRSPVRRAGQVLTGLGALVVLVGVLAGGPVALLAFAGNPLP
FT                   DHLPTLAEVGTALTSRDDGRLFLRALAVVGWFGWATFAFSVLVELLAAAVRRPAPKLPG
FT                   MHRQQKAAAALVGSVALILVASPAAASAAALTAPQPAVAAVTSPAVAASQVTPPAPIAS
FT                   KADDPAVYRVAKGDYLGEVADRYLDDFDRYKELARLNRLADPDRIRPGQLITLPEGATD
FT                   SGARRHATGRIVVTKPAETAPVKPGGGGASSTTPKAKPKPTPRDATPTVEAPVGQPPAM
FT                   SAGASRATAEEGINRPLAISAVLAVASIVGAQIGALLGLRKRPVPARALSSGRHRRD"
FT   gene            complement(253585..254016)
FT                   /locus_tag="Micau_0252"
FT   CDS_pept        complement(253585..254016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43820"
FT                   /db_xref="GOA:D9T5G5"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G5"
FT                   /inference="similar to AA sequence:KEGG:Strop_4450"
FT                   /protein_id="ADL43820.1"
FT                   /translation="MTGRREAENGRVSLFLAVAMTGVLAIIGLAYDGAGQLRTLQRADN
FT                   LAAEAARAGGQMIDRARAIEGGPKRIDQVAARAAVAAYLDAAGGVQDHEVDFPVVGTET
FT                   QIRVRVQITYSRDLLSLFGVQENATVTGEATARALTGPP"
FT   gene            complement(254013..254486)
FT                   /locus_tag="Micau_0253"
FT   CDS_pept        complement(254013..254486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0253"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: stp:Strop_4452 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43821"
FT                   /db_xref="GOA:D9T5G6"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G6"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADL43821.1"
FT                   /translation="MNAGPRRDRGSVSIEVAVLAPAFIGLMVLAGVAGRTAIADEAVES
FT                   AAHDAARAASLARTADDGAEAAEVAAQDQLGWAGLNCTGPPQIDLAGSVAGTTTSFAAA
FT                   YQSAAGVPATVTVTVTCTVSFDDLSAPGLPGVPGGKTVSARFTSPLDTYRSRG"
FT   gene            complement(254483..254965)
FT                   /locus_tag="Micau_0254"
FT   CDS_pept        complement(254483..254965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0254"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: stp:Strop_4453 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43822"
FT                   /db_xref="GOA:D9T5G7"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G7"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADL43822.1"
FT                   /translation="MPRPARTVRSRPASAGRLAGPPGPGRFAAALRARLAEGERGANPV
FT                   ELAVVMPVILVMLFGSIQVAVWFVARSTALNAAQTAVNAQRTIDAGPDAGRQRAISFLQ
FT                   QSGDWLVGWEQTGPTCVETATAVTCTVQGRSLSVIPGVSFEVTQTAHGPAEHWTTG"
FT   gene            complement(254965..255174)
FT                   /locus_tag="Micau_0255"
FT   CDS_pept        complement(254965..255174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43823"
FT                   /db_xref="GOA:D9T5G8"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G8"
FT                   /inference="similar to AA sequence:KEGG:Sare_4967"
FT                   /protein_id="ADL43823.1"
FT                   /translation="MHLYAYLYVAVSTRLAELRRDSERGDSPVPTAVIIFGLVAVAMAV
FT                   TGLALAKANNWMNAIPNNTAPQAP"
FT   gene            complement(255200..256063)
FT                   /locus_tag="Micau_0256"
FT   CDS_pept        complement(255200..256063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0256"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   saq:Sare_4968 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43824"
FT                   /db_xref="GOA:D9T5G9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5G9"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADL43824.1"
FT                   /translation="MILNWQLAIAVLGGCAVGLGLFLVVREALPATPALGPALRRLHQP
FT                   PGQAPAAGAGPDWLGGFARWLRPPHRQLALLDRTPEQYALSVLLSALVGFATPAVASAV
FT                   LFVGGVALPVAVPVVASLGLALGAGLLAHRTVLAKADAARDEFRQAVCTYLDLVALQLS
FT                   AAHGPVQSLERAAAVCDGWVFDRIREALRLAQLQMHSPWDELQELAERIGIPELGDVGA
FT                   IMRSSGSEGAQVHETLRSRADSLRDQIRTDNLARAEGVTSKLDIPGSLLVFVLLGFAVY
FT                   PFLARL"
FT   gene            complement(256060..256959)
FT                   /locus_tag="Micau_0257"
FT   CDS_pept        complement(256060..256959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0257"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   stp:Strop_4456 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43825"
FT                   /db_xref="GOA:D9T5H0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H0"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADL43825.1"
FT                   /translation="MTQIELIALVSGAACVAGLVLTVVALVGTRRPPGPAPGAGPGLSR
FT                   LWTGSGASRADQRRYQLLLGAAVVAGAAAFLLTGLPVVGLLVALAVPGVPWLFAVGRAE
FT                   QRAIARVEAVGEWTRRLKDISATGQGLQQAIIGTIATAPEEIQEEVRTLAARLQAGWLA
FT                   RSALLAFADEIADPVADQVVAALILHLTDRGERLGDVLGSIATAASAEVATRREVEAKR
FT                   TQPRFAVRFLTGMTLATLAYGLVNSDYIRPYGTLTGQLVMAVLGAAFVGLLVWVRSMSQ
FT                   PPRPARFLPAPDLDEAIA"
FT   sig_peptide     complement(256882..256959)
FT                   /locus_tag="Micau_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.575 at
FT                   residue 26"
FT   gene            complement(256956..258497)
FT                   /locus_tag="Micau_0258"
FT   CDS_pept        complement(256956..258497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0258"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   stp:Strop_4457 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43826"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H1"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADL43826.1"
FT                   /translation="MRFEPVSHDPRAQQPGVVSTVPPLAPPNGRHHVPGPAPAAPPAPP
FT                   PRPRVDFAVVRELRRELSERLTHWQRGREFDADAEEVERARLAVAVVSAYADSVRRAGT
FT                   PMAADSERLLLDQVTAELVGLGRLQTLLVDDSIEEVHILGCDQVRITRHGGGVDWAEPI
FT                   AETDDELVEILQAAARRAGATERSLSTSKPTLDLQLPDGSRLAAVFLVSHRPYAVIRKH
FT                   NTLEVSLEDIAGGRPDLDEMIDPLLRDFLRASMRAGLNIMVAGLAGAGKTTVIRALMDE
FT                   IPADEPYVLLEESRELLPARRGHKHRAVMSFESREGHGERGADGRPAGEVSIADLIPVS
FT                   LRMGVLRIIVGEVRSREIVPMLQAMTTSRGSMCTIHARTPSGVSERIIELALSHGREMT
FT                   VDQARRMAGNALDLIVYVTVEDETAIGGRKHRFVSHVEEVIGVGEGNRITTTTVFGPGP
FT                   DGRAVPRHLPERIRDQLLRVGYDARLLTRFVEAGMGAWRRPRHTRLGARPSGGPA"
FT   gene            complement(258487..259320)
FT                   /locus_tag="Micau_0259"
FT   CDS_pept        complement(258487..259320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43827"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H2"
FT                   /inference="similar to AA sequence:KEGG:Strop_4458"
FT                   /protein_id="ADL43827.1"
FT                   /translation="MAIIALVSAKGSPGVTTAALAAALSWHRRLVLAECDPAGGSILAG
FT                   YLGGALDGPRGIGELAVGELRDGSLEHAFWSQLVDLDAPRRERLLLPGVVDPAQAGSVI
FT                   PLWQRFADYFTGLERGEPPYDVLVDCGRLAVGGPPWPLLRAAAVVLLVTRAHLPDLSAT
FT                   RATARAIERDLTEHRVPPGTLRLLVVGDGHGTSEISKALRLPVIARLPHDPRTAEVLAH
FT                   GGTVRANRPLMRAAGALEVPVRALLDRRRARLAWPGATTPRAVTAPSVPGVSGAV"
FT   gene            complement(259320..259988)
FT                   /locus_tag="Micau_0260"
FT   CDS_pept        complement(259320..259988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0260"
FT                   /product="SAF domain protein"
FT                   /note="KEGG: saq:Sare_4972 SAF domain-containing protein;
FT                   PFAM: SAF domain protein; SMART: SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43828"
FT                   /db_xref="GOA:D9T5H3"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H3"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADL43828.1"
FT                   /translation="MSVVAARNGTPVEAPVAPPKVVRQRRVRPGLLGLAVLLIALGGLG
FT                   AAFAVTSVRSTGTYLAVARQVDVGHQLTADDLVPVRVSGGRELQPVPADRMDEVLGLRA
FT                   AVRLTPGTLLTPAQLTEAPLLGPGQQQIALGLEPEQVPARKLHPGDKVLLVSTPSNATG
FT                   GGSEASRGGGTRFEGTVIDTAAPQNGDVVVYLALAVRDVPAVVALAADDRIALVLTEAA
FT                   "
FT   gene            complement(259985..260938)
FT                   /locus_tag="Micau_0261"
FT   CDS_pept        complement(259985..260938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43829"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H4"
FT                   /inference="similar to AA sequence:KEGG:Sare_4973"
FT                   /protein_id="ADL43829.1"
FT                   /translation="MLTWGGRGVPARPARAGTLRRLLLAAGLAALLTLTGAPARAADPG
FT                   GSCPPEQTDCDVWDDDPGTPGGPGGPGGPGGGGDNGGGGGSTPKCQWNGRAIPCYHPIL
FT                   GWFNNADGCYYKLEEPQDEAPPGKQWYQLTCNGGDLGSLRRALLDAPPPGYGAPPDPEE
FT                   LARRALASISLLPPRAAVAPRRSQGPGLVGLPVWMWASPGAAYFGPLSASASDRGLTVE
FT                   ITAKVDRIVWHMSDDIDVTCDGPGTPYRADGPRAGSTSPDCGLDQGYPKAGTYQVSATT
FT                   FWTVEWSGGGESGVIAQSRSSGVVLVQINELQVVTR"
FT   sig_peptide     complement(260813..260938)
FT                   /locus_tag="Micau_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.993 at
FT                   residue 42"
FT   gene            complement(260932..261498)
FT                   /locus_tag="Micau_0262"
FT   CDS_pept        complement(260932..261498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43830"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H5"
FT                   /inference="similar to AA sequence:KEGG:Sare_4974"
FT                   /protein_id="ADL43830.1"
FT                   /translation="MRTRQSRRWEIFLLSIVLVVGSAGCGTEPEAVTRPLTGRAAAPAA
FT                   HSSAEENAAGKAALAAYSGYLDASRAASARSDPSHPALTRFLADPLLTRVRMAILDAKE
FT                   HGAMRTGKLVSDPEVVSVDLAARPPTVEIQDCLDASGYRLVYAKDRKAVPGTRGGRYLA
FT                   TATAVRYPDGRWLINGGAAHQDQPC"
FT   sig_peptide     complement(261415..261498)
FT                   /locus_tag="Micau_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.403 at
FT                   residue 28"
FT   gene            262058..262834
FT                   /locus_tag="Micau_0263"
FT   CDS_pept        262058..262834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0263"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   stp:Strop_4462 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43831"
FT                   /db_xref="GOA:D9T5H6"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H6"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADL43831.1"
FT                   /translation="MTAERVRRTGPVADARRPSTRLTAALTVVPLLRLAVARYAVPPGC
FT                   PDRTACDGCGAPIGLDRPLPALGPVARCPACRARVGAPPAVVEVALLLAVAVPVFAGGA
FT                   PAARLALAWWLVWAVPMTIVDAMAHRLPDRLTWLAAAGVWALLGVAALTGPGVDPLVRA
FT                   VLAALALGGGFAATTLLFGRRGFGLGDAKLALGAGALLGWYGWPLLVAGLVLALLLAGS
FT                   AGVALLAARRVRWSGHLPFGPFLVLGTAATLVLVTV"
FT   gene            262943..265312
FT                   /locus_tag="Micau_0264"
FT   CDS_pept        262943..265312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0264"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: tcu:Tcur_2817 glycoside hydrolase family 65 central
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43832"
FT                   /db_xref="GOA:D9T5H7"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H7"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADL43832.1"
FT                   /translation="MPHGDDGWRIRRTSADLDRLGETESVFALANGWVGWRGTLDEGEP
FT                   CGMPGSYLNGFHEQHELTYPESGYAFPERSDTVISAPNAALIRLWVDDEPLDLSTGTIR
FT                   RHHQELDLRAGVVRRETEWVSPGGRGVRIRSTRLVSLTRRPVAAVDWAVEPLDEPVRLR
FT                   VGADLLANQRVPERADDPRAASVIHDPLTGEIRREDGPDGVLVHRTGRSGQRVAVAVAH
FT                   RVEAPDEIATDTELTADRFRLALSGPVRPGERIRVTRFAAYECTDVDGTPAGELADLVV
FT                   AEAATARDDGLDALLTEQRAALDVAWTTADVELEGDPELQLAVRFSVFHLLQSGRADGD
FT                   RTIPAKGLTGNGYDGHVLWDTEGYVLPVLTYLAPELARSALRWRHAHLPEARDRAAELR
FT                   LTGATYPWRTLSGRECSGYWPAGSAGLHVNADIADAVLRYVAATGDTAFLAECGAEVLI
FT                   ETARLWHGYGHFDDGGAFHLTGVTGPDEYSALVDDNVFTNLMARRNLRGAADAAEGCPE
FT                   VAARLGVDAAEAAGWRAAADAMFVPYDGKRGVHEQSAGFTAQPEWDFAGTGEDDYPLLL
FT                   HFPYLELYRKQVVKQADLVLAMLRCPGEFTAEEKTRNVAYYEARTVRDSSLSASAQAIL
FT                   AAEVGHLDLAYDLFAETAFQDLADLGDKTADGLHLASLAGAWLVVAQGFGGLRDDRGVL
FT                   AFEPRLPRPITRLAFHLRRHGHRLRVTLTPQEARYELPDAGPGDAVELWHHGEQLRVTG
FT                   DGPVTRPMPPVPDPGPEPEAPPGRRPERRAQEAGGD"
FT   gene            complement(265291..265767)
FT                   /locus_tag="Micau_0265"
FT   CDS_pept        complement(265291..265767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_33090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43833"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H8"
FT                   /inference="similar to AA sequence:KEGG:ROP_33090"
FT                   /protein_id="ADL43833.1"
FT                   /translation="MTGGRETVEVEPVVFRAVYDSPASLPGRHRWTTPEADVRRLEKLL
FT                   NMPARSIGAPLWVSGDEPDCPKCGRRVTWYDIVASALHGVHDHTMIARVILGERKYVNT
FT                   EVPDAIPGVHCADCRTPITGLRSFKCHNWAYAFEALEEVVARMSGLPAQSPPAS"
FT   gene            265883..266656
FT                   /locus_tag="Micau_0266"
FT   CDS_pept        265883..266656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0266"
FT                   /product="protein of unknown function DUF574"
FT                   /note="KEGG: sma:SAV_7303 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43834"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5H9"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADL43834.1"
FT                   /translation="MTEAENRPNVARMYDYYLGGCHNFAADRAAAEEVLKIFPDTGVAA
FT                   QSNRAFLRRVVRWAAGQGVRQFLDIGAGLPTQGNVHEVVRAVRPDARVVYVDHDEVAVA
FT                   YARRLLPTDGRTVVLQGDLRRPGDLLADPTLRDTIDLSEPVAVLLLAVLHFVPDADDPY
FT                   AAVATLRDATVPGSVLALSHLTLDGLPTLPTEQGTAIYRRSSSPLVPRTRDEVARFLDG
FT                   YELVEPGLVKVADWRPDGEPQAAVSHGYGGVGVRR"
FT   gene            complement(266663..267016)
FT                   /locus_tag="Micau_0267"
FT   CDS_pept        complement(266663..267016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43835"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I0"
FT                   /inference="similar to AA sequence:KEGG:Tbis_0399"
FT                   /protein_id="ADL43835.1"
FT                   /translation="MTGGKARREGTAGGPCDDRRTSSAASPDVSALAINVTVPEELRWT
FT                   DTRRGEEFTLTTLNIRLLPDGRLAAKAYGRPTAGGRGAYVSFRVPDRPELAALVAAAAD
FT                   RAAALWAAHGGLD"
FT   gene            complement(267013..267894)
FT                   /locus_tag="Micau_0268"
FT   CDS_pept        complement(267013..267894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0268"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="KEGG: sen:SACE_4776 sigma factor, sigma 70 type,
FT                   group 4; TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43836"
FT                   /db_xref="GOA:D9T5I1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I1"
FT                   /inference="protein motif:TFAM:TIGR02957"
FT                   /protein_id="ADL43836.1"
FT                   /translation="MADRATEDFLAHRNLLFTVAYEMLGSAADAEDVVQETWLRWAGVD
FT                   LEAVRDRRAYLVRIATRQALSRLRTLGRRKESYVGSWLPEPLLTAPDVADDVTLAESVS
FT                   MAMLLVLETLTPTERAVFVLREVFDVGYDEIAETVERTPVAVRQIAHRARAHVAARRPR
FT                   RTVPAAEARDALDAFRRAVETGDLDGLLRVLAADAVLVGDGGGIKQAIARPVTGGDKVA
FT                   RLLAGGWRRIAAVASMEPVQVNGYPALLVRLDGELDTVVAVRLDDGRISGLYAVRNPEK
FT                   LSHMTRETTLRR"
FT   gene            268062..268547
FT                   /locus_tag="Micau_0269"
FT   CDS_pept        268062..268547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0269"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="KEGG: sen:SACE_4777 alkylhydroperoxidase; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43837"
FT                   /db_xref="GOA:D9T5I2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I2"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADL43837.1"
FT                   /translation="MQTRFNLFENPVSATFMKRFAGAGLMIHQSSLPRTVQELVSLRAS
FT                   QINGCGWCIDMHTKEAVAGGESAVRLNLVAAWRESTVFTEAECAALAFAEEGTRLADAH
FT                   QGVSDETWEQVRKHYDDDQIAALVCLLGLINAANRFAVLVHQRGGSYEPGMFAAAMG"
FT   gene            complement(268557..269648)
FT                   /locus_tag="Micau_0270"
FT   CDS_pept        complement(268557..269648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0270"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase domain protein; alpha/beta
FT                   hydrolase fold; KEGG: sro:Sros_5100 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43838"
FT                   /db_xref="GOA:D9T5I3"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I3"
FT                   /inference="protein motif:PFAM:PF06441"
FT                   /protein_id="ADL43838.1"
FT                   /translation="MIEPFRIHVPQADLDDLADRLARTRWPDELPDAGWDYGIPLTRVR
FT                   ELAEHWRTAYDWREAEAELNRYPQFTTTIDGQNIHFLHVRSADPDALPLILTHGWPGSV
FT                   VEFLDVIGPLSEQFHLVVPSIPGFGFSGPTRERGWDVDRVARAWAELMRRLGYRRYGAQ
FT                   GGDWGSVISTRLGGIDPEHVVGVHLNYLPTAPPPGWTGEAGLSGEDRDRLDRIRRLKTQ
FT                   RHPHQVLYASRPQTVSYALNDSPVGQLAWIAEKFTEWTDPGSAVSVDRVLTDVSVYWFT
FT                   GTAASSARLVRESAFGGPPAPCPPPLGVAVFAHDITRSVRPIAELTYTIRQWSEFDRGG
FT                   HFAALEVPELFVDDVRSFFWNLR"
FT   gene            269743..270204
FT                   /locus_tag="Micau_0271"
FT   CDS_pept        269743..270204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0271"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: ami:Amir_2538 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43839"
FT                   /db_xref="GOA:D9T5I4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL43839.1"
FT                   /translation="MDNPEPDLVPTRLAGLPSWLITRTAVRAGRLVADGLAAVDARGYH
FT                   FRLLATLDEFGPASQAALGRRSGIHVSDVVAALNELAEREFVTRSPDPADRRRNVVTIT
FT                   AAGRRQLRRLEKRLAAVQDDLLAPLSPDERADLTRLLSRVLAHHTRPPA"
FT   gene            270288..270878
FT                   /locus_tag="Micau_0272"
FT   CDS_pept        270288..270878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0272"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: sro:Sros_5282 hypothetical protein; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43840"
FT                   /db_xref="GOA:D9T5I5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL43840.1"
FT                   /translation="MERWAEIALHPVRIRILRAVAGARVTTHDLVELLPDVPQATLYRH
FT                   LATLVKTGMLDVVQERKVRGAVERVYALPAHGAALDPAALATATPEDHARYFTAFVSSL
FT                   LSEFSRYLARDSVDFVADGVGYQQLVLHLTDAELHEFAAGLNALVGPLLARGPGDGRIP
FT                   RLLATILMPADRQAAPGDTHTSAHDSDTTKGDD"
FT   gene            270878..271249
FT                   /locus_tag="Micau_0273"
FT   CDS_pept        270878..271249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_5283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43841"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I6"
FT                   /inference="similar to AA sequence:KEGG:Sros_5283"
FT                   /protein_id="ADL43841.1"
FT                   /translation="MASVTLDRDVIDIRFTGWERMWVGRERFTLRLAAVRHAAPVDEPI
FT                   RLARGARRGYAVSGFAKVGVWGIFGGPRQLVAARRGKPGLHLVLDRAAAGGEFDEVVVS
FT                   DPAASRLAETIGRATGSRP"
FT   gene            271246..272151
FT                   /locus_tag="Micau_0274"
FT   CDS_pept        271246..272151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0274"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: svi:Svir_30550 ABC-type multidrug transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43842"
FT                   /db_xref="GOA:D9T5I7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL43842.1"
FT                   /translation="MTGDRLAIEASGLTKRYGDVTAVRDLTFTVRPGAVTGFLGPNGAG
FT                   KTTTMRMLTGLVTPTSGAATIGGQPYGRLAQPSRTVGAVFDGNAFHPGHTARDHLGVYA
FT                   AMAGCPDGRVAELLDLLGLAQAADRRTREFSTGMRQRLSLATALLGDPRVLLLDEPSNG
FT                   LDPEGMSWLRGLLRRLADEGRTVLVSSHVLHEVQQVVDDVVVIRRGELVAAGPWSRLTG
FT                   PPTVLVTSPDATDLAAALTAGAGSVEPAGPGRLRVRGLDAPRVADLAADHRLRIHELVT
FT                   ETTSLEQLFLDLTTDTAEAR"
FT   gene            272148..272942
FT                   /locus_tag="Micau_0275"
FT   CDS_pept        272148..272942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_5480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43843"
FT                   /db_xref="GOA:D9T5I8"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I8"
FT                   /inference="similar to AA sequence:KEGG:Sros_5480"
FT                   /protein_id="ADL43843.1"
FT                   /translation="MNLIRAELRRILATRMCTGLLLAALALGGGLVGLMALVGPENFDP
FT                   PMPGLHTEEGLRSILGILGFTAFVPAAAGALAATSEYRHGTAAVTFMFAPRRGRVLAAK
FT                   LATHAIVGLGYGIALAGSAAVALFTVAAARGVSLGLPAPTVLALLARIGVAMAVYLLVG
FT                   TGVGALLRNQVAAVCVVVGYLYLAEPVLMMIPGVNALYPLLPGGATAALTDFTYVADAM
FT                   SAQLGSDAVALLPPAAGALLLTGYAIAAAAIAVVVPMRRDIT"
FT   sig_peptide     272148..272258
FT                   /locus_tag="Micau_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.503 at
FT                   residue 37"
FT   gene            complement(272935..276180)
FT                   /locus_tag="Micau_0276"
FT   CDS_pept        complement(272935..276180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0276"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mva:Mvan_1183 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43844"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5I9"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADL43844.1"
FT                   /translation="MIGDEQRRALAALRFNWAPTPDDVWKPTPFHVEGLHHDVVTTVLD
FT                   SFAEAQASTDSSPVGVAILGQRGTGKTHLIGTVRQQVQARGGFFFLVELLEARTFWQRT
FT                   AISMLEGLVRPMPDETTQLRTFLRRLADEVGAPRTVRRAVAGETELSRSTLDAFADLIR
FT                   KKDRQIGTECQDTARALVLYAAEQSAVQDIGYDFLSSMDEEEPGQRAGWGLRRNRRAPQ
FT                   EVVRDISRLLAVVGPTVIAVDQIDLMIAQSVKATNQDARGEADWQTSLLLEQVASGLMA
FT                   LRETTRRTLSVVSCLPQTWRSIQQQATDTVQDRFREAAPLKEIPSVEVGRELVEKRFAV
FT                   LFEGLGFTPPHPTWPVHPDAFQEVVGFTPRELLRRIDAHVRACLADGEARELRHLLHTT
FT                   GDRAADGLAHAPVTGPPPEERTNGFGKIDARYAELVAAADTTSALSPQSEDGRVPRLLE
FT                   AGLTAWIAAQGAAVDAFSLDPIPAGTKPALHARLRHSLSEDSEDEEHWSFRAISAPHHI
FT                   AVLNRIRNAITTAGLTEGVAKRRLFLLRSAEWSAGARTREVLDAFERAGGRRLPLNAPD
FT                   VARLAALEQLIQDYGRETLRPWFADRRPASDITCLREALGDWPGEPAAVRAEEGPEEAP
FT                   DRPSVGKPPPVTAAPRSADPVPVPPVVAPLPPVAGIDPERMEIGTVTGRPDPVGIDLEA
FT                   LRRHTVIFAGSGSGKTVLIRRLVEECALRGVSAIVLDPNNDLARLGEGWPAPPPGWGAD
FT                   DARRAAEYLAGTDVVVWTPGRQAGRPLSFQPLPAFADVLDDPDGFTSAVNAAVATLAPH
FT                   ARVDGGTDKARLGRAVLREALIGYARSGASDLREFTDVLNDLPDGVSQLESAPKLAAGM
FT                   AQLLKAALINDPLLGGVGTPVDPGELLTPPPGRRARVSVINLAGLPEENQRQSFVNQLQ
FT                   LALFTWIKRHPAGDRPLGGLFVMDEAQTLAPSGAVTACTQSTLALTSQARKYGLGLVFA
FT                   TQAPKALHNQIPGNAATQFFGLLTVPVQIEAARDVARAKGTDVPDIGKLRTGQFYAAVE
FT                   GARFVKMQAPMCLTHHPRSPLTAEEIVRLATLR"
FT   gene            complement(276177..276833)
FT                   /locus_tag="Micau_0277"
FT   CDS_pept        complement(276177..276833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43845"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J0"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_3595"
FT                   /protein_id="ADL43845.1"
FT                   /translation="MPEKELTLVDRCILVTLMVKAAPLPQTYFTNVAGIGLKADHRRRL
FT                   QSLGLIEVTEKPITLALTDRGWDRATEELGAEPPKGAGTAGGTLYVALDFLRRLIDHSG
FT                   TRADDLFRMQINRDEVVAPPVTSSGAPAVDAVALIRQAYHELAAKPGDYVMLADLRGAL
FT                   TDLSRPEFDAALMTLNRERGVHLVPESNQKVLKPQERAAAVTIGNQDKHLVAISS"
FT   gene            277210..277539
FT                   /locus_tag="Micau_0278"
FT   CDS_pept        277210..277539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43846"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J1"
FT                   /inference="similar to AA sequence:KEGG:SGR_687"
FT                   /protein_id="ADL43846.1"
FT                   /translation="MQSEVVRYQVDDETVALIEVEPTPGFQPAGFGDVAGWVRESAAPA
FT                   VAAARELLEQVKTVSPDAVEVRFGIKATGTASWVVAKATGEANFEVTLAWQPDGPTDRG
FT                   AGPRR"
FT   gene            277555..281658
FT                   /locus_tag="Micau_0279"
FT   CDS_pept        277555..281658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0279"
FT                   /product="WD40 repeat, subgroup"
FT                   /note="KEGG: sgr:SGR_686 WD repeat-containing protein;
FT                   PFAM: WD40 repeat, subgroup; SMART: WD-40 repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43847"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J2"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ADL43847.1"
FT                   /translation="MTAAPDESSWAVALHREADPHTALGTGIVIATNLVLTCHHVAFAT
FT                   DGTLRPDLMVAFPRAPKVAYFDRRKVRQCRHDGMREAYVDLVVLELVEPVPATVTPARL
FT                   RCLAPEPLLDRPFWAYGFPTGVVGGLQATGSVVETGGYGHVTIDSGASGPLSKGFSGGA
FT                   LWSPEYEAVVGVVVTADGKGKGQAVTLHHADEQVPAMTLGALSAWRVEDADDAALSAWG
FT                   WTLSTDGEAGRHWLPRARGVAVDTEGGARFRGRTAALRRIVDFIDGEAPATRPLIVTGS
FT                   PGVGKSAVLGRVVTTADQQIRAGLPGGDNAVRATVGSVSCAVHAKGKTALEVAVEIARA
FT                   AAVELPGAPADLMPAVRDRLARRPARFALVIDALDETAAPGQARQVIDDVLLPLARECG
FT                   RYGVRVVVGTRRGDDRGDLISCFGDPVELVDLDTPEYFAEADLMNYALATLRLLGAERP
FT                   GNPYTDPAAAAPLARRIAGLAKGNFLVAGLVARAHALRDIEPVDPASVSFTATVAHALD
FT                   SYLAGLPAAGSASARLALTALAYAETPGLPLSLWRIAVTALGGTVTEDELLAFARTSAA
FT                   NFLVETGGGSQPAYRLFHQALNDALLAGASRRDDQRRLVAAWTDLAAEVGWASVPDYLR
FT                   RSLPQHASRAGLVERLLADEDYLLHAHLERLLSVVDMERPLEPLSRSRVRLLHRTPLAV
FT                   AAAPAERAALFSVVDRLDGLGSGIEADPAPYRARWAHTPPRQERSVLDGHSQAVYDVAA
FT                   VELDDRWLLASAGDDGTVRLWDPLTNQAVAVFTCHGDTIRGLCAVRTGAGETLIATASH
FT                   DGTVGLWDPRTGQRRHELRGHDDWVRNICVIPLPDGDLLASAGDDRTVRIWDPVTGTQR
FT                   YALTGHSGWVTAVTYVPAGGRHLLASTGFDGVVRVWEPTCDTRPALTLTGHVGWVTTLY
FT                   AVRAPGGTLLASAGYDGTVRLWDPQSGECVHILATGGPVTDLCTVEVDEGCLLVSTGED
FT                   GLIRIWDVSTWTIRPSLRGHASWIRAVCELRTAKDRMLATAGDDGTVRLWDPAGGRPDT
FT                   VAERDRLGPVHSLCAVPGERPGLVASGGADGRVGVWDAATGERLREIPTPGGPVNAMCA
FT                   VADVEEPLLVTAQDDNTVGTWSVRHGAQMGSMTEHHAPVAAVCPIVIGGETLVASAGDD
FT                   QAIRLWHPQTGAVRAVLLGHVTRAWVTALATVRWPSVEALASADKSGTVMLWGGGDTPV
FT                   WTRQGHQDAVTALCGLVVANRRMLASASADHTIRLWDAEWGEPVGVFTGHTAAVTGLSL
FT                   VRVGGRDLLASTSRDRTVRIWDPSTGRVLHTIPVYHPALTCCTVGGTLLVGLDQGLLAL
FT                   DVGGRSDVPPEAADRAVARVAVRC"
FT   gene            complement(281659..282573)
FT                   /locus_tag="Micau_0280"
FT   CDS_pept        complement(281659..282573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0280"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fre:Franean1_4770 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43848"
FT                   /db_xref="GOA:D9T5J3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADL43848.1"
FT                   /translation="MGTRTFRAAVVRAPGGRDTIEIIDVPEREPGPGEVRVDVAAAPVN
FT                   PADLGVVGGFFHSLGLIHQPHHTGLGWDFAGVVAAAGPGVDLAVGTRVAGLVGGFDRDF
FT                   GTYAEQLVVAAADVAVVPDDLDLVAAATVPLNGQTAAQIVDLLGDPPADGRLLVTGAAG
FT                   AVGGYVVPLARDRGWRVTGLARAGDEKFVRGLGADFITAAEPGWDAVADAAGWQDQGLA
FT                   LVGDGGVFVGVRPNAHPAAERGVTVRAVDVRPDGVRLADLLARTAAGELPARVHAVLPL
FT                   DRVADAHRAVAEGGVRGRYVLRP"
FT   gene            282692..283120
FT                   /locus_tag="Micau_0281"
FT   CDS_pept        282692..283120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0281"
FT                   /product="helix-turn-helix HxlR type"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fre:Franean1_4769 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43849"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J4"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADL43849.1"
FT                   /translation="MPTQTAAEKRAQAREEYDAFLAGCPSRQLLDRISDKWVALILAAL
FT                   GRDGPDRNAEPQVMRYSELSRRLAGVSQKMLTQTLRSLERDGLVTRTVTPSVPVTVTYE
FT                   LTDLGQSLHRLMYGMKLWAEAHMDEVHANRERYDAADR"
FT   gene            283411..284016
FT                   /locus_tag="Micau_0282"
FT   CDS_pept        283411..284016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0282"
FT                   /product="glycoside hydrolase family 10"
FT                   /note="KEGG: sco:SCO5931 xylanase A; PFAM: glycoside
FT                   hydrolase family 10; SMART: glycoside hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43850"
FT                   /db_xref="GOA:D9T5J5"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J5"
FT                   /inference="protein motif:PFAM:PF00331"
FT                   /protein_id="ADL43850.1"
FT                   /translation="MKHLPRRSHRVVLAAVTSALALAGAALVVPSLAQAAASTLGAAAA
FT                   QSGRYFGTAIAASRLGDSTYSTIAAREFNMITAENEMKPDALQPNQGQFNFSSGDQIYN
FT                   WATQRGLQVRGHTLAWHAQQPAWMQRLSGSSLRTAMINHINGVMAHYRGKLAAWDYIMP
FT                   PFDRSGFGRRIRPVTDAVERSPLKFFGMALAVVARRPA"
FT   sig_peptide     283411..283518
FT                   /locus_tag="Micau_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 36"
FT   gene            284114..284632
FT                   /locus_tag="Micau_0283"
FT   CDS_pept        284114..284632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0283"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ami:Amir_3902 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43851"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J6"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADL43851.1"
FT                   /translation="MASVAIPSDDPTRTLVHARPDDPALTHLAIAGGTYTILVTGEQTA
FT                   GRYCLIDMRVPPGGGPPPHRHDFEEMFTVLDGAVEFTFRGEQTVARAGETINIPANAPH
FT                   FFRNSFDQPARLLCMCTPAGQDEYFLRVGDRVDGPTSPPPALTDEEQAERRNRAAALAA
FT                   EYRSELLVP"
FT   gene            complement(284648..284938)
FT                   /locus_tag="Micau_0284"
FT   CDS_pept        complement(284648..284938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_3914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43852"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J7"
FT                   /inference="similar to AA sequence:KEGG:Gbro_3914"
FT                   /protein_id="ADL43852.1"
FT                   /translation="MVFDADREWYIQGRVYANIIESVPAGMLQDDDLELHLWPARAMGL
FT                   LRLPGMEPDRAERIAAALVEGVTRRLRTIDQSDTEMVTFHEGLREIAARHA"
FT   gene            complement(285083..286693)
FT                   /locus_tag="Micau_0285"
FT   CDS_pept        complement(285083..286693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0285"
FT                   /product="glycoside hydrolase family 10"
FT                   /note="KEGG: family 10 glycoside hydrolase; PFAM: glycoside
FT                   hydrolase family 10; Ricin B lectin; Methyltransferase type
FT                   11; SMART: glycoside hydrolase family 10; Ricin B lectin"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43853"
FT                   /db_xref="GOA:D9T5J8"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J8"
FT                   /inference="protein motif:PFAM:PF00331"
FT                   /protein_id="ADL43853.1"
FT                   /translation="MVNTTRNLGLGHGSAFGERGVAKRLGTLSRHTSLTGRRLLEIGCG
FT                   DGTYTMRLVGAFEQIEAVDIQQDRLALFRERLADYPAAAQKINVRELSATELDYPDESF
FT                   DLVTAIEVVEHIDDLDAALRQVRRVLVPGGCFALTTPNRWFPFETHGFLIRGKRYRPAR
FT                   GPFLPWIVPLHRRLADARCFTARGLSAQLRRAGLEPVAVDYVNEAFNEDGSRRQSNLQG
FT                   TGNDWIEVAFRTARAADPSVKLCYNDYNIENWSYGKTQGVYNMIRDFKSRGVPIDCVGL
FT                   QTHFTGGSSLPGNFQTTLSSFAALGVDVALTEVDVTNSSTSQYAGLTQACLNVPRCIGI
FT                   TVWGVRDSDSWRSNENPLLFDGGGNKKAAYTSVLNVLNAATPNPTPTGTASPTAGPTPT
FT                   AGPTTPPPTNGASRIVGNQSGRCIDVPNSSQSNGTRVQLYDCHGLTNQRWTYTSSRQLT
FT                   VYGSMCLDAAGSGNGSAVQIYSCNGQTNQQWNVNSNGTITGVQSGRCLDVWGTGNGQQV
FT                   QIYDCNGQANQRFQLVATS"
FT   gene            complement(286721..286999)
FT                   /locus_tag="Micau_0286"
FT   CDS_pept        complement(286721..286999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0286"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: stp:Strop_4330 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43854"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5J9"
FT                   /inference="similar to AA sequence:KEGG:Strop_4330"
FT                   /protein_id="ADL43854.1"
FT                   /translation="MMPVWSCGGCDLPWPCPTRKQELRAEFAGAPVSLALYLGSYLIQA
FT                   TEDMPWTPAGMLHRRFLGWTREADQPMPAARQRPPSAEITSRAVPPR"
FT   gene            complement(287014..287193)
FT                   /locus_tag="Micau_0287"
FT   CDS_pept        complement(287014..287193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43855"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K0"
FT                   /inference="similar to AA sequence:KEGG:Sare_4772"
FT                   /protein_id="ADL43855.1"
FT                   /translation="MKDDQEQAILAVHVRGFDGMCTGCRAWWSRLTPYPCWQVEWATSR
FT                   QARTITARFLDGVR"
FT   gene            287843..289264
FT                   /locus_tag="Micau_0288"
FT   CDS_pept        287843..289264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0288"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   saq:Sare_4805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43856"
FT                   /db_xref="GOA:D9T5K1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K1"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADL43856.1"
FT                   /translation="MLLGNLRIPDDLWSREDVHTALASRDIGALFRLLARHTGASQTRI
FT                   GAAVGLEQGYVSRIIAGRRVTSIDVLERIATGCGMPDDARMTLGLAPRPRSYRPAMADH
FT                   SRGRHSDVPANRSWREDVRAAAQLWEGDVNRRDMLRQTVFSSTAYTLPALRWFTATTAQ
FT                   PVDQEGRRAVGQPDIDTIRQMTATYRRLDNQYGGGHARDNVTRFLHHEVTPLVIEGRYD
FT                   PATGRRLLIAVAELAQLAGWQAYDMAEHGLAQRYLTQALDLARTAGDAGLGAEILAAMS
FT                   HQATYLGHAATGIDLARAARQTAQRAGLTVLTAEALVMEAHAHAVALHERDCAAALHQA
FT                   EQALDRADRSSDPQWLGYFDEAYLSAKFGHCFHALGQHRRAERFAARSLKMDERYVRGK
FT                   AFNLALLASVHARHGEPERASAIGTEALTLTTQLRSARAVRYVRDLQTGLTPHRRKPAV
FT                   RQFITRVDAALGQRR"
FT   gene            complement(289265..289831)
FT                   /locus_tag="Micau_0289"
FT   CDS_pept        complement(289265..289831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0289"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: saq:Sare_4804 NUDIX hydrolase; manually
FT                   curated; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43857"
FT                   /db_xref="GOA:D9T5K2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL43857.1"
FT                   /translation="MTDEVAGRSTRWTIHGERVVDGSRRSRLSIADVELPDGVRFEQYV
FT                   IRAPRSAMVAVLDGQERLLLMRRHRFVFDRWVWELPGGYVDEGEDPAKCAVREVEEETG
FT                   WRPEAVEPLLSFQPWVATADAENLLFLAREAEHIGAPVDVNETERVAWIPLGEARRLVS
FT                   EGEIVGAGTVIAVLELVARRARGEL"
FT   gene            289971..290282
FT                   /locus_tag="Micau_0290"
FT   CDS_pept        289971..290282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0290"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   sen:SACE_5121 IS3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43858"
FT                   /db_xref="GOA:D9T1W3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9T1W3"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADL43858.1"
FT                   /translation="MAAPKKYPDELRQRAVRLYRESDPKPVIRRLAEQLGVHHEALRNW
FT                   IRQAEADADERHDRPTSEMAEENRRLRREVAELRRANEILKAASAYFAAELDPTRRRS"
FT   gene            290279..291205
FT                   /locus_tag="Micau_0291"
FT   CDS_pept        290279..291205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0291"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   sen:SACE_5120 IS3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43859"
FT                   /db_xref="GOA:D9T1W2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9T1W2"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADL43859.1"
FT                   /translation="MRFIHEHRDQFAVALLLRVLNIGASTYYAWVKQVEQPCDRDVVDL
FT                   GLVSNIHEIWETSGRTYGADRVHRQLRRDGIRVGRKRVERLMAQQGWQGAFLRRGWRGG
FT                   STKQDPRHTPAPDLVNRQFTADGPNRLWVADATRIPCGEGVFWLAAVRDAFSRRIVGWK
FT                   TSDRCDTDLILAALEYGIWSRDVRDGQLIHHSDRGSNYTSFRFAERLQDNGILPSMGSV
FT                   GDSYDNALMENFWSTLKIELVYRTSWRTRDEAENAIFAYIDGWYNTRRIQKELDYLSPN
FT                   EYETAWHTRQTQPSEPPIATPAPAGSR"
FT   gene            complement(291682..292980)
FT                   /locus_tag="Micau_0292"
FT   CDS_pept        complement(291682..292980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0292"
FT                   /product="transposase"
FT                   /note="manually curated; KEGG: sma:SAV_670 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43860"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D9T2K1"
FT                   /inference="similar to AA sequence:KEGG:SAV_670"
FT                   /protein_id="ADL43860.1"
FT                   /translation="MAAGYRVDAQRWRVLFDDLMLTIGQRFRRPEPRRRVCDFVRGLLA
FT                   PLPRKNCWTIAEHAGDAGPDGMQDLLTRVKWDDAEVRADVREFVGHHLGDAEAVLVIDE
FT                   TGDLKKGRHTVGVQRQYSGTAGKIENCQVAVHLVYATDAGHAMLDTALYLPKSWCDDPE
FT                   RRAEAGVPEQVRFATKPQLSSRMITAAVTAGLPCRWVAGDEAYGNDPRLAAQLRQLRLG
FT                   YVLAVACSHQVTTGLGVYRADALAAGLPATAWQRLSAGRGAKGYRYYDWSFTALPHAAD
FT                   AHGGHHWLLIRRNRRTGELAFYRCWASETVPLRSLVLVAGRRWKIEESFQAAKTGLGLD
FT                   QHQNRRWTSWHRWTTLAILAHAFLAAATTHRSRPDPAGLIALTANELRHLFNILIIEPT
FT                   RRHCDPLLWSVRRRRHQQRAMTSHYARQALTEP"
FT   gene            294164..295921
FT                   /locus_tag="Micau_0293"
FT   CDS_pept        294164..295921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll5083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43861"
FT                   /db_xref="GOA:D9T5K6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K6"
FT                   /inference="similar to AA sequence:KEGG:sll5083"
FT                   /protein_id="ADL43861.1"
FT                   /translation="MPPIISGENPGGTSPPHGLPTISLMPTAVFGGPSKPNEDVYINFG
FT                   GATHPITYFVGRNGTGKSKTAAAVTRAYGGRLLATDRLLGLMKAADYGWGTLPQSGYRG
FT                   VPLGGQERQNIDNFVNHADYAGVIYATQNLYALREQPEVWLKVAAFIRRALGRIIELRE
FT                   DAGYLDPYVRIGDMEYSLLRDEGHGLRELVILLTAVYRSDWRCLVVDEPELHLHPSLAR
FT                   IWIGELEQQCRTTGRQAIIVTHEPSLLRPKSADDLAAIWYFAPNSRPLRISDHVLPVQT
FT                   DRVTASLQQNPDLISQLVFSPRPVLVEGPHDVAALTASLQRTQPQEVVAQTDFIACGGS
FT                   GAVALWYEISQKIGLDIKAVADLDACFSPEIQRALDKSPGVVRRYIEDFAADIPKTIEI
FT                   IRPFIRASDRAQVGAEPRSRGRWLADSLEAEGHLVRKEKLLAIWRDADLWLHPQGTLED
FT                   VLGISNKGSTEAAAAAQAPGRIDDVTEWCAYRLDPSGDVFELLGATIERIAHNIMEALR
FT                   LSPGTDFSQPVGVTSKSDGRLVQVTPIGDGVHRLTVLAPAEFAGYWLEFARHTPSTDLV
FT                   LREPERDAV"
FT   gene            complement(295996..296620)
FT                   /pseudo
FT                   /locus_tag="Micau_0294"
FT   gene            296729..297013
FT                   /locus_tag="Micau_0295"
FT   CDS_pept        296729..297013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0295"
FT                   /product="Protein of unknown function DUF3027"
FT                   /note="PFAM: Protein of unknown function DUF3027; KEGG:
FT                   stp:Strop_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43862"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K7"
FT                   /inference="protein motif:PFAM:PF11228"
FT                   /protein_id="ADL43862.1"
FT                   /translation="MAPGQAVDRQRRGHNNHCHQRWIKQRNRDTADPAYPEAWYDEQCG
FT                   GCRFWIPLDGELGHDYGACTNPASNFDGRVRFEHDGCAAFANRDDGSFG"
FT   gene            297216..298616
FT                   /locus_tag="Micau_0296"
FT   CDS_pept        297216..298616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0804 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43863"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K8"
FT                   /inference="similar to AA sequence:KEGG:Sfri_0804"
FT                   /protein_id="ADL43863.1"
FT                   /translation="MIALPDGYTWAEPLNAGVPLDLDRRKHGDQWIDFVFRRLADSSGA
FT                   TGHQMASHDTFPGGYICQPTGTRIQSALWLLFPVDQGPICVVIGRDSPRDDDIEPWRDA
FT                   VAHALGQIGTVTEFGWWAIIGPDPNSSGGGIRLVPPREVGSLKLDAAPDVFVENVPARF
FT                   NLFSARSCRTGLVKVRGTSTGYTWGVAAEDAARRLRLLCAMLSIAGESWVQRCSVNPLI
FT                   NMNEAGEAEPTSGDEIELPVKSPWDRDDLISMEDISEMTTMETPDWIVSRWDAIASDAG
FT                   LQDVLVNYHEGLLMMPDHPSYAALAFVAVIEALGNRTVGKLPRCDQCKVVTGSGQRFRQ
FT                   ALTRVLPAEEAEYFGRRFYDRRSRTAHEGVLHGAEPIFGAWSHWGGISDNQIRDFEILL
FT                   RNLSTVARRLLLLEAGQVEVPKSSLLWPALISSGLTDLASPAADGGETPTSGDQEPDVD
FT                   ARCDKRQL"
FT   gene            298588..298710
FT                   /locus_tag="Micau_0297"
FT   CDS_pept        298588..298710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43864"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5K9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL43864.1"
FT                   /translation="MLGAISGSYSLGPQGSVVLLFTSARGKLVNDRYWAELWSG"
FT   gene            complement(299017..299091)
FT                   /locus_tag="Micau_R0008"
FT                   /note="tRNA-Lys3"
FT   tRNA            complement(299017..299091)
FT                   /locus_tag="Micau_R0008"
FT                   /product="tRNA-Lys"
FT   gene            299265..300389
FT                   /locus_tag="Micau_0298"
FT   CDS_pept        299265..300389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0298"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerization and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: tcu:Tcur_0111 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43865"
FT                   /db_xref="GOA:D9T5L0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5L0"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADL43865.1"
FT                   /translation="MVPAVALVALLGLIVQSEGIDTTAELVALLVVLASSAALYLRRRH
FT                   PVAVGLVALAAVAAYGALLHRPGPIMLVFVVALYTVVDEGYLAVAVGLGLASVVSFAVA
FT                   ESYTRTGVSGNGATLLHAGWLVAVIVGVTRNRRAYLAEVQARVLAAEQRKEEEARHRAT
FT                   EERLRIARELHDLLGHHLSLISVQASAALHRPDPERSAEALTVIKQTSRETLRELRAAL
FT                   GVLRQESTTPNRPAPGLDRLDELVTAAGRRGLTVRTEVTETGPLPPEVDLSAYRIVQEA
FT                   LTNVSRHAGATTAVVRVVPDGDEVLVEVADDGAGPAGPPGNGILGMGERARALGGSLTT
FT                   GPGPDGGFLVRARLPLRPAPLPIPAPRTAQGETT"
FT   gene            300386..301048
FT                   /locus_tag="Micau_0299"
FT   CDS_pept        300386..301048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0299"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: sro:Sros_8793 response regulator receiver
FT                   protein; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43866"
FT                   /db_xref="GOA:D9T5L1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5L1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL43866.1"
FT                   /translation="MIRLLLADDQTLVRAGFRSILDGEDGIEVVGEAADGTTAVRLTRE
FT                   LRPDVVLMDIRMPLLDGLAATREIVAGTDARVIILTTFDLDDYVYGALRAGASGFLVKD
FT                   TEPAELIHGVRVVARGDALIAPAVTRRLIAEFAARTRHPDPGPRLNALTEREREVLALV
FT                   AAGLSNDEIAARLVLSPATAKTHVSRIMTKTRVRDRAQLVVLAYESGLTVPGWLTAS"
FT   gene            complement(301115..301498)
FT                   /locus_tag="Micau_0300"
FT   CDS_pept        complement(301115..301498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_3335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43867"
FT                   /db_xref="GOA:D9T5L2"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5L2"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_3335"
FT                   /protein_id="ADL43867.1"
FT                   /translation="MSIRHLLATTVVGEFAPAAHTSLAAGGIGGSGRAGATVIALVGLT
FT                   SVVVGGLALSRSRRGPGEGRVQALVAAASGLVSMVLSAWHLALTTEGLGSGQGRAGAVA
FT                   GVALGLIGAVLGGLALARSRRTA"
FT   gene            301682..301981
FT                   /locus_tag="Micau_0301"
FT   CDS_pept        301682..301981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_0852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43868"
FT                   /db_xref="UniProtKB/TrEMBL:D9T5L3"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0852"
FT                   /protein_id="ADL43868.1"
FT                   /translation="MRVTSTAAVAASREVPGDDGVRRPGGEVHAWLPSRNQTLCGLPLS
FT                   RTRLRRFPHVPFDYSGTDVLTEADPEGWLCPRCLAATAGRRDRERGWVRTNPRP"
FT   gene            302019..303101
FT                   /locus_tag="Micau_0302"
FT   CDS_pept        302019..303101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0302"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sro:Sros_5491 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43869"
FT                   /db_xref="GOA:D9T6C3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADL43869.1"
FT                   /translation="MRIVIVGATGNVGTAVLRRLRREVGTELVGVARRLPGPDAGEPYG
FT                   DVEWHSCDIGAPGAADQLVRIFAGARAVVHLAWQIQPSHDRRTLYRTNVGGSRAVIEAA
FT                   VRVGVPALVYASSVGTYAPGPKNQPVSENWPATGVETSSYSRDKAEVEALLDGVQREHP
FT                   KLRVVRLRPGLIFQREAGTEISRYFLGPLVPVRLLRYGRIPLVPSNRRLRMQAVHADDV
FT                   ADAYARAVVGDASGAFNVAADPVLTPELVARHFHGWTLPVAVPVLRAAAAVTWRARLQP
FT                   VDTGWVDLALNVPLMSSHRAETELGWSPSIDTVTALKELFAGMATRAGTGSPPLSPDPA
FT                   LPGRPAALTRGQLPGHPNPY"
FT   gene            complement(303611..304759)
FT                   /locus_tag="Micau_0303"
FT   CDS_pept        complement(303611..304759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0303"
FT                   /product="Polymorphic membrane protein Chlamydia"
FT                   /note="PFAM: Polymorphic membrane protein Chlamydia; KEGG:
FT                   kfl:Kfla_4105 polymorphic membrane protein Chlamydia"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43870"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C4"
FT                   /inference="protein motif:PFAM:PF02415"
FT                   /protein_id="ADL43870.1"
FT                   /translation="MKSAVTLLALALTTAMLPACGDDPAPAPAAGVAGSSAGPAAAPAA
FT                   SPSGRSGLGSARPSPSPATVTFRAGNPNGRAAVPAEARPVDTSRPTRTVGSGTPASCTS
FT                   EAVVKAVAAGGVITFDCGPAPVTITMKATAKVVNSHGPRVVLDGGGTVTLSGGGKRRIL
FT                   YMNTCDEAQGWTTSHCQNQDHPRLTVQNLTFADGDATGERTEGGGGGAIFVRGGRFTVI
FT                   NSRFVGNRCDRTGPDLGGAALRVLSQFENKPVYVVSSTFTGGVCANGGALSSIGVSWTV
FT                   LNSVFRDNRAVGTGANPARGGTPGGGSGGAIYCDGNEFAVRIAGTVIEDNSANEGGGAI
FT                   FFVSNNRTGTLKIDSSTLRRNPSRGFETKGHPGIFFLGAQIS"
FT   sig_peptide     complement(304694..304759)
FT                   /locus_tag="Micau_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(304867..305616)
FT                   /locus_tag="Micau_0304"
FT   CDS_pept        complement(304867..305616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0304"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: kfl:Kfla_1154
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43871"
FT                   /db_xref="GOA:D9T6C5"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C5"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ADL43871.1"
FT                   /translation="MPEWLEAGFWGLLAGSALLIGAAVGFFARVPRRVTASVMAFGAGV
FT                   LLSAVSFELIDEAHKQGGLLPVAIGAAAGALLYTAANVLLARHGARHRKRSGDEQPSER
FT                   EQPGSGTAIAVGALLDGVPESVVIGASLLAGGPVSLVTVIAVFLSNVPEGLSSAAGMRQ
FT                   AGRTRRYVFGLWTAIALISGAASLAGYTLLGGAPPEVLATITALAAGAILAMITDTMVP
FT                   EAFADAHLLVGLITVLGFLVAFALSHA"
FT   gene            complement(305656..306855)
FT                   /locus_tag="Micau_0305"
FT   CDS_pept        complement(305656..306855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0305"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43872"
FT                   /db_xref="GOA:D9T6C6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL43872.1"
FT                   /translation="MHIRRLAADERLTTSFPLQAYAFEASPMGATRTDQFRAYLPYNAG
FT                   NTTLVAEEDGVTAAAVSAIPMRQNLRGAVLPMAGVAGVATHPLARRRGHVRTLMQQLLD
FT                   GVRDEGHQLTALHPFRASFYERFGYIGLPRRRTAVFDPADLAPLLRAELPDELVWERIG
FT                   AGYARWRAYTERCLRERHGFAVFPDFRAVGLRDRDDRWLVSVVRGGETVGAVTYRIDDH
FT                   AGTLFADDLLVDDAYARASVLQFFARHVDQVARISVQVTPDELPELWLTDLDVQVEARV
FT                   ARPDPTAPMARLLSLDALAEQPVGVGRVLIEVVGDRWLAGRHLLDGTTGKLAVLPAQTA
FT                   AEGSVPTARLTAAGLSALAYGVLDPAEVVVRGLGEVPVDAAGELRRLFPRELPHLFADF
FT                   "
FT   gene            complement(306908..307627)
FT                   /locus_tag="Micau_0306"
FT   CDS_pept        complement(306908..307627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0306"
FT                   /product="Protein phosphatase 2C-like"
FT                   /note="KEGG: saq:Sare_4532 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43873"
FT                   /db_xref="GOA:D9T6C7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C7"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADL43873.1"
FT                   /translation="MTLILRSAILNDVGLVRTNNEDSALAGDRLVAVADGMGGLPAGEV
FT                   ASEIVIRILDELTPPTGADEAADALRAVVSTANQRIRAAITVDPARDGMGTTLTAALLA
FT                   GDTLVLAQVGDSRCYLLRDHELTQLTRDDTFVQALVDQGALSRDQARHHPQRSLVTRAV
FT                   QGSDAPPAVGALTVFPGDRLLLCSDGLSDYVEDAAIAAALATYGDRQQCGEQLVKLAHQ
FT                   AGAPDNVTVVISDVTEA"
FT   gene            complement(307721..308284)
FT                   /locus_tag="Micau_0307"
FT   CDS_pept        complement(307721..308284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0307"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: sro:Sros_0410 putative transcriptional
FT                   regulator, XRE family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43874"
FT                   /db_xref="GOA:D9T6C8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL43874.1"
FT                   /translation="MTAAAPADDRGAREVGRRIRSLRTERGISLSELARLAGVGKATLS
FT                   GLENGVRNPRLETLYAITAQLGVPLTAVLATPDQAPTLRGAAVGGTLLEVFSDREATYE
FT                   LYRMWVTPGPAQLSPAHSSGVTEHVTVFSGVLRAGPADAPLTAGPGGYLRWTSDVPHTY
FT                   AAVGEEEVHASLLLRYPRPSTPDS"
FT   gene            308343..309557
FT                   /locus_tag="Micau_0308"
FT   CDS_pept        308343..309557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0308"
FT                   /product="benzoate transporter"
FT                   /note="KEGG: sro:Sros_0411 putative benzoate transporter
FT                   protein; TIGRFAM: benzoate transporter; PFAM: Benzoate
FT                   membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43875"
FT                   /db_xref="GOA:D9T6C9"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6C9"
FT                   /inference="protein motif:TFAM:TIGR00843"
FT                   /protein_id="ADL43875.1"
FT                   /translation="MGGRLQPVLAGVVTALVGFASSFTVVLAGLRAVGADPDQAASGLL
FT                   ALCVASGACAVWLGLRHRLPLSIAWSTPGAALLVATGPVAGGWPAAVGAFLLAGLLIIA
FT                   AGLIPALGRAVAAIPAPIASAMLAGVLLPLCTAPVRALVEVPRLAGPVVLVWLLLHRFA
FT                   RRWAVPGALAVAVVAIALTTSGPARLDVAPVVAFTAPSWTLPAVVGLALPLFLVTMAAQ
FT                   NVPGTAVLAGYGYRAPLGSALRVTGLATALGAPAGGHAVNLAAITAALAAGPDAHPDPE
FT                   RRWIASVTAGIGLALLGLGAGAATALVLLSPPVLVEAVAGLALLGALAGAVTAAVAQPD
FT                   AREAAVVTFVVTASGVSLLGVGGAFWGLVAGWLMLLLFRRRAVASPPVEPPRTESAPTL
FT                   SGRTG"
FT   gene            complement(309624..310349)
FT                   /locus_tag="Micau_0309"
FT   CDS_pept        complement(309624..310349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43876"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D0"
FT                   /inference="similar to AA sequence:KEGG:Srot_0358"
FT                   /protein_id="ADL43876.1"
FT                   /translation="MLLTYVDESYTDRWYWIGALLVPEAVAIPLSTALDEVMTDAAKAY
FT                   GIDRAAELHGYDLFQGRTAWARVPPRARIAVYNAALKAIGTYDVTVILRGVDRHGLTRR
FT                   YGLTRPAHEVVLSHLLERVDGYAAMRDELALVIADEVDNPARHRSDLTRYRVDGTGGYR
FT                   SRRLSRIVDTLHFAPSHASRLVQAVDLVTFLFRRMASGAGADPREATTNTRLWSWVEPR
FT                   RYHSWCWHPTGRPTHEGPA"
FT   gene            complement(310429..310794)
FT                   /locus_tag="Micau_0310"
FT   CDS_pept        complement(310429..310794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43877"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D1"
FT                   /inference="similar to AA sequence:KEGG:Strop_4110"
FT                   /protein_id="ADL43877.1"
FT                   /translation="MSQQQDTVSRVTTGMRVVDSAGVEVGTVDLVQRGDPAAVTVQAPA
FT                   PVDPGSSLDELIESAAAEEPDVPADLAARLLRDGYLKVSTELVRTGAVYVLADRIAAVG
FT                   DGAVRLTVPAAELPAEE"
FT   gene            complement(310824..311072)
FT                   /locus_tag="Micau_0311"
FT   CDS_pept        complement(310824..311072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43878"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D2"
FT                   /inference="similar to AA sequence:KEGG:Strop_4109"
FT                   /protein_id="ADL43878.1"
FT                   /translation="MEQRRHWWNGKWGRLARRDVFLRVDGDRWHVEQRAGGAEGISRFY
FT                   EHASVEEAEETIRALLDGTDTWRELSPRPPGGWAPSV"
FT   gene            complement(311150..311620)
FT                   /locus_tag="Micau_0312"
FT   CDS_pept        complement(311150..311620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0312"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: dra:DR_2422 large conductance mechanosensitive
FT                   channel; TIGRFAM: large conductance mechanosensitive
FT                   channel protein; PFAM: large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43879"
FT                   /db_xref="GOA:D9T6D3"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D3"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADL43879.1"
FT                   /translation="MLKGFKDFIMRGNVVDLAVGVVIGAAFTGVVTQLTKSFLEPLVRV
FT                   FIALITGSKDGLSGSTPKFRGIPFDWVAFVNAAITFVLTAAALYFLVVYPMNRLAERRK
FT                   RGEEPPPSAPSEEVKLLTEIRDALLAGNHGTPGQRSALDDVLGRRQEPPAPR"
FT   gene            complement(311661..312344)
FT                   /locus_tag="Micau_0313"
FT   CDS_pept        complement(311661..312344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0313"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: saq:Sare_4529 GntR domain-containing protein;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43880"
FT                   /db_xref="GOA:D9T6D4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D4"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADL43880.1"
FT                   /translation="MTPAVDSVAVPPRGHRVRQTIEQLRERILGGEWPVGGRIPTEPQL
FT                   VAALGVGRNTVREAVRALVHAGVLECRQGSGTYVVSTDELAPVVARRLTDDRMTEVIEV
FT                   RRAFEVEAARLAALRRTPEDLAALDGALAAREAAWCGGRVDEFVEADAALHTVVVAAAH
FT                   NAMLAELYASVGAALRSTVAQAMGEALTSERYVDHSRLVEAIRAGDPQRAAIEAGAFLE
FT                   GPAGA"
FT   gene            312394..313662
FT                   /locus_tag="Micau_0314"
FT   CDS_pept        312394..313662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0314"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   saq:Sare_4528 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43881"
FT                   /db_xref="GOA:D9T6D5"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL43881.1"
FT                   /translation="MTPPPAPAATVPAPGVTPAAGPAPAAGPVRGGLLVLAGMLLVALN
FT                   LRAAVTSLGALLDEIRVGLGLSGAMAGLVTTLPTIAFAGLGALTPWLVRRWAAPRVLVV
FT                   AMVALTVGQVLRAVTGSAAVFVLTSALALAGIAVANILLPMLVKQHFPHRTGLVTGAYT
FT                   MALTVGTTVAAASAVPVAHAFGSWRAGLGIWAGLAALAVLPWVPLALRARAARRAAPPA
FT                   VAVAAPARVQPGRTRLGWAMAVYFGAQSLSGYAIMGWLAQLFRDAGYRPETAGLLLAGV
FT                   TALGVPVALMMPALAGRLATLRPLVLSLTVFSAAAYAGLALAPHGLAPLWVLLLALGQG
FT                   AFPLILTTIGLRARTAEGTVALSAFAQSTGYVIAALGPLLVGILYEATGGWTAPIGFLL
FT                   VALAVQTAAGMVIARPRYIEDER"
FT   gene            complement(313673..314029)
FT                   /locus_tag="Micau_0315"
FT   CDS_pept        complement(313673..314029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0315"
FT                   /product="anti-anti-sigma factor"
FT                   /note="KEGG: anti-sigma-factor antagonist; TIGRFAM:
FT                   anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43882"
FT                   /db_xref="GOA:D9T6D6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D6"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADL43882.1"
FT                   /translation="MSLTVHTEQHGDVVVVSVAGELDMATAPQLQDQITDLLDKGRNRL
FT                   VFDLAEVSFCDSTGLSVFVRAKNNCDEAGGVVRLAAPQRGVLRILEVSGLVEVLHTYPT
FT                   VEQAVAGDPTPASS"
FT   gene            314189..315049
FT                   /locus_tag="Micau_0316"
FT   CDS_pept        314189..315049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0316"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sro:Sros_2269 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43883"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D7"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADL43883.1"
FT                   /translation="MALSAEQGDRLAHLLTEHAERLTSRWTEIVAGSLRGRLSRAELAR
FT                   QMQELHRALVDVGRHGVSDLAGEHGGELRAVLSELSTNRARQGFSATETAISVFALKEA
FT                   LLELMEEEKGDGTLRDFVAYSALVDQMGLFTFETFVRARESLIADQAEQLLELSTPVVK
FT                   LWEGVVAVPLVGTLDSARAQVVMERLLQTLVDTGSPYAIIDITGVPAVDTQVAQHILKT
FT                   VVAARLMGADCIISGIRPQIAQTIVALGIEFGDIATKASLADALRHVLRLTGVETTARR
FT                   PRRES"
FT   gene            315049..315459
FT                   /locus_tag="Micau_0317"
FT   CDS_pept        315049..315459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0317"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sro:Sros_2268 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43884"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D8"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADL43884.1"
FT                   /translation="MERVPILKIGDILLVSIQVDMSDQTAVQLQEDLAERIVATGCHGV
FT                   IIDITALDIVDSFVGRMLSTIASISKVLDAETVVVGMRPAVAITLVELGLSLNGIRTAL
FT                   NVERGMELIAASRADEWDEAADDEDTETTATA"
FT   gene            315456..315875
FT                   /locus_tag="Micau_0318"
FT   CDS_pept        315456..315875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0318"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: ami:Amir_3742 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43885"
FT                   /db_xref="GOA:D9T6D9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6D9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL43885.1"
FT                   /translation="MTTGVDLGVPATQAIRSDEDVVRVRQLARTTAVAVRLSLVDQTKL
FT                   VTAASELARNTLIYGGGGSAEVSTVSDGRRRGVRIVFADEGPGIPDLDLALTDGYTTGG
FT                   GLGLGLSGARRLVDDFDIRTAVGEGTRITVTKWSR"
FT   gene            315872..316885
FT                   /locus_tag="Micau_0319"
FT   CDS_pept        315872..316885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0319"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: fal:FRAAL1278 putative two-component system
FT                   regulatory protein; PFAM: Stage II sporulation protein E;
FT                   SMART: protein phosphatase 2C domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43886"
FT                   /db_xref="GOA:D9T6E0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E0"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADL43886.1"
FT                   /translation="MIADVVPDHGIWFRVDTGATAGSVRRAAERLGRQLELSAARVADL
FT                   AIVTAEITSNLVKHAREGTLLMRPARRGGRAGVELVAIDSGPGMADLTLSSADGHSTAG
FT                   TLGIGLGAITRQSSRFDGYSSPGRGTVLVVQVWDAAPPEPDWAGGLARPITGEQTSGDG
FT                   YAVRQVGGRRQVLVSDGLGHGPLAAAATGAAVSAFRSAPDGPPDVVVRHLHAAISHTRG
FT                   AALAVAEPDPAAGVLRYAGLGNIAAMIVAPGERRRGLVSLPGIAGHQRPAIRGYDYPFS
FT                   RDATLVMHSDGVVDRWDLDDYPGLAGRNPLLAAATLLRDAGVRRDDACVLVARGAA"
FT   gene            316882..318228
FT                   /locus_tag="Micau_0320"
FT   CDS_pept        316882..318228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0320"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: ami:Amir_3740 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43887"
FT                   /db_xref="GOA:D9T6E1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL43887.1"
FT                   /translation="MTEPLLHLALRVEQDIFLVRQRGREVAAAVGLEHQDQVRIATALS
FT                   EVARELLHGADGADVTFALDRDAVGRRVLQVDLSPLRPLPGGRYEPQSGAVARLVDTLR
FT                   VVAVEGDTVVRMSRRVPDHAEELTAERAAELRAELAERAPGSALDELAAQNAQLIAALD
FT                   EVRSQRDELAVLNSELQETNHGVMALYNQLTEELEETNRGVVALYAELDEKSAQLRAAS
FT                   ESKSRFLANVSHELRAPVTAIIGLARLLADSASDPLTGEQARQVGLIRSSAGDLLGLVN
FT                   ELLDLAKAESGRIEPDWSDVDLRAVFGQLRGTLRALAARPEVELVVEEPPAPATVRSDE
FT                   VLLAQVLRNLLHNGLKFTERGEVRLRAERRGGQWTLSVTDTGVGIPPELHERVFEEFYQ
FT                   VPGTTRVGGTGLGLPYARRLITLLGGTLELTSEPGRGSTFTVVLPAGGA"
FT   gene            318231..319769
FT                   /locus_tag="Micau_0321"
FT   CDS_pept        318231..319769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0321"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: sro:Sros_2264 serine phosphatase RsbU
FT                   regulator of sigma subunit-like protein; PFAM: Stage II
FT                   sporulation protein E; response regulator receiver; SMART:
FT                   response regulator receiver; protein phosphatase 2C domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43888"
FT                   /db_xref="GOA:D9T6E2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E2"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADL43888.1"
FT                   /translation="MDGGPVTVLVVDDSGPKRYLLVNWLTRAGFVTVEAENGTAALERV
FT                   DREHIDLVVLDVRLPDMSGFEVCERIKEAHPSIPVIHVSAHAVDVVDRAQGLTRGADAY
FT                   LAEPIEPEELVATAHAVLRYYQARRRAEQLAERLAALADATVEMHATPNFVRLLEAAAS
FT                   GAARIFNAPAAVVAETFDGDCLAGVAADPHTPATIVPWVVDDTGVPIGTRVRVDEPANW
FT                   APAGWPDGDTVTVAASRLREDRAPLYVVVPTATQTVRTPVLVQLAQAVASAVEAQRSFD
FT                   EEHRIAVTLQRSLLPQRLPDVVGLDLAVRYEPASAQTEVGGDFYELVMLDGHLLVAIGD
FT                   VAGHSLHAATVMAELRHAVRAYAVEGHQPGVILDRVNELMRNLLPTELATICVLLLHPP
FT                   TGLVRLASAGHLPALLSRDGRVEFVTQSAPLLGVRAPRPPDLEFVLPAGATLVLYTDGL
FT                   IERRDATIDDGMAALGVAATRVDDDLDDFCRRLLVELAPPEIHDDVAVVAVRRR"
FT   gene            319824..320390
FT                   /locus_tag="Micau_0322"
FT   CDS_pept        319824..320390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43889"
FT                   /db_xref="GOA:D9T6E3"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E3"
FT                   /inference="similar to AA sequence:KEGG:SGR_4189"
FT                   /protein_id="ADL43889.1"
FT                   /translation="MNTKTSELLAVAAPRTAAVVRGISDDQLVLPTPCPDYTVRDLLGH
FT                   LFDVVVNFQALARQEEVDWSGKTDHLTDGWRDRFATEAARLTEAWSDPATQEGVSPGMG
FT                   LPQETVGMMALIDLTVHGWDLARATGQELTVDPAVVAAGHEFMDRMGDTGQKMGAFGPP
FT                   VPTGAAPDSMDALLGRAGRDPAWTR"
FT   gene            320464..321000
FT                   /locus_tag="Micau_0323"
FT   CDS_pept        320464..321000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0323"
FT                   /product="transcriptional regulator PadR family protein"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sma:SAV_5389 PadR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43890"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E4"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADL43890.1"
FT                   /translation="MSTSHVLLGLLAAGPRHGYELKRAHDERLPRARPLAFGQVYATLA
FT                   RLCRDGLVATAGQTREGGPDRTSYALTEDGRAALDHWLGTVEPPMPYVASTLFAKVVVA
FT                   LLVADVDQARVYLIAQRQAHTQRLRELTALKTAPGARLDEVVAADFAIAHLDADLRWLH
FT                   TTLDRVADWHREVRT"
FT   gene            320997..321698
FT                   /locus_tag="Micau_0324"
FT   CDS_pept        320997..321698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0324"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: sma:SAV_5388 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43891"
FT                   /db_xref="GOA:D9T6E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL43891.1"
FT                   /translation="MTFLQARGVVRAYGHNPALRGVTLDVAEGEIVAVTGPSGCGKSTL
FT                   LHCLAGILRPDAGQVTWRGERIDTWSEAARSRLRRTEFGVLFQFGQLVAELTAAENVAL
FT                   PLLLAGTGRRAARTAALSWLDRLGVADVADARPGEMSGGQQQRCALSRALVTEPRVIFA
FT                   DEPTGALDTLAGEQVLTQLVRLAREQRTTVVLVTHEPRIAAYADREVSLRDGMVDHTGL
FT                   GLDPALPGGSR"
FT   gene            321695..323206
FT                   /locus_tag="Micau_0325"
FT   CDS_pept        321695..323206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0325"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sma:SAV_5387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43892"
FT                   /db_xref="GOA:D9T6E6"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL43892.1"
FT                   /translation="MRPGTLLRLVLAGTRTDIARVVLTAVSAALATLAGLAALTVLSVV
FT                   KPSGDEGLNSDQYTNALLREPGLRPGVAFALLLLCVPVLGLAGQCARLGAPGRDRRLAA
FT                   FRLAGATPGQVTRVAVAETGVASLLGTLVGLAVFLAGRRLLHRPDADGRLPLPTDVHPA
FT                   PVAVAAVVLGLPLAAALVSALLLRRVATTPFGVVRKVRTRAPWPWPGVLILAALAMFAA
FT                   IRPLLLWYERRGAVAPDWPVPTLLVVGGLTAMIGVVSGTGWISYRTGRLLHRHGRGPAA
FT                   LLAARRLAADPWAGSRTFAALLAALIFGAGAAGLRADFQAEAEVTRRTGSGLADPGFYL
FT                   GAMDLVDLAVLVAMAIAGGGLLVAVVEGITSRRRAYAAQVATGVPRATIGRSLLWAALA
FT                   PAVPAIGLALTVGYLLVRGVMPAPSNGGFTRTICDAGSELCGDPATAARYTRTEWVPKT
FT                   TVPPDVPWDQLAWLAAGGLAAVLCTVVAGLLFLRTATSVEELRAG"
FT   gene            complement(323291..325384)
FT                   /locus_tag="Micau_0326"
FT   CDS_pept        complement(323291..325384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0326"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="KEGG: stp:Strop_4105 oligopeptidase B; PFAM:
FT                   peptidase S9A prolyl oligopeptidase domain protein
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43893"
FT                   /db_xref="GOA:D9T6E7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E7"
FT                   /inference="protein motif:PRIAM:3.4.21.83"
FT                   /protein_id="ADL43893.1"
FT                   /translation="MTETPPPVAKRVPTERLHHGDTVLDEYAWLAAKDDPDTIAYLDAE
FT                   NAYTEARTAHLAGLRAELFEETRRRTQETDLSVPTRKDGYWYYTRTVEGQQYGVHCRRA
FT                   VRPGETAPPVSADGAPLDGEEVLLDGNQLAEGHDFFSLGAFDVSPDGRWLAYSTDFSGD
FT                   ERFTLRIKDLTTGESLPDEVPDTFYGTAWSSDASTLFYVTVDEAWRPNRVWRHTVGTAS
FT                   TEDVVVYQEDDERFWVGVELTRSERFVVIDIHSKITSEVWVIPASNPTGEPAVVAPRRQ
FT                   GIEYAVEHHGHRFLILHNDGAEDFALAYTSADSPGEWEPLIPHTPGTRLEAVDAFENHL
FT                   VVSLRTNGLTGLRVLPVGTDDSWDIDFPEPIYSVGLDASPEYRTNEVRLRYTSLVTPDS
FT                   VYDYDLVTRELTLRRQKPVRPGPDGRAYDPADYEQHRDWALADDGTRVPISLVCRRDTP
FT                   RDGSAPAVIYGYGSYEASMDPWFSIARLSLLDRGVIFAVAHIRGGGELGRRWYDEGKLL
FT                   AKKNTFTDFVACARHLVKAGWTASDRLVARGASAGGLLMGAVANLAPDAFTGIVAQVPF
FT                   VDALTSILDPSLPLTVTEWEEWGNPLDDPEVYAYMKSYTPYENVATVEYPAILAVTSLN
FT                   DTRVLYHEPAKWIARLRSLAPAGDYLLKTEMGAGHGGPSGRYDSWREEAFVNAWILDRV
FT                   GRA"
FT   gene            325467..326960
FT                   /locus_tag="Micau_0327"
FT   CDS_pept        325467..326960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0327"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG: FAD
FT                   linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43894"
FT                   /db_xref="GOA:D9T6E8"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E8"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADL43894.1"
FT                   /translation="MCTITAMADAARSTELEALDITRKLAAICGTPFARFAGPADEVAG
FT                   RTARWVAVPGGPHAAAEVLRLAAAHDLTVVPRGAGTKIDWGAAPAQVDIMLDTGRLAGV
FT                   WHEPRDAAVAEIGAGTPLRAVQATLARTNRRLPVDAPSPGATLGGVLAADESGPLRHRH
FT                   GSPCAQLVGVRYLDADGELVSVGESGTEALGRATPGSGGGRASGRGPAGDGGGGDPGRG
FT                   GGDAILGRGEVPGLDVARLLCGSQGGLGVLVSATMRVHAVPAGRLWVSRPVWTPLEVHD
FT                   LVRAVLAAGVDPAAVELDLPVPVPLPRRRIPPSHPSVVNRPDHPAVTGRPAAGSLVVLL
FT                   EGGPADVTERAERLTAVLGAEAIVSHHAPEWWGRYPFAPGDTALRIEVPINDLHAAVYA
FT                   LRDATGGPVPVRGSAGSGTVHAALSGALPPERVASILTAVRSVLIARRGRCVVVAAPAA
FT                   VRRAVDLWGELPTLPRLRSAKAHLDPHHRLAPGRLPGGL"
FT   gene            complement(327432..329492)
FT                   /locus_tag="Micau_0328"
FT   CDS_pept        complement(327432..329492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0328"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: stp:Strop_4104 stage II sporulation E family
FT                   protein; PFAM: Stage II sporulation protein E; GAF domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   protein phosphatase 2C domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43895"
FT                   /db_xref="GOA:D9T6E9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6E9"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADL43895.1"
FT                   /translation="MSAEAGPASGGADERVRRVRLPADRRTPAAARALVRTMLLEARLP
FT                   ELLNEALLLTTELTTNAVEHARTELDIEVDTDRNGLTVTVTDFASGPVDELIVGVRNTT
FT                   SDITEVAARGRGLLLVDHFSSRWGTTYLPTGKGVWFRLDRPGPGGSARPSAGPLRVAEP
FT                   EGNGDGTPSAAAMSELMQLTPDSYADEPLPEFATGLLTRVAEMVGAAGGTVRLDRGDGL
FT                   GTQVFARYGRPAREGNELLRVPLAVHRPYSGELELDAAPSAYARPLAVLAAERLSLHLE
FT                   NDRLRRADVRRSTWLTFLAEASELLAQSLDVELTMALIPQLVVPRLGQWCAVHTTDEWG
FT                   RLRLAASSHADEAMLPQLHRILQETGQDSIQSRLREASRNAAQMPLGGPMEGFAVPLIA
FT                   RGQRLGTLAVGRHQRHRHDPDEVSVLEDVARRAALAIENARIHAERRRVAQTLQQSLLP
FT                   PVLPVVEGIGFAAEYVPTGDDAEVGGDFYDVLPLPDGRWLVVVGDVSGKGVQAAAVTGL
FT                   VRDVIRVLVGDGKPLPEVLGRLNETLVERGGGRYCTLALAAVAPGDGDQLDVSLHLAGH
FT                   DRPVLLHGGGGATFVGAGGTALGLLDTITTPTAELTLKPGDALIFYTDGVTERRRGREL
FT                   FGTDRLRESAAPLAGYSADVVAARLRAATIAFSVEPPRDDIAILVLRNDTP"
FT   gene            329663..334027
FT                   /locus_tag="Micau_0329"
FT   CDS_pept        329663..334027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0329"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: sna:Snas_1053 GAF sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; GAF
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; histidine kinase A
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43896"
FT                   /db_xref="GOA:D9T6F0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL43896.1"
FT                   /translation="MATVNQSVTADPSASDHEVLLGELVEALRRVGRGDLRVRLPRRAG
FT                   LPGEVADAFNDVVSLQERQHLDLRRISRIVGRDGRLTERLDDEGLDGSWAEGQRAVNSL
FT                   IDDLGRPTTEIARVIVAVADGDLSQHMALEIDGRPLRGEYLRIGRTVNTMVDQLSSFAD
FT                   EVTRVAREVGTEGKLGGQADVRGVAGTWKDLTDSVNTMASNLTGQVRSISQVATAVAKG
FT                   DLSQKITVGARGEVAELADTMNSLTDTLRLFAEQVTRVAREVGTEGKLGGQAEVPGVAG
FT                   TWKDLTDNVNSMASNLTAQVRNIAQVSTAVAKGDLSQKITVAAQGEILELKDTVNTMVD
FT                   QLSSFADEVTRVAREVGIEGKLGGQAQVRGVSGTWRDLTENVNQLAGNLTSQVRNISQV
FT                   STAVAKGDLGQKITVDAQGEILELKNTVNTMVDQLSSFADEVTRVAREVGTEGKLGGQA
FT                   QVKGVSGTWRDLTDNVNSMASNLTSQVRNIASVTTAVAKGDLSQKITVDARGEILELKS
FT                   TVNTMVDQLSSFADEVTRVAREVGTEGKLGGQAQVRGVAGTWRDLTDNVNSMASNLTAQ
FT                   VRNIAQVSTAVAKGDLSQKITVDAQGEILELKSTVNTMVDQLSSFADEVTRVAREVGTE
FT                   GKLGGQAQVKGVSGTWRDLTDNVNSMASNLTSQVRNIASVTTAVANGDLGQKITVDAQG
FT                   EILELKNTVNTMVDQLSSFADEVTRVAREVGTEGKLGGQAQVKGVSGTWRDLTENVNQL
FT                   ASTLTTQLRAIAQVSTSVTRGDLTQRINVKAQGEVAELKDNINQMIVTLRETTKKNAEQ
FT                   GWLDSNLARIGGLLQGQRDLGEVCRMIMQEVTPLVDAQLGAFFLADSSEGSMRLRLTAS
FT                   YGYVARGHDVTFGPGEGLVGQAALSRRTIRVKAQPDGRLVVRSGLADTPPADLVVLPVQ
FT                   FEGELLGVIEFAGVATFSELHLAFLERLVLTIGVAVNTIQANRRTEELLAQSQRLAHEM
FT                   QDQSAELQRTNAELEDKAKLLSEQKANIETQNREIELARLGLEEKAQQLTRASAYKSEF
FT                   LANMSHELRTPLNSLLLLARLLAENPERNLSAKQIEFARTIHGAGSDLLSLIDDILDLS
FT                   KIEAGRMDVEPTEIQFAEIRGYVEQAFAPQAEEKGLDFQVRVSRDLPPALVTDAQRLQQ
FT                   ILRNLLSNAVKFTDNGAVTLRIGLAADNAVFDVPALTNAQRVIAFTVIDTGIGISDDKL
FT                   SLIFEAFQQADGTTSRRYGGTGLGLSISRDLARLLGGTITVSSAPGQGSTFTLFVPDVL
FT                   APDAVVAPAPPSPSRAGLPSSLLMPMELPQPQETPATRRLDGVTVLIIDDDVRNVFALT
FT                   SALELHGMTVLYSDNGADGVRQLAEHPEVDIVLMDAMMPDQDGYETTAQIRRNHRFADL
FT                   PIVFLTAKAMPGDRESALGAGGSDYITKPVDLDELIELMASWISRSRGEENA"
FT   gene            334024..334581
FT                   /locus_tag="Micau_0330"
FT   CDS_pept        334024..334581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0330"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: saq:Sare_4522 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43897"
FT                   /db_xref="GOA:D9T6F1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL43897.1"
FT                   /translation="MTQTAKALLVDDRRENLMALEAILQGLPVQSVAVESGEAALKQLL
FT                   VDDFAVILLDAQMPDMDGFETATHIKRRERTRHVPIIFLTAADKDAQLALRGYAAGAVD
FT                   YLTKPFDPWVLRAKVTVFVDLWVKTRQLAAQSDLVRERDLQWRHLTDAVDEATALLRAD
FT                   DDPSTRERAVELLEQARWGNTR"
FT   gene            complement(334586..335089)
FT                   /locus_tag="Micau_0331"
FT   CDS_pept        complement(334586..335089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cwo:Cwoe_5391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43898"
FT                   /db_xref="GOA:D9T6F2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F2"
FT                   /inference="similar to AA sequence:KEGG:Cwoe_5391"
FT                   /protein_id="ADL43898.1"
FT                   /translation="MNVPPQHDEEEVHLFVERMAMAFADVGFPRMAARVLFTVMSADDP
FT                   LTAGEIAERLGVSAAAVSGAVRYLTQFAMLVREPVKGSRRDRYRMPDNPWYEATITKTT
FT                   LYKNFIDIAAGGVDALHGRSTPAGERVAEMRDFFLFVQEELESLGDRWRARRAATGHGG
FT                   PAGG"
FT   gene            335164..336102
FT                   /locus_tag="Micau_0332"
FT   CDS_pept        335164..336102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0332"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: svi:Svir_36950 ABC-type multidrug transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43899"
FT                   /db_xref="GOA:D9T6F3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL43899.1"
FT                   /translation="METAIDVSGLVKTFGRTRALDGLDLTVRTGEVHGFLGPNGSGKST
FT                   TIRVLLGLLRADAGAVRLLGGDPWRDAVALHRRLAYVPGDVTLWPGLSGGEVIDLLGRL
FT                   RGGLDPERRAELLESFELDPRKKGRTYSKGNRQKVGLVAALASDVELLILDEPTSGLDP
FT                   LMEEVFQHWVRRARQDGRTVLLSSHILAEVEALCDRVTIIRAGRTVESGTLGDLRHLHR
FT                   TAIDAEVTAPLDGLADLPGVHDLRVDGQRVRFDVDTASLDAALRRLTELGVRSLVSTPP
FT                   TLEELFLRHYETTPAVDVAPSAAVRETADRS"
FT   gene            336099..337691
FT                   /locus_tag="Micau_0333"
FT   CDS_pept        336099..337691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0333"
FT                   /product="putative exporter of polyketide antibiotics-like
FT                   protein"
FT                   /note="KEGG: cwo:Cwoe_5389 putative exporter of polyketide
FT                   antibiotics-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43900"
FT                   /db_xref="GOA:D9T6F4"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F4"
FT                   /inference="similar to AA sequence:KEGG:Cwoe_5389"
FT                   /protein_id="ADL43900.1"
FT                   /translation="MSALTGTRHLVRLILRRDRLLLPLWVLVLAVLPITYAASFFELFP
FT                   TAAERAAYLEGTARNPSIVALLGPAYGDSVGALTAQRSGFLLLIVALASLLTVIRHTRT
FT                   EEEAGRRELLGGSVLGRHAGLTAALLVTYGADLVLGLLTAAGLVSTGLPVGGSVAYGLV
FT                   TVLTGTVFATLGGLAAQLTETAGGARGIGLAGLGAAFGLRLAGDTAGNDWPSWLSPLGW
FT                   AARVRPYEGERWWVLLLPLAATVLLAAFAYPISVRRDLGAGVLPPRLGPAGAGGALSGP
FT                   SGLAWRLHRGQILWWSVGFGLLGLILGGAAEAAGRSVEGSPRMEEIVARLGGASGMADA
FT                   YLGVTLSLAGLAAAGYGIQAALRMRAEEAAGHAEPVLATGTRRSTWLLSHVAFALLGPV
FT                   VVLGVTGLATGLTYGLSTGDVPRQLGRMLAAGLAQVPAAWVLAGLAVLLYGLLPRLASA
FT                   AWVVLAVCVLLGQLGAVLELDQWLLDVSPFTHTPQVLRDAWTPTPLYVLTALAVTLATA
FT                   GLLTFRRRDIPVL"
FT   gene            complement(337790..338122)
FT                   /locus_tag="Micau_0334"
FT   CDS_pept        complement(337790..338122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0334"
FT                   /product="anti-anti-sigma factor"
FT                   /note="manually curated; TIGRFAM: anti-anti-sigma factor;
FT                   KEGG: saq:Sare_4521 anti-sigma-factor antagonist; PFAM:
FT                   Sulfate transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43901"
FT                   /db_xref="GOA:D9T6F5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F5"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADL43901.1"
FT                   /translation="MDRAELSITVHRTGDEAVLRLAGEIDMLTAAQLSTVVNEVLADPP
FT                   PRIVLDLAGVTFCDSQGLGTLVVLSRKASHTQCLLMLTNVGDFLIRVLDITGLRSALMI
FT                   RNEATP"
FT   gene            338280..339617
FT                   /locus_tag="Micau_0335"
FT   CDS_pept        338280..339617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0335"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="KEGG: stp:Strop_4100
FT                   glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43902"
FT                   /db_xref="GOA:D9T6F6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F6"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADL43902.1"
FT                   /translation="MTETFSAGSGRYPADAPASEALFDRAKAVVPGGVNSPVRAFRAVG
FT                   GTPRFMVRGEGPWLFDADGRRYVDLVCSWGPLILGHAHPAVVEALREAAPLGTSFGTPT
FT                   PGEVDLAEEIIARTPVEQVRLVNSGTEATMSAIRLARGFTGRAKIIKFSGCYHGHSDAL
FT                   LAAAGSGVATFGLPDSPGVTGAAAGDTIVLPYNDLRAVEEAFAAEGRHIAAIITEAAAG
FT                   NMGVIAPRDGFNSELARIAHANGALLIVDEVMTGFRVSRAGWHGLDPSDADLWTYGKVM
FT                   GGGLPAAAFGGRAEIMAKLAPAGPVYQAGTLSGNPLACAAGLATLRLADDALYRRLDET
FT                   AAALGKLTTEALSAAGVPHRLSTAGNMFSVFFTDADVHDYDSARTQVVPAFKAFFHAML
FT                   AGGVYLPPSAFESWFVSTAIDDAAWEQIAAALPVAARAAAAAGHGG"
FT   gene            339621..340268
FT                   /locus_tag="Micau_0336"
FT   CDS_pept        339621..340268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0336"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="KEGG: saq:Sare_4519 phosphoglycerate mutase;
FT                   manually curated; PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43903"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F7"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADL43903.1"
FT                   /translation="MAETVVHVLRHGEVHNPDGILYGRLPGFRLSELGVQMAKAAAQAL
FT                   ADRTVVHVVASPLERAQQTAEPIAAQFGLSVGVDERLIESANWFEGKKVSPGDGSFRDP
FT                   RNWWVLRDPVTPSWGEAYRAIAERMFAALHAARVAAEGREAVLVSHQLPIWTLRRHVER
FT                   KRLWHDPRRRQCGLASLTSFHFDGAKIVGIGYSEPAAHLVSISPTARTAKGA"
FT   gene            340268..340843
FT                   /locus_tag="Micau_0337"
FT   CDS_pept        340268..340843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0337"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: saq:Sare_4518 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43904"
FT                   /db_xref="GOA:D9T6F8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F8"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADL43904.1"
FT                   /translation="MLTRRLAAALLAAVTAGTVLVGCSSGSQESRCAADGSTVTCAPDQ
FT                   RSKTPKVSGELLTGGSYDISRDRGQVVVVNFWGSWCAPCRAEADDLEATYQATKGSGVT
FT                   FLGINVQDSKDKAIAFEEGRVTYPSIFDPASRQALNFDIPPNTTPATVVLDREGRIAVV
FT                   IRRAVTRDELRPIVEDIAAEAPPPNGAR"
FT   sig_peptide     340268..340351
FT                   /locus_tag="Micau_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.288 at
FT                   residue 28"
FT   gene            340843..341736
FT                   /locus_tag="Micau_0338"
FT   CDS_pept        340843..341736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0338"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: stp:Strop_4097 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43905"
FT                   /db_xref="GOA:D9T6F9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6F9"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADL43905.1"
FT                   /translation="MGETFRQLAESGPLLLAVGAAALAGLVSFLSPCVLPLMPGYLSYV
FT                   TGLAGSDLEGARKGPLLTPPVEEGPLLNTGAAAGSSAGGSGGSGGVSVAERAAPQRTTA
FT                   AVKGRVLAGTLLFIAGFTVVFVATAILFSGVGKLFFRYERTLEIVIGALVVVLGLGYLG
FT                   VIPGMQREFRIRWLPSAGLLGAPVLGAVFALSWLPCTGPTLGAVLGMAATEGGTDRAVV
FT                   LAVAYCLGLGIPFVVFGLGFQRLLGVFRAVRRNSRWVTRIGGALLIAIGLALITGGWVN
FT                   VVIWLQTNVGVGEVSI"
FT   gene            341736..343355
FT                   /locus_tag="Micau_0339"
FT   CDS_pept        341736..343355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0339"
FT                   /product="ResB family protein"
FT                   /note="KEGG: stp:Strop_4096 ResB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43906"
FT                   /db_xref="GOA:D9T6G0"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G0"
FT                   /inference="similar to AA sequence:KEGG:Strop_4096"
FT                   /protein_id="ADL43906.1"
FT                   /translation="MTTVDDRPSTPPAQAPRRRVNPVLALLRNSWRQLTSMRTALILLF
FT                   LLAVAAIPGSVLPQRGVNPERVNQWFVDHPDLAPRLNQIGAFEVFGSVWFSAIYLLLFT
FT                   SLIGCILPRARDHVRALRMKPPAAPKRFDRLPQHAVLEAPAAADPEAIAAVLRRRRWRV
FT                   TVRGDEVSAEKGYLKETGNLLFHVSLVAVLLGVALGSWYGWHGNRILVAGEDNAFCNTR
FT                   QQYAEASLGPRVDSSDLPPFCLTLEKFEADYLPSGLASRYWATVTVDEPGGTERTAGFS
FT                   VNSPLRLGSANVYLLGNGYAPLLKYTDKYGRSQTSEAPFLRTGDSNATEEGVAIFPDAN
FT                   VDPKTGARAPDQQIAFDGLYLPTAPESAPYVSSQYPAERNPAVNLTAYRGNLGLDAGIP
FT                   GSVYALDRRQIDDGKLKEIGTKLLRPGEKWTLDDGSTLEFVGTKPYITLAVRHAPGQTL
FT                   LLVASGTLLLGLMGSLFARRRRVWFRVSPPEGGSPTSGSSLVEAGGLPRTEHPGFADEF
FT                   AQLVAAVSGDAPDARRAREGDD"
FT   gene            343355..344329
FT                   /locus_tag="Micau_0340"
FT   CDS_pept        343355..344329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0340"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="KEGG: saq:Sare_4515 cytochrome c assembly protein;
FT                   TIGRFAM: cytochrome c-type biogenesis protein CcsB; PFAM:
FT                   cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43907"
FT                   /db_xref="GOA:D9T6G1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G1"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ADL43907.1"
FT                   /translation="MSALSDQLVAFAILAYLIAMISHAVEFALGNARKVPAAAPARELV
FT                   GAGVGGAGGTIDEPAVAATPPRPDRTGARAVLAGRIAAWLTVLAAAVHLGAVVTRGLAA
FT                   DRMPWGNMYEFVLTGTWIGVAAWLVVLWKQPWLRRLGLFLTLVMVLLLAFAELKLYVPI
FT                   EPLMPALQSWWFIIHVSTIIFASGIFLLGVVPAAAYLMRSGWEQGRRSFPYTLARRLPE
FT                   AAGLERLTFMLHAFSFPIFTFAVIAGAIWAEAAWGRAWGWDPKETWAFISWVVYAGYLH
FT                   ARATPSVKRNVATWISIVGFLTVMMNLFGVNFFFTGLHSYAGV"
FT   sig_peptide     343355..343429
FT                   /locus_tag="Micau_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.828 at
FT                   residue 25"
FT   gene            complement(344298..344522)
FT                   /locus_tag="Micau_0341"
FT   CDS_pept        complement(344298..344522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43908"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL43908.1"
FT                   /translation="MDDAYVVGDPDGLSPLQAEIRDAVARELHAQFALRADRLELADLP
FT                   EVAYQVTRRVDEVLSARPVTTPRRTSADR"
FT   gene            344619..346103
FT                   /locus_tag="Micau_0342"
FT   CDS_pept        344619..346103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0342"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="KEGG: scb:SCAB_51721 putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43909"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G3"
FT                   /inference="similar to AA sequence:KEGG:SCAB_51721"
FT                   /protein_id="ADL43909.1"
FT                   /translation="MPLFGKPAEIFDRDVEWAELARFVADDRPGATLGVVSGRRRQGKT
FT                   LLLYQLAQASEGFYFGATEATSTESLRRLGEALGAYSGSPGPVHLPDWGAAVDALLALG
FT                   RERPVTVVLDEFPYLVRAARDLPSIIQHALTPGRPERTGSRARLLLCGSALSFMGGLLA
FT                   GSAPLRGRAGLELPVQPLDFRAAAAFWQIDDPLLAVRVFSVVGGTPAYRREYVQDDTPA
FT                   GSDDFDAWIVRTVLNPARPLFREARYLLAEDPDLRDTALYHSVLAAVAEGNASRGGIAG
FT                   YIGRKATDLQHPLTVLEDAGLLLREPDPLRSGRSSYRITEPLITFYQAVMRPAWTALEQ
FT                   RRGADVWRRSQRRYASAVLGPRFEEIVRQWSLRFAEPELLGGHVAEVSAATLTDPDTRT
FT                   RHELDLVAVGEPPPGDGPRPLLAIGEVKWGRRLGRADLQRLERIRALLVRRRPGVDAAG
FT                   ARLLLAGGHGFEDDLVDAAAGRADVVLVDPALLYGR"
FT   gene            complement(346113..346583)
FT                   /locus_tag="Micau_0343"
FT   CDS_pept        complement(346113..346583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0343"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: sen:SACE_1607 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43910"
FT                   /db_xref="GOA:D9T6G4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL43910.1"
FT                   /translation="MATPDRPGFALPLLLLAGFRTLVDDLHAELARQGHPELRPAHGFV
FT                   LQAVGPAGTTASDLGQRLGVSKQAAGKTVDRLVALGYLERVDDPADARRKLVRMTAKGR
FT                   DGLHRSAVVFDELRDRWAATLGADRVAAIEDDLRRMVPADVFRLDIPGWFAG"
FT   gene            346647..347201
FT                   /locus_tag="Micau_0344"
FT   CDS_pept        346647..347201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0344"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="KEGG: scl:sce5382 hypothetical protein; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43911"
FT                   /db_xref="GOA:D9T6G5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G5"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADL43911.1"
FT                   /translation="MSRFTAYEPDTAPAAARPVMAGVRRSLGHLPAAVSLMAGSPELLK
FT                   GFLAANAAFEATDLDPVAREVVVLTVATRNGCHLCVAMHTATLVRHGAAPELIEALRTG
FT                   ATLPDPRLEALRRFTVAVLDHRGAVPDADLDALLAAGWQARHALDVVLGVGTYTISTFA
FT                   NRLTEAPLDEPLAAYAWQPAA"
FT   gene            347287..348753
FT                   /locus_tag="Micau_0345"
FT   CDS_pept        347287..348753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0345"
FT                   /product="UbiD family decarboxylase"
FT                   /note="KEGG: saq:Sare_4514 UbiD family decarboxylase;
FT                   TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43912"
FT                   /db_xref="GOA:D9T6G6"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G6"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADL43912.1"
FT                   /translation="MGGMAARFPYTDLKDFLAALERAGELRRVSAPVDPTLEISEIVTR
FT                   TVRAGGPALLFERPTRGEMPVAINLFGTEKRMAMALGVEHLDEIGERIGDMLKPELPQG
FT                   FSGMMGGLGKVMQLKSMPPKKVKTAPCQQVVYRGDDVDLNRLPGLQVWPGDGGIFHNFG
FT                   LTHTKHPETGKRNLGLYRLQQHSHNTIGMHWQIHKNSTAHHAVAERLGQRLPVAIAIGA
FT                   DPVVAYSASAPLPADIDEYLFAGFLAGERVEMVDCLTVPLQVPAHAQIVLEGYIEPGER
FT                   LPEGPFGDHTGFYTPVEPFPVMHIECMAMQRDPVYHSIVTSQPPQEDHGLGKATERIFA
FT                   PLLRFLIPDIVDYDLPAAGVFHNCAIVSIRKRYPKHAQKVMNAIWGAHMMSLTKLIVIV
FT                   DEDCDVHDYNEVAFRAFGNVDYARDLMVTEGPVDHLDHASYQQFWGGKAGIDATRKLPE
FT                   EGYSRGWPEEMRMSPEVVSLVDKRWKEYGI"
FT   gene            348753..349658
FT                   /locus_tag="Micau_0346"
FT   CDS_pept        348753..349658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0346"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="KEGG: stp:Strop_4093 prenyltransferase; TIGRFAM:
FT                   4-hydroxybenzoate polyprenyltransferase; PFAM: UbiA
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43913"
FT                   /db_xref="GOA:D9T6G7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G7"
FT                   /inference="protein motif:TFAM:TIGR01475"
FT                   /protein_id="ADL43913.1"
FT                   /translation="MTAAVQERPGRVSSFLKLVAIEHSVFALPFAYLSALTAMQLNGGR
FT                   VRWGDLLLITVAMVGARTFAMAANRILDRRIDARNPRTANRELVTGAVSVRTAWTGAAV
FT                   ALVVFLAAAALLNPLCLVLAPLAVVPLVVYPYAKRFTNWPHAILGVAQAVGPVGAWLAV
FT                   TGTLDGSGPAWLLGAAVGLWIGGFDLIYACQDSEIDREIGVHSVPARYGRRFALHASTV
FT                   AHVVTFALFIWFGAWVGFGWLWWIGLALTAVAFAYQHMVVSPTDLSKVNRAFFTANGFV
FT                   GIALFVLALLDLVIRLGLRP"
FT   gene            complement(349680..350645)
FT                   /locus_tag="Micau_0347"
FT   CDS_pept        complement(349680..350645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0347"
FT                   /product="Terpene synthase metal-binding domain-containing
FT                   protein"
FT                   /note="PFAM: Terpene synthase metal-binding
FT                   domain-containing protein; KEGG: rxy:Rxyl_0493 terpene
FT                   synthase, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43914"
FT                   /db_xref="GOA:D9T6G8"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G8"
FT                   /inference="protein motif:PFAM:PF03936"
FT                   /protein_id="ADL43914.1"
FT                   /translation="MTAAVLRALRSDCPIPPRLSPYADDVQGWLVAQVDRLGLPADPAT
FT                   RQRLARAGFARYAGRLYPDATEPDLRVLTTLFTWFFLVDDACDGRDGLTPAQIRALRDG
FT                   ALALLREGPRARHPGFSGPLRRLLVQAWREPRRRMPARWRLRFADAVADHLDGVHREAT
FT                   ATTSGRPPGVAEYVRLRRATSAAYVSYPLIEFASGRPLPDAVYHHPALRRLAGLANDLL
FT                   SWFNDIASLERDRATGGGHNLVLATAAERGVPVPAAVDLVAGHWRAEMDRFAALLAAAP
FT                   SFGPTLDDAVASHLDGLAAAVRGTVDWTLESARYPVAAAS"
FT   gene            350789..351433
FT                   /locus_tag="Micau_0348"
FT   CDS_pept        350789..351433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0348"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="KEGG: saq:Sare_4512 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43915"
FT                   /db_xref="GOA:D9T6G9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6G9"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADL43915.1"
FT                   /translation="MREPWVVGVSGASGTPYAAAVVRGLLDAGQAVDLIVSRAARLTVL
FT                   DETGRPFRDAHWTEDLAAWLDRDLTGADLRHWPAGDLAAGPSSGSYPVRGMAVVPASTA
FT                   ACAGIAIGLSKDLLQRAAEVNLKERRPVVVVPRETPVTRSHLEHLIALHDAGAVVLPAS
FT                   PGFYGAGAAASAGQLVDFVAGKVLDALGVEHTLFRRWSGELAAGRREADPD"
FT   gene            complement(351491..351757)
FT                   /locus_tag="Micau_0349"
FT   CDS_pept        complement(351491..351757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0349"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: saq:Sare_4511 DNA binding domain-containing
FT                   protein; TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43916"
FT                   /db_xref="GOA:D9T6H0"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H0"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADL43916.1"
FT                   /translation="MDTGDRLLTPGEVAALFRVDPKTVTRWAAAGRIGSIRTPGGHRRF
FT                   RESEVRALLEGEGMLDEAEDMGKARNMGPTANTGPGPANAGMY"
FT   gene            352015..352473
FT                   /locus_tag="Micau_0350"
FT   CDS_pept        352015..352473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0350"
FT                   /product="Transcription regulator AsnC-type-like"
FT                   /note="KEGG: saq:Sare_4510 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43917"
FT                   /db_xref="GOA:D9T6H1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADL43917.1"
FT                   /translation="MDTIDLSLVELLRGNARLSYAELARQVGLSAPAVHERVGKLESSG
FT                   VIRAYRAEVEPESIGLGVTALIGIIEDSDADTDEVLEAFRRIPEIESCYFMAGVESFLL
FT                   KARVGTIAELEQLIVRLNRTAGVASTRTSIALSTKWENRPQPLEPPTA"
FT   gene            352516..353358
FT                   /locus_tag="Micau_0351"
FT   CDS_pept        352516..353358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0351"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ami:Amir_2536 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43918"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL43918.1"
FT                   /translation="MTSSERGAAVVTGAAGGLGRAIAAALHADGWNVLLTDTDAGAVAA
FT                   AAAPLGGWSRPLDVRDESACADVAAEAAAAPGGLGLWVNNAGILVTGPSWAHDAPTRRA
FT                   VVEVNALGAINGTLAAVAVMREQGRGHVLNVVSLAGLIAAPGETVYAASKHALLAFSLG
FT                   TLSDLRMAGVRGVHVSCLCPDGIWTPMLHDKLDDPGALASFTGSLLTPERVAARAVRLA
FT                   RRPRPVVSLPRWRGAQVRLLDAFPRLALALTPVIRATGRAGQRRQARRVRENPSPPRL"
FT   sig_peptide     352516..352587
FT                   /locus_tag="Micau_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.406 at
FT                   residue 24"
FT   gene            353369..354463
FT                   /locus_tag="Micau_0352"
FT   CDS_pept        353369..354463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0352"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: stp:Strop_4089
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43919"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADL43919.1"
FT                   /translation="MTHLDRCDEASRRWVTEAIATVEADANRSADTHLLPFPLPREWGI
FT                   DLYLKDESVHPTGSLKHRLARSLFLYGLCNGWIGPDTTIVEASSGSTAVSEAYFARMLG
FT                   LPFIAVMPASTSPEKIAQIEFQGGRCHLVDDPSKVVVEARWLAEDSGGRFMDQFTYAER
FT                   ATDWRGNNNIAESIYAQLALERHPVPAWIVVGAGTGGTSATIGRYARYRRLPTKLCVVD
FT                   PENSAFYPAWQAGDWSVRTDRGSRIEGIGRPTVEASFLPSVVDRMVQVPDAASLAAMRA
FT                   GSAVLGRRVGGSTGTNLWGAFGLIAQMRAAGRTGSVVTLICDPGDRYVDTYYSDEWVVA
FT                   QGLDLAPHLATIDRFLTDGTWPTA"
FT   gene            complement(354481..355101)
FT                   /locus_tag="Micau_0353"
FT   CDS_pept        complement(354481..355101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0353"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   sro:Sros_3333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43920"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H4"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ADL43920.1"
FT                   /translation="MPKSLFWARTDTAGSEHVVLDDGQGLTAQGVALAVDPIPYTCRYR
FT                   LTVGPDWSTNRLEVESEGAGWSRSVRLERGRVGWRVRTGEEGDLDAALSAAGHPPAGLP
FT                   GTDDPGRLAEALDVDLGGSPLTNTLPIRRIGLGRLPADLATAVNVAWVLLPGLAVVPAE
FT                   QVYTSLGPGRVRYASGTFTADLEVDPDGFVVRYPGLAERVDPR"
FT   gene            complement(355206..355448)
FT                   /locus_tag="Micau_0354"
FT   CDS_pept        complement(355206..355448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_0526 phage transcriptional regulator,
FT                   AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43921"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H5"
FT                   /inference="similar to AA sequence:KEGG:Xcel_0526"
FT                   /protein_id="ADL43921.1"
FT                   /translation="MTTACRAYFRRVRRPRLYGPGELAALFGVSRQRVLQITRRPGFPE
FT                   PLARLIGMNVWDADEVDEWARHNRPPRPTEGDEQG"
FT   gene            355574..355825
FT                   /locus_tag="Micau_0355"
FT   CDS_pept        355574..355825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0355"
FT                   /product="flavin reductase domain-containing protein"
FT                   /note="KEGG: stp:Strop_4506 flavin reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43922"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H6"
FT                   /inference="similar to AA sequence:KEGG:Strop_4506"
FT                   /protein_id="ADL43922.1"
FT                   /translation="MTQRHAPLKPLWVCTADLLNWPCENAKVELVADYEHDRRHLAVDL
FT                   AALMRQATDDLTRLYSEPPDPAEMHIRFLGWLRSVRNV"
FT   gene            355818..356039
FT                   /locus_tag="Micau_0356"
FT   CDS_pept        355818..356039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mdo:100016201 similar to VESPR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43923"
FT                   /db_xref="GOA:D9T6H7"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H7"
FT                   /inference="similar to AA sequence:KEGG:100016201"
FT                   /protein_id="ADL43923.1"
FT                   /translation="MSDPIGTGLLLAAVIAQAFGCWVAWSWGRSARRSLRQTIDKTIPT
FT                   PPPGWRPRHRLSLWNEPTRRYPVLTPRS"
FT   sig_peptide     355818..355880
FT                   /locus_tag="Micau_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.594 at
FT                   residue 21"
FT   gene            complement(356116..358023)
FT                   /locus_tag="Micau_0357"
FT   CDS_pept        complement(356116..358023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0357"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: saq:Sare_4508 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43924"
FT                   /db_xref="GOA:D9T6H8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H8"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADL43924.1"
FT                   /translation="MTTFAESSTSPSVDPTPDTVDFASLGLPRQVVEVLARQGITTPFE
FT                   IQRATLPDSLAGRDVLGRGQTGSGKTLAFGLPVIARLADRNRARPLHPRALVLVPTREL
FT                   AMQVNDALMPLGKAVGVFLKTAVGGVPYDRQIDALRRGVEIVVATPGRLGDLIERGVCR
FT                   LDDVEITVLDEADQMADMGFLPEVTQLLAKTPADAQRLLFSATLDNDVDTLVKRFMTDP
FT                   VTHSTAPATAAVSTMDHHLLLIPPHDKFAVAASIAAREGRTMLFARTQLGVDRLVEQLA
FT                   AVGVRAGGLHGGKTQRMRTKTLAEFREGRTPVLVATDVAARGIHVDGVSLVLHVDPPKD
FT                   PKDYLHRAGRTARAGESGAVATLVLPKQRRTTLAMMEKAGVEPAETRVRAGDEALAELT
FT                   GAREPSGVPVRDEPEPRRGGGSRRFGDRDGRGFDRGGRGGFSDRGERRFGDRDGRGERR
FT                   YGDRPAGERSGDRFADRGGDRRFGDRPAGERYSGERSGGERRFGRPERRDDRSFGDRGE
FT                   RSFGDRRSDGRSFGEQRSDDRGQRGERFGERADRPYGDRQRPATGRGYDRDERRYDDRP
FT                   SGSRGFGDRRQDDRPHAERRFGDRGDARPAERRAGGFRAEGRGRDDRRGFGGRPPARTH
FT                   "
FT   gene            complement(358213..359850)
FT                   /locus_tag="Micau_0358"
FT   CDS_pept        complement(358213..359850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43925"
FT                   /db_xref="GOA:D9T6H9"
FT                   /db_xref="InterPro:IPR003882"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6H9"
FT                   /inference="similar to AA sequence:KEGG:Sare_4507"
FT                   /protein_id="ADL43925.1"
FT                   /translation="MGEQDVPAEKVHPGPTPDPADPAGDDDHGSAPPGPIAVARARVSV
FT                   AGSAVPPPAGDEQPLPQAGPTTYRAATPADTPPPLDRRLPGATVPPSSWSAFAVGERQA
FT                   TSQPAAAEADGDASPGTPGSAPAAIPAPRVSGSARVPTPPVATADAAAPADAAPDRDTA
FT                   PAEQADGTAVGPQDDSQSSAAGSAESPPNAAPASAAGRPAPLTGSSTPAEQAGSAPARA
FT                   SASVPGLSRVSAEEVAASVVAAPPAAATVYRAGPVNPEPPEPVQPPEPAQPPAPNGPEP
FT                   EPAPTPVPGPTPPSPAPPVPEPEPPLRPTPPLPTPPAPAPPTPTPGPVPPIPGPPVPPP
FT                   GPPVPPPPPPPGPMPAPPFPPPPAMTGGPGPLPAPLFPAPAPGPSFPPARAAVPGPPAT
FT                   PGTPDGALPSWAAAPVSAPPPPVVPAPALPTWPPPATTARDADTTRPVRPQPAGPDLAG
FT                   TAYGGTDGPGFATVSFPQGNPLENSGSLTGHILAQGWSEEGPAARGGNTKVIIVLAVAL
FT                   TMLIAISLLVVFLANDALSSLTGTMLIE"
FT   gene            complement(359960..361555)
FT                   /locus_tag="Micau_0359"
FT   CDS_pept        complement(359960..361555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0359"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: saq:Sare_4506 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43926"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I0"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL43926.1"
FT                   /translation="MISPILRPALWSALLGAVAAAALATPAWADPLPDVVPDTGSRPQV
FT                   TGPLQLPGSSGTVRGVPGTVPGVPGAVPGLPGTVPGLPGVTTPGGTAGLPGTTGVTNPA
FT                   DGPLIAQINQLDARVTLLGEELLRIKAERDAAQTELTQSAARLKEAQDALTRAQDNAKS
FT                   AAADAVKADAALPPGEFGASLRDFANLQRITRGDKAEGATTSVTGELLRATSAEEAARK
FT                   AHESAQRRATEQTTAFTRAEADLRKQETALVALRKENAAKLLEIERLADAAEQRLGTSY
FT                   VVDQSIDGLVADPRALAAVRYALAQLGDPYLWAAEGPDRFDCSGLMLASYQAAGYRGLP
FT                   RVAKDQYFATRSRTVSPNALLPGDLLFFASSSSWTSVHHVAMYIGNGKMVEAPRTGDVV
FT                   KISVVRWSRLYAATRVIGAVPAPATPVPPPTVPATPKPSTTPEPTPTTPKPSTTPKPTP
FT                   TTPKPTTPTPKPTTSSPAPSTPPPSPTDSPDPTPSQSASAEPETSSAAPSSSSAAPSSS
FT                   TSGSGSASPSSSTD"
FT   sig_peptide     complement(361466..361555)
FT                   /locus_tag="Micau_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            361823..362992
FT                   /locus_tag="Micau_0360"
FT   CDS_pept        361823..362992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0360"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: saq:Sare_4505 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43927"
FT                   /db_xref="GOA:D9T6I1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL43927.1"
FT                   /translation="MDAGLKRELEAKVYAGERLTREDGIALYASDDLTWLGRLAHHRRT
FT                   ELNGDRVMFNVNRHLNLTNVCSASCAYCSFQRKPGEKDAYTMRIDEAVRKAKEMEDEQL
FT                   TELHIVNGLHPTLPWRYYPKVLRELKAALPKVNLKAFTATEVQWFEKISGLTADAILDE
FT                   LMDAGLESLTGGGAEIFDWEVRQHIVDHNCHWEDWSRIHRLAHSKGMKTPSTMLYGHIE
FT                   EPRHRVDHVLRLRELQDETGGFQVFIPLRYQHDFVDSADGKIRNRIQARTTMASPAESL
FT                   KTFAVSRLLFDNVPHVKCFWVMHGLSVAQLSLNFGVDDLDGSVVEYKITHDADSYGTPN
FT                   TMHRDDLLHMIWDAGFRPVERNTRYEIVREYDGPPSLAERRSEPQQVWA"
FT   gene            363000..363428
FT                   /locus_tag="Micau_0361"
FT   CDS_pept        363000..363428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43928"
FT                   /db_xref="GOA:D9T6I2"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I2"
FT                   /inference="similar to AA sequence:KEGG:Sare_4504"
FT                   /protein_id="ADL43928.1"
FT                   /translation="MSDEEQQRGFPRRDAEGRILTLGDLLGVSLAGLVIGVLALLVFEF
FT                   AFATVGDSGFGGTNGWLAVILPLWLFWDEFRAWEFGAARVVAALAGLGLGVLAGLLAAG
FT                   LASGLPALFTGALAAAVFTVVYAVIWFHGVHWLARRTG"
FT   gene            363455..363739
FT                   /locus_tag="Micau_0362"
FT   CDS_pept        363455..363739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43929"
FT                   /db_xref="GOA:D9T6I3"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I3"
FT                   /inference="similar to AA sequence:KEGG:Sare_4503"
FT                   /protein_id="ADL43929.1"
FT                   /translation="MSAAVKYTLGRVGLFVAVLAALWFVEMNMFLRLMVALISSAALSF
FT                   FLLRNWRDEMAGEMAEASERRRAEKDRLRSALAGDDEPGAEPDAERRDG"
FT   gene            complement(363824..365164)
FT                   /locus_tag="Micau_0363"
FT   CDS_pept        complement(363824..365164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_6915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43930"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I4"
FT                   /inference="similar to AA sequence:KEGG:SAV_6915"
FT                   /protein_id="ADL43930.1"
FT                   /translation="MFGRPMRAAALAGLTALTLLATSAPVQAQAPRPGVTHDEQITFQE
FT                   FSRFPDWRSGSHQGTRAVPGRHPALTIGRPAGTTEFTDEHTGTTRTWEYATWTSPERRI
FT                   GFDATEMVASWNAATPAGTWIQVELHGTYNTGAQTPWYVMGRWASGDQDIKRSTLDGQG
FT                   DPWSSIWTDTFSVDDADAGVLLRSYQLRLTLYRAPGQAAAPQVQMVGAMASNVPDRFTV
FT                   TPSRGGIAWGTELAVPRYSQNIHIGEYPEYDGGGEAWCSPTSTEMVVEYWGRKPSAEDT
FT                   SWVDPSYPDPTVDHAARMTYDYEYEGAGNWPFNTAYASSFPGLEARVTRLHSLDEAERF
FT                   IKAGIPVVTSQSFLASELDGANYGTSGHLFVIVGFTADGDVIVNDPASSSNDAVRNVYK
FT                   REQFEQIWLRTKRYRANGTVASGSGGIAYLIKPADRPWPVVPGSTNW"
FT   sig_peptide     complement(365078..365164)
FT                   /locus_tag="Micau_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            365370..366692
FT                   /locus_tag="Micau_0364"
FT   CDS_pept        365370..366692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0364"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="KEGG: stp:Strop_4082 peptidase M14, carboxypeptidase
FT                   A; PFAM: peptidase M14 carboxypeptidase A; SMART: peptidase
FT                   M14 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43931"
FT                   /db_xref="GOA:D9T6I5"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR033810"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I5"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ADL43931.1"
FT                   /translation="MAFRSSPLRRRLALAAVIGLTIVAAAAAPAVARPAPEGSGEPATV
FT                   AYRVLGPRTAADRTAVASTGAAIDYSEHGVLHVTATKAEANAITRLGFRLEKDVVPEHD
FT                   HADGGMTANAFPPADSNYHDYAELTAVVNKVVADHPTIARKLSIGTSYQGRDLMAVKIS
FT                   DNVATDEAEPEILFNAQQHAREHLTVEMAIYLLNLFTDNYGSDSRISSIVNSREIWIVP
FT                   TVNPDGSEYDIATGSYRSWRKNRQPNSGSTAIGTDLNRNWAYQWGCCGGSSGTKSSDTY
FT                   RGPSAFSAPETAALRNFVNSRVVGGVQQIKANIDFHTYSQLVLWPYGYTYSNTATGMNT
FT                   DQYNTFATIGRQMAATNNYTPEQSSDLYIADGTSIDWMWGAHKIWAYTFEMYPGSASGG
FT                   GFYPPDEVIPAQTSRNREAVLILSEYADCPYRAIGKQSQYC"
FT   sig_peptide     365370..365468
FT                   /locus_tag="Micau_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.732 at
FT                   residue 33"
FT   gene            367011..367943
FT                   /locus_tag="Micau_0365"
FT   CDS_pept        367011..367943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0365"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   saq:Sare_4501 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43932"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I6"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADL43932.1"
FT                   /translation="MSRRTPRLFATALAAGVLLLGGCAEKTSTDTPAAGGSGGAFPATV
FT                   GKLTLEKRPEKIVSLSPTSTEMLFAIGAGKQVTAVDDQSNYPAEAPRTDLSGYQPNAEA
FT                   VASRNPDLVVISDNLNKIADQLVALKIPVLQIPAAATLDDTYRQLTDLGTLTGHRSEAD
FT                   AVVQKMKDDITALTKDLPKRTDKPTYYHELGPELYSATSKTFIGTIYALAGLENIADAS
FT                   DADGKNGGYPQLSQEVIVKANPDFVFLSDTKCCKQSADTVKARSGWSGITAVKNNQIVE
FT                   LDDDIASRWGPRVVELLKVIVDATAKVPA"
FT   sig_peptide     367011..367091
FT                   /locus_tag="Micau_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.350 at
FT                   residue 27"
FT   gene            367946..369115
FT                   /locus_tag="Micau_0366"
FT   CDS_pept        367946..369115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0366"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   stp:Strop_4080 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43933"
FT                   /db_xref="GOA:D9T6I7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I7"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADL43933.1"
FT                   /translation="MALRQAESAPNPAGTPDAPRPGARLLSRPGRRGARGAAGAPIRPA
FT                   GLRKRWLFAGVVAVLVALVAGVSLGPVSLPPGSVAAELLNLLPGVHLDSGLTEREVAII
FT                   TELRLPRVVLGLLVGALLALAGGCYQGVFRNPLADPYLLGVAAGAGFAVTAAIVLGAGA
FT                   GGALTGLPITIPLAAFVGSLGAVVLTYLLGAAGGRDRSPATLILAGVAVSAFFAAGQTY
FT                   LLQQHSDNIQQVYSWLLGRLATAGWHDVWLVLPYFVLTSVVVLLHRRELDVLSVGDDEA
FT                   AGLGLHPQRSRYLLIAAASLGTAAAVSASGLIGFVGIIVPHTMRLLAGSSHRVILPLSM
FT                   LFGGAFLALTDVVARTAAAPAEIPIGVVTALLGGPFFVLVLRTARRVAM"
FT   gene            369112..369891
FT                   /locus_tag="Micau_0367"
FT   CDS_pept        369112..369891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0367"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: saq:Sare_4499 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43934"
FT                   /db_xref="GOA:D9T6I8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL43934.1"
FT                   /translation="MNAPAVRVHDLRVALGGTPVLAGVDLTVTAGEWVTVIGPNGAGKS
FT                   TLLRAVGGLLTGPGEVALFGTPIGALRRRDRARIVATVAQSPVVPIGMSVFDYALLGRT
FT                   PYIPPLGRESAADLAAVHEVLDRLDLGPFAHRELATLSGGERQRVFLARALAQGATLLL
FT                   LDEPTSALDIGHQQEVLELVDQLRRAHGLTVLATMHDLSIAGEYADRLVLLADGRVAAA
FT                   GPPEEVLTEELLARHYRAHIRVIPGDHGPLVVPVRPT"
FT   gene            complement(370286..371044)
FT                   /locus_tag="Micau_0368"
FT   CDS_pept        complement(370286..371044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0368"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: saq:Sare_4498
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43935"
FT                   /db_xref="GOA:D9T6I9"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6I9"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADL43935.1"
FT                   /translation="MNGVEPGTPCWTDLATPGLDDARRFYPELFGWTGEISPEPEAGGY
FT                   TVFRKDGKAVAGAGPPGTPDQVPVWSTYVATDDADLVATRVEAAGGQVVVSPFDVAQQG
FT                   RMAVLADPAGAVFSVWQPMAMRGAELYNAPGAMCWNELVTPDPEGAKEFYALVFGWHPE
FT                   ERPAGPVAYTGWRCGARIVAGMLPRAEPMPTDLPAYWAVYFAVEDADATAARAAELGGT
FT                   ILVPPRDNPAGRSAALRDPDGALFSVSTLR"
FT   gene            complement(371138..371875)
FT                   /locus_tag="Micau_0369"
FT   CDS_pept        complement(371138..371875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0369"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   fra:Francci3_4202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43936"
FT                   /db_xref="GOA:D9T6J0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL43936.1"
FT                   /translation="MPLALIHARYHLLEIIRVPVAVVGSAFFPAASMLFFVVPFAGDDP
FT                   VGATYATAAMVTFAVMTANIFQYGVGVSEDRDQPWNPYTRTLPTGPAPRLAGRILAGVV
FT                   LTYVSMIPVVVIAAVATDARVSAVQFLLGLGAVAVVSVPFTLLGLAIGYSLPSKAAIVV
FT                   AQVIFFPLAFGGGLLSGPDDAPGFIKAIAPYLPTRGAVELIWAAVTDFRPDTRALVMLV
FT                   VWVLVLAALAGWAYRRDEGRRFS"
FT   gene            complement(371885..372772)
FT                   /locus_tag="Micau_0370"
FT   CDS_pept        complement(371885..372772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0370"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: sro:Sros_2548 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43937"
FT                   /db_xref="GOA:D9T6J1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL43937.1"
FT                   /translation="MILAQAEQVSRRYGDVLALDRVDLTVRAGELVGLLGPNGAGKSTL
FT                   INLLVGLRRPTAGRVELCGGDPRDPASRRQLGVTPQETGLPGTLRVGEVVDFVSAHFPD
FT                   PVPRGELLDRFGLADQVRRQTGGLSGGQRRRLAVALAFVGRPRLVVLDEPTTGLDVEAR
FT                   HALWDAIRGFHADGGTVLLSSHYLEEVEALAQRVVVIGHGRVLADDSVAAIRGIVGVRR
FT                   VSLVADDLPALPGVVTTERADGRVHLLTTDADQLVRDLVTSGVPFHDLEVRPTSLEEAF
FT                   LAITADDRPAPTPA"
FT   gene            372922..373242
FT                   /locus_tag="Micau_0371"
FT   CDS_pept        372922..373242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_2806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43938"
FT                   /db_xref="GOA:D9T6J2"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J2"
FT                   /inference="similar to AA sequence:KEGG:BURPS1710b_2806"
FT                   /protein_id="ADL43938.1"
FT                   /translation="MTSPSRNLDVQPEALRSFAAASRDRAGRFRELERAFRDGHVARHS
FT                   FGVMPASFSLAAAYEQQFEACLEGLADGAEVMADIAEGLDDTAEAYTGTDVANTDMFKP
FT                   GV"
FT   gene            373252..374178
FT                   /locus_tag="Micau_0372"
FT   CDS_pept        373252..374178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_1295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43939"
FT                   /db_xref="GOA:D9T6J3"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J3"
FT                   /inference="similar to AA sequence:KEGG:Caci_1295"
FT                   /protein_id="ADL43939.1"
FT                   /translation="MSTEALQRNKTYFEQIVSGTPDPFKPLSNAVLWPFEQLLELVAGE
FT                   PDDLMRAAQLALTTGEAVRRIAGDQVADRARLRGAWDGDAADKFHASMESVEEAIEELA
FT                   KGLDGTKEVLVDAANAAVDAFNLLVELILEFLLWFLTEVIIAAVAAVLSAGVTLAATVV
FT                   RVLARLATTVGRMVKIVARFAEILTKLVTKLEKVAELLMRYRRVVLELRQAKKAYRAWN
FT                   KSGYTREAFAFKIKRAAILFPGKFAINQASPVNIPGIGGALLDTGMGLHDVSDGRKDRN
FT                   YLVDGTYREDLGPYTNGVQNVFDSIVN"
FT   gene            374188..374541
FT                   /locus_tag="Micau_0373"
FT   CDS_pept        374188..374541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0373"
FT                   /product="uncharacterized protein family UPF0133"
FT                   /note="PFAM: uncharacterized protein family UPF0133; KEGG:
FT                   sro:Sros_7887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43940"
FT                   /db_xref="GOA:D9T6J4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J4"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADL43940.1"
FT                   /translation="MTFPALDRIEALARNLDGWQRELGARMAELEQSSAEGVSDSGLVT
FT                   VVAAADGKILSTDINARAMRFDSYTLAEEITSAANRAQEAAAARVREIVGEVMGNAPGA
FT                   ERPADDGYGHDRY"
FT   gene            374546..375145
FT                   /locus_tag="Micau_0374"
FT   CDS_pept        374546..375145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_3302
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43941"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J5"
FT                   /inference="similar to AA sequence:KEGG:Mpop_3302"
FT                   /protein_id="ADL43941.1"
FT                   /translation="MDETRYRDRIGLLVEPGERVLAHAKADVGQGLAPAPPPEPESTAE
FT                   PSRRTIGSVLLNVLLPLATWDRGDRLVDAIGWGIAGRGAPGTAASRLHRALRPPRPDLQ
FT                   VRETLLAVTERRLLVCRTGGVKLLAGREAEERALAETAVAWSAARGEIASARVGWHRLN
FT                   PKRLRIDFTDGSWLSFTVPIAESGRPLREVAAALSA"
FT   gene            complement(375249..377294)
FT                   /locus_tag="Micau_0375"
FT   CDS_pept        complement(375249..377294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43942"
FT                   /db_xref="GOA:D9T6J6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J6"
FT                   /inference="similar to AA sequence:KEGG:Sare_4482"
FT                   /protein_id="ADL43942.1"
FT                   /translation="MPATDLDATPSLDAELAAERAHLDASRAALTRMRERAEALFSTGD
FT                   KVAGDSYTAEQLGRHMARRVKELADDPTTPLFFGRLDFGGDDPDHAGREYHVGRRHVTD
FT                   ELGEPLVLDWRAPVSRSFYRASARDPQGVAVRRRFGFSAGTLTSFEDEHLDRGEELGTA
FT                   SRILTAEIERPRVGPMRDIVATIQPEQDELVRADLTDSICVQGAPGTGKTAVGLHRAAY
FT                   LLYLHRERLRRSGVLIVGPNRAFLSYIAAVLPALGEVEVEQATVEDLVARVPVRAVDDP
FT                   AAAALKHDVRMAEVLRRAVEAHIGTPTEPIMVSDGSYRWRIGLDPLHRLVTETRGEGLP
FT                   YATGRERVRARVVGLLQRQAEARRAESPSDAWLRRMSRIKPVTDLLDAVWPALTPDGLV
FT                   HRLRTDADALAAAADGLLTPEEQELFRSGKISRTAKATRWTAADAVLIDEVAGLLERPA
FT                   GFGHVVVDEAQDLSPMQCRAIARRSEHGSITLLGDLAQGTAPWAATDWRDSLAHLGKPD
FT                   AAVVPLSVGFRVPAAVVAFANRLLPALAVDVPPARSLRNDGALDVRTAEDLTAATVAEV
FT                   RAALAHDGSVGVIAADDAVDRLRAALADAGVETATADDVEAAARVTVVPATLVKGLEYD
FT                   HVVVVEPAAIVAAEPRGLHRLYVVLTRAVSRLAVLHREPLPAPLTA"
FT   gene            377507..378088
FT                   /locus_tag="Micau_0376"
FT   CDS_pept        377507..378088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0376"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: sna:Snas_1225 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43943"
FT                   /db_xref="GOA:D9T6J7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL43943.1"
FT                   /translation="MTEALPGRSRVTISDPQVMRALAHPARMAIMEHLGTLEGGATATE
FT                   CAEIAGLSPSATSYHLRELAKFGLVQQAPGRGDARERLWQAVNPSYHVEVGPDADPEAR
FT                   AAEAALVEAHMVRDAQRVRDWLRRAPDESPEWYAATWFSDSMLLMTAEELTELNQAIQA
FT                   LMEPYRRRTRTDPPAGARPVATQYRAMPVD"
FT   gene            378130..379386
FT                   /locus_tag="Micau_0377"
FT   CDS_pept        378130..379386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0377"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; KEGG:
FT                   sna:Snas_1226 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43944"
FT                   /db_xref="GOA:D9T6J8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J8"
FT                   /inference="protein motif:PFAM:PF05977"
FT                   /protein_id="ADL43944.1"
FT                   /translation="MSFTTDESRWPDVWLAATARGISSCGDFLAAATLTLALQSAGAGG
FT                   LAVSGLLLAATLPLVVLAPLTGRLADRVDSRVLLVAAGLAQAAVCLALAYARDPVLVIA
FT                   LVALLATGLAVTQPAIAALVPVMVRPEDLPRAGALNQTAGTLGALAGPALAGLLVGQFG
FT                   TRVPLLVDAFSYLALVAAGLLIRTRRGGRRTPDAVAAAVAPAWRLRRDPLLTVMVGSVA
FT                   AVIGAVGAVNVIEVFFIRETLGSSTTVYGLVTGSWTLGIVLGAWLFARVARRLADDGAL
FT                   LGAGLVLLGGCCLAVLVSAAVPSAWLLVPIWLAGGVANGGNNVFDQLLLARRVPEASRG
FT                   RAFAVFGAAAQGAAMGGYLVGGLLLEVAGPRVLIAGCGVAGLLVVVALLGPVRRAVRAE
FT                   RAAARSATPAAVSVAAKSV"
FT   gene            379523..380374
FT                   /locus_tag="Micau_0378"
FT   CDS_pept        379523..380374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0378"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   stp:Strop_4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43945"
FT                   /db_xref="GOA:D9T6J9"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6J9"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADL43945.1"
FT                   /translation="MADRIARPRVGHIQFLNCLPIYWGLMRSGALIDVDLHKDSPDRLS
FT                   ADLVAGDLDIGPITLVEFLKHADDLLLLPDLAVGSDGPVLSVNVVSTRPLGELDGARVA
FT                   LGSTSRTGVLLAQLLLAERHGVRPEYFRCPPDLTQMLLEADAGVLIGDVALRALYEAPA
FT                   KGLEVTDLGQAWHDWTGLPMVFAVWAVRREFAAAHPGLVKEVHEAFLRSRDLCLAELDQ
FT                   VAEAAARWETFDAATLATYFRALDFSLGERQVAGLREFARRAAAHGEVPALPAGGPEFF
FT                   QG"
FT   gene            complement(380442..381377)
FT                   /locus_tag="Micau_0379"
FT   CDS_pept        complement(380442..381377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43946"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K0"
FT                   /inference="similar to AA sequence:KEGG:Sare_4474"
FT                   /protein_id="ADL43946.1"
FT                   /translation="MAGARRRPGSYRRPLAFSALAAALVGLLGLSLRVIPGSPLEATAN
FT                   SHPEPTSERSTQQSVDRNAPRVAPSPSIAPLPFQAKNLDSLKIKGWYAWSVLDKRTGKI
FT                   IGSANMGETSTTASLIKSWVVADYLRLSAAEGRTPSDAKLADATKIIRDSDNTRAQEFY
FT                   ENVGGSDSIERLISICRLTDSEVASDGGWSRTELSPRDTARLGLCIDDGRAAGPKWTKW
FT                   LLNEMRQVRAPGDFGIRKAFPAAQQKKIAIKNGWIDRDKEEEYHVNCLAIGDTWTMGVM
FT                   LRTPFGVEGGWEYGMDACERITKALLRPAT"
FT   gene            complement(381377..382357)
FT                   /locus_tag="Micau_0380"
FT   CDS_pept        complement(381377..382357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43947"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K1"
FT                   /inference="similar to AA sequence:KEGG:Strop_4074"
FT                   /protein_id="ADL43947.1"
FT                   /translation="MRPRVTLVLAIVAVLIGGVMLVPAAYAKLSGGDGAGGLGGGEQVP
FT                   APAPTAPAPPTLADAPVSVNFKGEFFSWALMDRETGTVTGAKNMNQTSSTESMLKAWII
FT                   ADYLRQLGDKQPSAGLKKAAILAIRDSDDDGANAVYRAAGGSYKPQPGGRPDPVIARAI
FT                   QICGLTDTRPGSVPDYKGWWSFTEMSPRDAARLGDCIADGRAAGPKWTKWLLSEMTKVA
FT                   GSVSKQAARSGGGRWGIIDGLPATIKSQGPVHMKNGWTQLAYDGNWHVSCLAFTDKWSL
FT                   SVMMRYPGSSGLPYGAKMCAAVATQLVAPQPGAALKVPQQPVGKL"
FT   sig_peptide     complement(382274..382357)
FT                   /locus_tag="Micau_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.975 at
FT                   residue 28"
FT   gene            382717..383781
FT                   /locus_tag="Micau_0381"
FT   CDS_pept        382717..383781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0381"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="KEGG: saq:Sare_4472 phenylacetate-CoA oxygenase
FT                   subunit PaaA; TIGRFAM: phenylacetate-CoA oxygenase, PaaG
FT                   subunit; PFAM: phenylacetic acid catabolic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43948"
FT                   /db_xref="GOA:D9T6K2"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K2"
FT                   /inference="protein motif:TFAM:TIGR02156"
FT                   /protein_id="ADL43948.1"
FT                   /translation="MYGNDFAPPEDAPGGGLLGEVEAAEAALREAAARARRGGPAPDED
FT                   VEAYFADVINADQKIEPRDWMPEAYRRTLIRQIAQHAHSEIIGMQPEGNWISRAPSLKR
FT                   KAILLAKVQDEAGHGLYLYAAAETLGISRDELVDLLLDGRQKYSSIFNYPTLTWADVGA
FT                   IGWLVDGAAIVNQVPLCRCSYGPYARAMIRVCKEESFHQRQGYEILHTLAHGTPAQKAM
FT                   AQDAVDRWWYPSLAMFGPPDGDSTHSAQSMAWKIKRFSNDELRQRFVDMCVGQAEVLGL
FT                   TLPDPDLRWNDERQAYDYTQPDYDELMRVIKGNGPCNRERMAHRRKAHADGAWVREAAA
FT                   AYAAKRAERKAVAA"
FT   gene            383778..384065
FT                   /locus_tag="Micau_0382"
FT   CDS_pept        383778..384065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0382"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="KEGG: saq:Sare_4471 phenylacetate-CoA oxygenase
FT                   subunit PaaB; TIGRFAM: phenylacetate-CoA oxygenase, PaaH
FT                   subunit; PFAM: phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43949"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K3"
FT                   /inference="protein motif:TFAM:TIGR02157"
FT                   /protein_id="ADL43949.1"
FT                   /translation="MNSASSPLWEVFVRARRGLSHTHVGSLHAPDAELALRNARDLYTR
FT                   RQEGVSIWVVPASAITASSPDEKDAFFDPAADKVYRHPTFYEVPEGAAHL"
FT   gene            384062..384784
FT                   /locus_tag="Micau_0383"
FT   CDS_pept        384062..384784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0383"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="KEGG: stp:Strop_4071 phenylacetate-CoA oxygenase,
FT                   PaaI subunit; TIGRFAM: phenylacetate-CoA oxygenase, PaaI
FT                   subunit; PFAM: phenylacetic acid catabolic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43950"
FT                   /db_xref="GOA:D9T6K4"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K4"
FT                   /inference="protein motif:TFAM:TIGR02158"
FT                   /protein_id="ADL43950.1"
FT                   /translation="MSLFDFTLAVGDDALIAAQRLGEWTSRAPEMEEDIALANIALDQL
FT                   GAARLLLTYAGELEGAGRDEDDLAYLRDDREFRNCLLVELPNGDFGVTMAKLFFLAAYQ
FT                   SPLYTALAGCADERLAAVGAKARKESAYHLDHASLWVKRLGDGTEESHRRMQDAVDQVW
FT                   PYVHELFAPDPAAPVDPSTLRADFDATVSAVLDEATLIRPETGWAPGGGRDGLHTEHLS
FT                   YLLAEMQVLHRAHPGASW"
FT   gene            384840..385316
FT                   /locus_tag="Micau_0384"
FT   CDS_pept        384840..385316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0384"
FT                   /product="phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /note="KEGG: stp:Strop_4070 phenylacetate-CoA oxygenase,
FT                   PaaJ subunit; TIGRFAM: phenylacetate-CoA oxygenase, PaaJ
FT                   subunit; PFAM: protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43951"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K5"
FT                   /inference="protein motif:TFAM:TIGR02159"
FT                   /protein_id="ADL43951.1"
FT                   /translation="MTDARAAAAAVVDPEIRVITIDELGILRAVDEEPDTGRVVVTITP
FT                   TYTGCPAMDVIREDIRRALAAAGHPDAEVRTVYHPAWSTDWISEAGRAKLAAAGIAPPA
FT                   PRGDDTVVPLTLAVRCPRCGSPETTQISRFGSTACKALWRCRSCSEPFDHLKAL"
FT   gene            385313..386425
FT                   /locus_tag="Micau_0385"
FT   CDS_pept        385313..386425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0385"
FT                   /product="phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /note="KEGG: saq:Sare_4468 phenylacetate-CoA
FT                   oxygenase/reductase, PaaK subunit; TIGRFAM:
FT                   phenylacetate-CoA oxygenase/reductase, PaaK subunit; PFAM:
FT                   Oxidoreductase FAD-binding domain protein; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43952"
FT                   /db_xref="GOA:D9T6K6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K6"
FT                   /inference="protein motif:TFAM:TIGR02160"
FT                   /protein_id="ADL43952.1"
FT                   /translation="MTVTITRPVRRRPVFHPLPVAAVDRLTDDSVSITFAVPEELRETF
FT                   AFSAGQHLTVRRPADGDGEEVRRSYSICSTPDELARHGRLRVGVREVPGGAFSAYACGA
FT                   LRGGDTVEVLPPLGHFTSAFTPDRARRYGAVVAGSGITPVLGLAATALATEPRSTFTLV
FT                   YGNRTANSVMFAEELADLKDRYPTRLHLVHVLSREMGESALLSGRIDADRLTRLLDTVV
FT                   PGDEIEEWFLCGPYGMVVDAKAVLAGRGVPDAAVHTELFHVDAPPEPVRRETDRPGTGT
FT                   EVTILLDGRSSSFTMGRDERVLDAALRVRGELPYACKGGVCSTCRAKVTSGEVTMARNY
FT                   ALEPDEVAAGYVLTCQSSPVTDELTVDYDA"
FT   gene            complement(386438..387079)
FT                   /locus_tag="Micau_0386"
FT   CDS_pept        complement(386438..387079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cag:Cagg_2107 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43953"
FT                   /db_xref="GOA:D9T6K7"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K7"
FT                   /inference="similar to AA sequence:KEGG:Cagg_2107"
FT                   /protein_id="ADL43953.1"
FT                   /translation="MSPPPTPVRVAGARSALWSLTMTAVLVGFGLAVIVVSAVVAHLTV
FT                   GLPIAVPISVALVGCLAFAVGLRLLHRGWWLTLLSVLPALFVLVGTVQLAPESVLRERG
FT                   VAQQVTITDVQTVGKRHEFVLQGGTGRLDEPLVYRGSSPGYRVGQRLTVLVDPRGEVEL
FT                   ADARDVDPAGKRGMLVLGAAGWTLLALVGGWRGHVSRARGRAATAPPVVF"
FT   gene            387193..387471
FT                   /locus_tag="Micau_0387"
FT   CDS_pept        387193..387471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0387"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   mbt:JTY_1986 hypothetical protein, antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43954"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K8"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADL43954.1"
FT                   /translation="MEQIAVRELNQHTSRVLARVRAGETVEVTDRGEPIARLVPVLAGD
FT                   ALLGRLVAEGRATAPTTTGPVPMPPVLGDPTVDAAAALVEARDEERW"
FT   gene            387468..387878
FT                   /locus_tag="Micau_0388"
FT   CDS_pept        387468..387878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_1046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43955"
FT                   /db_xref="GOA:D9T6K9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6K9"
FT                   /inference="similar to AA sequence:KEGG:Kfla_1046"
FT                   /protein_id="ADL43955.1"
FT                   /translation="MIYLDSAAVIKMLRREAETADLLGWLNERAGTALVSSALAEVEVP
FT                   RALRRAAPQALVGVPSVLGRLYRVEIDATVRATAGAYPEPMLRSLDAVHLATAEILARQ
FT                   AAAEFVAFVTYDKRLLEAAKAIGLPVASPGMP"
FT   gene            387952..389142
FT                   /locus_tag="Micau_0389"
FT   CDS_pept        387952..389142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0389"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   saq:Sare_4467 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43956"
FT                   /db_xref="GOA:D9T6L0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL43956.1"
FT                   /translation="MTANREIDDILQRGADGGRITPEEALLLYTDAPFHALGEAADAVR
FT                   RRRYPDNIVTYLIDRNINYTNVCVTACKFCAFYRAPKHKEGWTHPTEEILRRCGEAVEL
FT                   GATQVMLQGGHHPDYGVEYYEELFSSVKKAYPQLAIHSIGPSEILHMAKVSGVSLDEAI
FT                   ARIKTAGLDSIAGAGAEMLPDRPRKAIAPLKESGARWLEVMELAHRQGLESTATMMMGT
FT                   GETNAERIEHLRMIRDVQDRTGGFRAFIPWTYQPENNHLKGRTQATTLEYLRLVAVARL
FT                   FFETVPHLQASWLTTGKDVGQLALHMGVDDLGSIMLEENVISSAGARHRSNLHELIGMI
FT                   RSADRIPAQRDTLYNRLAVHHTPADDPSDDRVVSHFSSIALPGGGAGKSLPLVEVN"
FT   gene            complement(389246..389449)
FT                   /locus_tag="Micau_0390"
FT   CDS_pept        complement(389246..389449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppl:POSPLDRAFT_116123 candidate polysaccharide
FT                   deacetylase from carbohydrate esterase family CE10"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43957"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L1"
FT                   /inference="similar to AA sequence:KEGG:POSPLDRAFT_116123"
FT                   /protein_id="ADL43957.1"
FT                   /translation="MVTHPAPAAVRYVNGPHGPMEDDGPTDAASVMASSAHRAVLTRVA
FT                   ADLLPACSRPGSVVSRGQASRR"
FT   gene            389576..390835
FT                   /locus_tag="Micau_0391"
FT   CDS_pept        389576..390835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0391"
FT                   /product="cell wall anchor domain-containing protein"
FT                   /note="KEGG: saq:Sare_4466 cell wall anchor
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43958"
FT                   /db_xref="GOA:D9T6L2"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L2"
FT                   /inference="similar to AA sequence:KEGG:Sare_4466"
FT                   /protein_id="ADL43958.1"
FT                   /translation="MTFRYRSTLARAGVVALLSTAGLGAAAGPAQAADKADLQLIPLSY
FT                   QLAKGVSEAKAKPFKFQVNNTLGTVDAKDVRVTVETKGLKTAKVGVLVPAGCDIRGTTF
FT                   SCLLGDLPAGTTEDFGLPLFSTGGKGAAGTLTVSISAANGAGVLDTIDHDITVTEPGYD
FT                   LTTWVQDVYADVRVDGDDADESGLRPVRPGGTAPLDWAVFNDGSKRATGIKYGIALPAG
FT                   VTFAKLPDGCVEQNLGGFLNAYCEDLGAVLKPGQYYTADVRVTVGADVTEKLLRPGILW
FT                   AEGLDAASGAPEEEPRVASSAQRRAFAETDDGDNSAVFDVFVDQSPQSTPSPTPTTQPT
FT                   STPTAQPTPTGDATAVPTPTAGGGAGGGSGDGGLPVTGMQVGLIGGVGAAVLAAGAALM
FT                   MLSRRRKVVLVAPGEERTGD"
FT   sig_peptide     389576..389674
FT                   /locus_tag="Micau_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            390935..391645
FT                   /locus_tag="Micau_0392"
FT   CDS_pept        390935..391645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0392"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: saq:Sare_4465 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43959"
FT                   /db_xref="GOA:D9T6L3"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L3"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADL43959.1"
FT                   /translation="MSRTPQGQRASLDKQPHEVAAMFDGVAARYDLTNTVLSFGQDRSW
FT                   RRATRAALGLRPGERVLDVGAGTGVSTEELAHSGAYAVGADLSLGMLHAGKRTRPSVPL
FT                   LAGDALRLPFADASFDAVTISFALRNVNDTDAALAELARVTRPGGRLVVCEFSTPVNPA
FT                   FRTVYLSYLMRSLPAVARAVSSNPDAYVYLAESIRAWPDQAALAARIGAAGWGRVAWRN
FT                   LTGGVVALHRAVRN"
FT   gene            391720..391938
FT                   /locus_tag="Micau_0393"
FT   CDS_pept        391720..391938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0393"
FT                   /product="mycobacteriophage protein"
FT                   /note="KEGG: fal:FRAAL2683 mycobacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43960"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L4"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2683"
FT                   /protein_id="ADL43960.1"
FT                   /translation="MTGSDQAATDDDAAELIAQLRELAGADPADVRQVVAEVLAALDRA
FT                   AGGALRDHLPEAIRLDAGLGPAAQARP"
FT   gene            392073..393347
FT                   /locus_tag="Micau_0394"
FT   CDS_pept        392073..393347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0394"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: saq:Sare_4464 geranylgeranyl reductase;
FT                   TIGRFAM: geranylgeranyl reductase; PFAM: monooxygenase
FT                   FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43961"
FT                   /db_xref="GOA:D9T6L5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L5"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADL43961.1"
FT                   /translation="MTAVENDADVIVVGAGPGGSATAYHLARHGVRVLLLEKTEFPREK
FT                   VCGDGLTPRAVRQLIRMGVDTSPEAGWLHNKGLRVIGGGIRLELDWPDLASFPNYGLVR
FT                   TRLDFDDLLAQRAVAAGAKLQTSVNVLGPVLGADDRVIGVQAEVGPDKEPATFHAPLVV
FT                   AADGVSGRFPLALGLAKREDRPIGVAVRRYYRSPAKHDDDYLESWLELRAKGSDALLPG
FT                   YGWIFGLGDGRVNVGLGVLNSSSAFGKTNYRKLLTDWLANTPEDWGMTDESNAEGPILG
FT                   AALPMGFNRVPHYTRGVLLVGDSGGMVNPFNGEGIAYAMESGEMAAEVVVQALARPTGA
FT                   ERERALMAYPQELKARFGGYYRLGGVFVKLIGRPEIMRMATKHGMPHPMLMRFVLKLLA
FT                   NLTDPRGGDAMDRVINAMTKVAPAV"
FT   gene            393483..393848
FT                   /locus_tag="Micau_0395"
FT   CDS_pept        393483..393848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0395"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: saq:Sare_4463 NADH dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43962"
FT                   /db_xref="GOA:D9T6L6"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L6"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ADL43962.1"
FT                   /translation="MTLSPYAPIIGLFALAAAFALFSVAAARLAGPRRLNKAKLEAYEC
FT                   GIEPSPQPVGGGRFPIKFYLTAMLFIVFDIEIIFLYPWAVSFDALPIFGFVEMVLFIVA
FT                   VFVAYAYVWRRGGLDWD"
FT   sig_peptide     393483..393560
FT                   /locus_tag="Micau_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.739 at
FT                   residue 26"
FT   gene            393860..394540
FT                   /locus_tag="Micau_0396"
FT   CDS_pept        393860..394540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0396"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   KEGG: saq:Sare_4462 NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43963"
FT                   /db_xref="GOA:D9T6L7"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L7"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ADL43963.1"
FT                   /translation="MGIEEKLPSGVLLTSVEKLVNWTRKTSVWGATFGLACCAIEMMAA
FT                   GGPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVISMGVCA
FT                   SSGGMFNNYAIVQGVDHVVPVDMYLPGCPPRPEMLIDAVLKLREKIMHEPLGPNGRKML
FT                   EARQARGDVPVVPYGSMPSSYRSDKARRAEWTKAVREGREEQLRIENWMKAQNHLQASH
FT                   RGPK"
FT   gene            394537..395268
FT                   /locus_tag="Micau_0397"
FT   CDS_pept        394537..395268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0397"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="KEGG: saq:Sare_4461 NADH dehydrogenase subunit C;
FT                   TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C; PFAM:
FT                   NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43964"
FT                   /db_xref="GOA:D9T6L8"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L8"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ADL43964.1"
FT                   /translation="MSNDKNNDGGVPVPTTPVGASSTAPAEYPPASPAGRGMFGNQGTG
FT                   DVSGYGGLVRPRKPIEEAARPYGSYFDEVRDALEEAYPDFGDAIEKVVVDRGELTLHVR
FT                   PERIAEVCQVMRDDLALRFELCSSVSGVDYLGAQERRLHVVYHLTSMTYRRSVRLEVAV
FT                   SVEEPHVPSVTAVYPTADWQERETYDMFGVVFDGHPALTRILMPDDWEGHPQRKDYPLG
FT                   GVPVEYKGAEIPPPDRRRSYQ"
FT   gene            395265..396590
FT                   /locus_tag="Micau_0398"
FT   CDS_pept        395265..396590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0398"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="SMART: PAC repeat-containing protein; TIGRFAM: NADH
FT                   dehydrogenase I, D subunit; KEGG: saq:Sare_4460 NADH
FT                   dehydrogenase subunit D; PFAM: NADH-ubiquinone
FT                   oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43965"
FT                   /db_xref="GOA:D9T6L9"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6L9"
FT                   /inference="protein motif:TFAM:TIGR01962"
FT                   /protein_id="ADL43965.1"
FT                   /translation="MTTSNYATERETTEGKVFTVTGGDWDEVVSGTDPINDERIVVNMG
FT                   PQHPSTHGVLRLVLELEGETVREARSVIGYLHTGIEKNLEYRNWVQGSTFVTRMDYLSP
FT                   LFNETAYALAVEKLLGITDDITERATTIRVLMMELNRVSSHLVWLATTAMELGAINMML
FT                   YGFREREYVLDIFETITGLRMNHAYVRPGGVAQDVPDDAIRKIRDFLQLMPKRLKEYEN
FT                   LLSGQPIWLERTQHVAVLDVTACMALGVTGPVLRSAGLAWDLRKTMPYCGYETYEFDVP
FT                   THTDGDVWGRYLVRVAEIRESLKLIEQALDRLKPGPVMVSDKKIAWPAQLAIGVDGMGN
FT                   SLEHVAKIMGQSMESLIHHFKLVTEGFRVPPGQVYVGIESPRGELGVHAVSDGGTRPYR
FT                   VHYREPSFVNLQALPAMAEGGLIADVIAGGASLDPVMGGCDR"
FT   gene            396587..397681
FT                   /locus_tag="Micau_0399"
FT   CDS_pept        396587..397681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0399"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="KEGG: saq:Sare_4459 NADH dehydrogenase subunit E;
FT                   TIGRFAM: NADH-quinone oxidoreductase, E subunit; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43966"
FT                   /db_xref="GOA:D9T6M0"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M0"
FT                   /inference="protein motif:TFAM:TIGR01958"
FT                   /protein_id="ADL43966.1"
FT                   /translation="MSFSETTRTRAREIIARYPADRSRSALLPLLHLVQSEEGYVSPAG
FT                   VEFCAEVLGLNKAQVGAVATFYTMYKRKPTGDYLVSVCTNTMCDVLGGQKVYDTLAEHL
FT                   GVGHEETTADGKITLEHAECLAACDYGPVMTVNYDFFDNVEPQAALDVVEELRAGGRPM
FT                   PTRGARLCTLKEMAVQLAGFADERDGAVADGGPGEPSLRGLRLAEQHGVSVPGFDPKTP
FT                   IRSKAEADRAAAEAKAKAEAAKPAPAPEPAEPEAATGSTAPDVKAPDDKSPQVRTAETR
FT                   QPDASTPVPDAPGTKVPVDGPAPAPRDARAAEAAGVAANPPAGDGKPAGDAAGAQERNL
FT                   KEAESGTGADGADPADASGTGVRK"
FT   gene            397678..398994
FT                   /locus_tag="Micau_0400"
FT   CDS_pept        397678..398994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0400"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, F subunit;
FT                   KEGG: saq:Sare_4458 NADH-quinone oxidoreductase, F subunit;
FT                   PFAM: Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43967"
FT                   /db_xref="GOA:D9T6M1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M1"
FT                   /inference="protein motif:TFAM:TIGR01959"
FT                   /protein_id="ADL43967.1"
FT                   /translation="MTTPRPETLAKLTPVLTKRWLSPDAWRLGTYEKLDGYAALRKALK
FT                   AHPDDLIQLIKDSGLRGRGGAGFPTGLKWGFIPQGDGKPHYLVVNADEGEPGTCKDLPL
FT                   MTHDPHSLVEGVIIASYAIRANRAYIYIRGEAVHAARRLRSAVDEAYAKGYLGRNVLGS
FT                   GFDLDLVVHSGAGAYICGEETALLDSLEGFRGQPRLRPPFPATHGLYASPTVVNNVGTI
FT                   ASVPYIVLGGADWWKTMGTEKSSGPMIYSLSGRIAEPGQYECSMGITLRELIELAGGMK
FT                   PGHNLKFWTPGGSSTPLLTAEHLDVPLDFEGVAAAGSILGTTATQIFSDQDCPVYATYR
FT                   WLEFYHHESCGKCTPCREGNYWMVRVYRRILAGQGTHEDLDTLLDTCDNILGRSFCGLG
FT                   DGATSSVTSSLKYFKQDYLDYIEGRTAPKLSDKSLVGAH"
FT   gene            398994..401435
FT                   /locus_tag="Micau_0401"
FT   CDS_pept        398994..401435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0401"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="KEGG: saq:Sare_4457 NADH dehydrogenase subunit G;
FT                   TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur
FT                   binding; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43968"
FT                   /db_xref="GOA:D9T6M2"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M2"
FT                   /inference="protein motif:TFAM:TIGR01973"
FT                   /protein_id="ADL43968.1"
FT                   /translation="MTDVAKQTETVTLTIDGVEVTAPKGALLIRVAEQLGTEIPRFCDH
FT                   PLLAPAGACRQCLVEVEGQRKPVASCTQTVADGMVVRTQLTSPVAKKAQEGVMELLLLN
FT                   HPLDCPMCDKGGECPLQNQAMSTGRTDSRFHEHKREYPKPLPISTQVLLDRERCVLCQR
FT                   CTRFSEEIAGDKFIDLMGRSSHEEINIYRDDAYGEEGDEGDVPFNSYFSGNTVQICPVG
FT                   ALTGTQYRFRARPFDLVSTPSVCEHCSAGCAQRTDWRRGKVLRRLAGDDPAVNEEWNCD
FT                   KGRWGFQYTRAFDRISTPMVRDEKTGELREASWSEALTRAAEGLRAARDGATGTAVLTG
FT                   GRLTVEDAYAYAKFARIALHTNDIDFRARPVSREEADFLASSVAGVTDVTYTDVENAPA
FT                   VVLVGLEPEEECPILFLRLRKAYLKKKLTVYALAPFATRGLEKLGAKLARVVPGEEAGV
FT                   LAEHATVAEALGQPGAILIVGERLAEVPGGLSAAADVARRTGARLVWVPRRAGDRGAVD
FT                   AGCLPNLLPGGRVVTEPAARAELGEAWDIPAGVIPSQAGRDTDGILTAAANGQIGALVV
FT                   AGVDPADLADPRLAESALDAVPFLVSLELRMSAVSRRADVVLPVAPVVEKAGSFLDWEG
FT                   RLRTFEKVLDTGAMTDARILDALAAQLDVRLGTGDVPSIRRELGALPRTRVERPSAPSV
FT                   EPAAVRQPGPGEAVLATWHQLIDLGSLTDGDEHLAGTARPPVVRLGKGTAEALGVADGD
FT                   PVTVGTDRGAITLPAAITEMPDGVVWLPTNSPGSTVRRGLGATSGDVVSVSAVGNERWV
FT                   Q"
FT   gene            401432..402787
FT                   /locus_tag="Micau_0402"
FT   CDS_pept        401432..402787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0402"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: saq:Sare_4456 NADH dehydrogenase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43969"
FT                   /db_xref="GOA:D9T6M3"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M3"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ADL43969.1"
FT                   /translation="MNPVILAAQDPTLADFGKDPWWLVLGKILFAFVVAVAATLLGVWF
FT                   ERRVVGRMAVRPGPNQAGPFGLLQTLADGVKLAFKEDILPRKADKVVYFFAPVISVVCA
FT                   VTALSVIPFGPMVSIFGHRTPLQVTDVSVAVLVVLAFSSLAVYGIVLGGWASGSTYPLL
FT                   GGLRSAAQLVSYEVTMGLSVVAVFMTAGTMSTSGIVAAQGDGTRLSIGGFDLAAPGWYA
FT                   ILLLPSFIMFFIAIVGETNRAPFDLPEAESELVAGFQTEYSSLKFALFMLSEYVAMVTM
FT                   SAFTVTLFLGGWHAPWPITIWSGANEGWWPMLWFFGKVIMLVFVFVWLRGTLPRLRYDQ
FT                   FMRFGWKVLLPLNLVWIMVLAGLRSIEDWQTRDRLLVTAVGAGVLLLATLFWPSRKKEP
FT                   KPSLQEQADTRPYGSFPLPPMDLQVPPSPRTKRVLAEREPANVVAGPDSREV"
FT   gene            402789..403436
FT                   /locus_tag="Micau_0403"
FT   CDS_pept        402789..403436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0403"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; KEGG:
FT                   saq:Sare_4455 NADH dehydrogenase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43970"
FT                   /db_xref="GOA:D9T6M4"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M4"
FT                   /inference="protein motif:TFAM:TIGR01971"
FT                   /protein_id="ADL43970.1"
FT                   /translation="MGAITGTFKGFGVTFSHMFKKVVTTDYPFKPPVSAPRYHGRHILN
FT                   RHPDGLEKCIGCELCAWACPADAIYVEGGDNTEEQRFSPGERYASTYQINYARCIFCGL
FT                   CIEACPTRSLTMSNEYELARDNRQDLIFTKEQLLAPLLEGMEQPPHPMRLGDSEKDYYV
FT                   GALTNPGTSAGAERSPMGPGRYQVEEHPGVTFPGAEQAEQRSAAAAGKGGKA"
FT   gene            403433..404203
FT                   /locus_tag="Micau_0404"
FT   CDS_pept        403433..404203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0404"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: saq:Sare_4454 NADH dehydrogenase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43971"
FT                   /db_xref="GOA:D9T6M5"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M5"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADL43971.1"
FT                   /translation="MTSATVLAAAGQVSGGEEVTFWILAPLALLGAIGMVWARNAVHSA
FT                   LWLVLTMLCLGVFYVLQAGPFIGMVQIIVYTGAIMMLFLFVLMLVGRDASDSLIETLRG
FT                   QRVAAVVLGLGFAGLVGTGLYRALDGVQPVGLDEANGEGNVQGIARLLFTKYVFAFELT
FT                   SALLITAAVGAMVLAHVERRKADRMDQIATMKARFRPGNYPGPKPGPGVYATSSSVATP
FT                   ARLPDGRLTDRSIPEIMPVRELTAEETAPKGTDR"
FT   gene            404259..404558
FT                   /locus_tag="Micau_0405"
FT   CDS_pept        404259..404558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0405"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   stp:Strop_4055 NADH dehydrogenase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43972"
FT                   /db_xref="GOA:D9T6M6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M6"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADL43972.1"
FT                   /translation="MTPDYYLILAAVLFTIGAVGVLVRRNAIVLFMCIELMLNAANLTL
FT                   VTFSRINGDLNGQIMAFFVMVVAAAEVVVGLAIIMAIFRTRRSASVDDANLLKY"
FT   gene            404566..406527
FT                   /locus_tag="Micau_0406"
FT   CDS_pept        404566..406527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0406"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="KEGG: stp:Strop_4054 NADH dehydrogenase subunit L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43973"
FT                   /db_xref="GOA:D9T6M7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M7"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADL43973.1"
FT                   /translation="MVEQILTIAQSEPAEAVTFATADGMLGSVWLLVAIPLVSAAILLL
FT                   LGKRADRWGHWLGVGAIGAAFVLGLTYFFQLRGLENKQVELSLWDFMAVGNLKVDFGLL
FT                   FDPLAAVFVLLITGVGFLIHLYAVEYMAHDAGRRLFFAYFNLFVAAMLLLVLGNNYVML
FT                   YFGWEGVGLASYLLISFWYGRPSAATAGKKAFLMNRVGDAGLAIGIFIMFAVLGTTQYD
FT                   EVFNGVGSMTSTTVLVLGLLLLLGAAGKSGQFPLQAWLPDAMEGPTPVSALIHAATMVT
FT                   AGVYLIARSNAIFSANETLQLVVVSVGALTLLMGCIIGAAKDDIKRVLAWSTVSQIGYM
FT                   FLGVGLGGGAYALAIVHLLAHGFFKANMFLGAGSVMHGMNDQVDIRRFGGLSKYMKVTW
FT                   LTFMMGWLAIIGMFPFSGYFSKEPIIVAAFEREGWTAWLFGMAALLGAGLTAFYMTRLF
FT                   VLTFHGPKRWTEDIEHPHESPKLMTVPLILLAVGSVGAGFLLATSVPDWLTATNGLAAE
FT                   SGEHAPVLAHWLLTALSLLLTVLGAGLAWFLFRSGTATEPQPAGVVVTAARRNLYTDAF
FT                   NEAVFEKPGIFLTRALVFLDNRGVDGLVNGLAAAVGGGSGRLRRLQTGFVRSYATSILT
FT                   GALLVVAAFLAVQAGWLA"
FT   gene            406592..408124
FT                   /locus_tag="Micau_0407"
FT   CDS_pept        406592..408124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0407"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="KEGG: stp:Strop_4053 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43974"
FT                   /db_xref="GOA:D9T6M8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M8"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADL43974.1"
FT                   /translation="MSNFPFLSVLTVAPLVGALVVALLPRSRPDLAKLVAFGWSLLVLV
FT                   LSVVMWFAFSADGDRFQFRESYPWIPNWGVNFTFEVDGIALVMLMLIAILVPLVILASW
FT                   HDAEASKRSVPAYFALLLVLECTMIGVFAAADVFLFYVFFEVMLVPMYFLIGSYGGHQR
FT                   QYAAVKFFLYSLVGGLFMLAAVIGLWVVGGKTFDWQALSQAEFATDTARWLFLGFFVAF
FT                   AIKAPFFPFHTWLPDAGGAAPAGAAALLVGVLDKVGTFGILRYCLPLFPEASRWFAPWA
FT                   LALGVIGIIYAALLAVGQNDLKRLVSYTSIAHFGFIGVGIFAFTTQAGTGAVLYMLNHG
FT                   LATGLLFLVVGMLIARRGSALISDFGGAGKLVPVLAGVLFFAGLASLALPGTAPFVSEF
FT                   LVLIGTFTVNKPVAVIATLGIILAAAYVLWMVQRTTQGTLNPALTEVEGMRRDLTLREK
FT                   VVVAPLIALIVLLGFYPKPVTDVINPAVQATMQDVGKSDPAPEVGSVQEAAK"
FT   gene            408121..409674
FT                   /locus_tag="Micau_0408"
FT   CDS_pept        408121..409674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0408"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="KEGG: stp:Strop_4052 NADH dehydrogenase subunit N;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43975"
FT                   /db_xref="GOA:D9T6M9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6M9"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ADL43975.1"
FT                   /translation="MSELRLPSIDYAALAPILIMLGAALLGVLVEAFVPRRLRNAVQLG
FT                   LALVAMLAAIVMVILNADDRLITIGGAIAIDGPTLFLQGAILVLAVMALLLVGERTVER
FT                   GGAFVAHAAVTAESAEDRRQAEGVGGATEVYPLMSFAIGGMLIFVAANDLLTMFVALEV
FT                   FSLPLYLLCALARRRRLLSQEAALKYFMLGAYASAFFLFGVALIYGFTSGIPGRTAGVD
FT                   FATVHAAVTDSPSSPVLLFAGMALLAIGLLFKAAAAPFHVWTPDVYQGAPTPVTGFMAA
FT                   CTKVAAFGALLRVFHVAFAGASWDFTPVLGAIAVLTMLVGAVLAVTQTDIKRLLAYSSI
FT                   ANAGYLLVGVLAPSREGLSGTMFYLAAYGFSVLAAFAVVTLVRDADGEATHLSRWAGLG
FT                   RRSPFFAAIFTFILLAFAGIPLTSGFTSKFAVFGPALEANQAWLVIAGVLTSMVLAFPY
FT                   LRVVVMMWLSEPGESTPTVTVPGALTSAALVIGVLATLVLGVVPGPLLDLTTGAAEFVR
FT                   "
FT   gene            409764..410804
FT                   /locus_tag="Micau_0409"
FT   CDS_pept        409764..410804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0409"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: stp:Strop_4051
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43976"
FT                   /db_xref="GOA:D9T6N0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N0"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADL43976.1"
FT                   /translation="MVEDVANPAGERSGQFGALGLHLADPRVEASVLGVLDRVETNLRA
FT                   SVASADPLVTEASRHLVEAGGKRFRPLLVALGAQFGDPDTDQVVPAAVVMELTHLATLY
FT                   HDDVMDEAAVRRGAPSANSRWTNSVAILVGDYLFARAADIAADLGPEAVRLQARTFARL
FT                   VHGQIAETVGPRDTDPVAHYLHVIAEKTGSLIATSARFGGMFGGAAPEHVEALAEYGEI
FT                   IGVAFQLSDDLLDIASESVQSGKTPGTDLREGVPTLPVLYAMASDDADAASVRLREILA
FT                   TGPLVDDALHAEALGLLRESPALKRARETVRSYAEDARARLAPLPEGPARRALESLCDY
FT                   IADRTS"
FT   gene            complement(410930..412138)
FT                   /locus_tag="Micau_0410"
FT   CDS_pept        complement(410930..412138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0410"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sna:Snas_5945 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43977"
FT                   /db_xref="GOA:D9T6N1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL43977.1"
FT                   /translation="MTETVSRVAPPASRHAVTVGAGATLTTIVCVLPVFLVGGLAVQLA
FT                   DELRFSPAGLGLAVSIYFGVSALASVPSGALVERFGSAPVARAAILLSAASLLAVAGLA
FT                   RSYPILVALLALSAAANALGQLASNAALAEHVPAHRQGLSFGVKQAAVPAATLLAGLAV
FT                   PTVALTAGWRWAFVAAAVAALAVLPAVPRAGRDRRARTASGRGPGGTGPLVVIGLAATL
FT                   AAAAANALGTFLVDSAAARGLSPGLAGLTLTLGSVVCVLARVGVGWLADRRTSGHVGLI
FT                   AGMLLTGSVGLILLAVAGSAPLVAGVVLGFGLGWAWPGLMNFAVVRLHPQAPAAATSIT
FT                   QTGVYAGGCLGPLGLGALAGAAGYPAMWLTAAAAMLLAALLMLLGARLLRPTPTPTPTP
FT                   ALP"
FT   gene            412292..413074
FT                   /locus_tag="Micau_0411"
FT   CDS_pept        412292..413074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0411"
FT                   /product="regulatory protein IclR"
FT                   /note="KEGG: saq:Sare_4448 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43978"
FT                   /db_xref="GOA:D9T6N2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N2"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADL43978.1"
FT                   /translation="MRDPLAEPSDLIRSVSRALRVLESVGRAPRGLTVKQIARRCELTV
FT                   ATTYHLVRTLAYEGYVIRREDGTYIVGLEVADRYRELVTAFRGPPAVGEALRRAASDTG
FT                   WSHYLGRFVGGQVAVTASAEGPRSPYMEDLVPGFDEGAHATALGKSLLATLTTEQRFRY
FT                   LREYGMRPFTTATLTTVEAFEADLAAGDRRGMQLELGQFRQGVACAAVLVSPDKDIERR
FT                   VVLACALPAGEMMTSARVVRAKLLTAARAIADGIASEN"
FT   gene            complement(413192..415318)
FT                   /locus_tag="Micau_0412"
FT   CDS_pept        complement(413192..415318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0412"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839;
FT                   Twin-arginine translocation pathway, signal sequence,
FT                   subgroup; KEGG: stp:Strop_4049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43979"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N3"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ADL43979.1"
FT                   /translation="MSDRPRLLPLLGGTRHGSRDAMTCLYRCGNACDHPVPNPTDNPYF
FT                   GDVVDTEISRRGVVRAGAVGALVLGFGGAAAGALAGAAPAAAAPAAPPVPGGGEVSPAG
FT                   AGRPGSGALTFKPIPPNKLDTLVVPNGYDHSVVIRWGDEVVPGAPAFSLGRQTAAAQSK
FT                   QFGYNNDFVGVLPIDRRRALLVVNHEYTNEDLMFPGFSSQDALTVEQVRVAMAAHGMSV
FT                   VELERVENTGQWQPVRRGRREYNRRVTALATKFELTGPAAGSSWLRTAADPKGRTVIGT
FT                   LNNCAGGVTPWGTVLSGEENFNQYFVGGDGAPEEQKPKLARYGIPTDVRHPSGSRKWER
FT                   ADERFDLAKHPNEANRFGWIVEIDPFDPQAKPRKHTALGRFKHEGANVIVARNGRVVAY
FT                   MGDDERFDYLYKFVSDKKFMPGKSSVARRHNLTLLESGTLYVAKIEGDSPAAEIDGSGK
FT                   LPADGGFGGRGRWIKLVSGNRSYVDGMTAADVLTFTRLAGDKVGATKMDRPEDVEPSLL
FT                   TGKVYVALTNNSDRGKAGKAPADEANPRNSNKHGQILELVEDRGDNTAETFAWSLPIVC
FT                   GDPADASTYFAGYDKTKVSPISCPDNVAFDATGNLWISTDGNALGSNDGLFATAVEGPE
FT                   RGHLKQFLTVPLGAETCGPFITGDNRSVFVAVQHPGEVSGASVENPASTWPDGDFAKPG
FT                   VVVTWRLDGGPVGS"
FT   gene            415489..416058
FT                   /locus_tag="Micau_0413"
FT   CDS_pept        415489..416058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0413"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="KEGG: saq:Sare_4446 LuxR family transcriptional
FT                   regulator; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43980"
FT                   /db_xref="GOA:D9T6N4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADL43980.1"
FT                   /translation="MEGRTHRRFPRRRKRGTAISDHDAQLLRALHDEHADALYAHALRL
FT                   VNGDRPRAEDLVQETLLRAWRHPESLDPRRGSVRAWLFTTARNLAIDAWRRRSARVGEV
FT                   YTDELPETAETVDETERAVEAWTVAEALNRLSPTHREVLVECFYQGRSVAEAAARLGVP
FT                   PGTVKSRTHYALRSLRLALAEMGVTG"
FT   gene            416055..416744
FT                   /locus_tag="Micau_0414"
FT   CDS_pept        416055..416744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0414"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: saq:Sare_4445 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43981"
FT                   /db_xref="GOA:D9T6N5"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N5"
FT                   /inference="similar to AA sequence:KEGG:Sare_4445"
FT                   /protein_id="ADL43981.1"
FT                   /translation="MTRCEFAHDDGAYVLGALAPADRVAYERHLAGCAQCREAVAEIAV
FT                   LPGLLGRLDPAGLEQFLEVGPETSRVPALLDAARERKRRERSRSRRRYALTALAAAALA
FT                   VLAGVGVGLVQSPAEPTKPPVALASMRPVAGTVPVHAEVGLTETPWGTEVTMHCGYDRR
FT                   AGHREAYTFRLVAHGPDGATEQIGSWLAAPGDDLRFSGVTRFTKGELVRLELLRGTNAP
FT                   VLAYDLR"
FT   gene            complement(416836..417762)
FT                   /locus_tag="Micau_0415"
FT   CDS_pept        complement(416836..417762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0415"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: saq:Sare_0466 transporter DMT superfamily
FT                   protein; TIGRFAM: RarD protein, DMT superfamily
FT                   transporter; PFAM: protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43982"
FT                   /db_xref="GOA:D9T6N6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N6"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADL43982.1"
FT                   /translation="MNQLRLGYLYGVGAYLIWGFFPIYLKLLRPAGPVEILAHRILWSV
FT                   AFVALLLAATRHAGFLRKLARRPRALAGIGLAAALIAVNWGTYIYGVNSDRVVETALGY
FT                   FINPLVSVLFGVLVLRERLRRAQWAALGVGALAVAVLTVDYGRLPWLALTLAFSFAGYG
FT                   LVKKQLALPATEGLFVESAVLALPALAYLGWLSARGDSTFGHVSAGHTALLVLAGAATA
FT                   IPLLLFAGAANRLPLSTVGMLQYLAPILQLGCGVLIFHEPMPPARLAGFALVWLALVVF
FT                   TADALRHSHRTRQAARTPTTPTPTPSR"
FT   gene            complement(417759..418247)
FT                   /locus_tag="Micau_0416"
FT   CDS_pept        complement(417759..418247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0416"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   saq:Sare_0465 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43983"
FT                   /db_xref="GOA:D9T6N7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL43983.1"
FT                   /translation="MFTLTRADGYEISTDPDRIDLDRVHVWLSTDAYWALGRERETVAR
FT                   AFTGSIGFGVYRPGDGRQVAVARVVTDGATFAWLCDVYVDPAERGSGLGTWLAGAVRDH
FT                   LNELGVRRILLATLDAHGVYAKIGFKPVAADRWMELDQRVTPVTDKDQDKDPPLTVER"
FT   gene            complement(418352..418738)
FT                   /locus_tag="Micau_0417"
FT   CDS_pept        complement(418352..418738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0417"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   saq:Sare_4444 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43984"
FT                   /db_xref="GOA:D9T6N8"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N8"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADL43984.1"
FT                   /translation="MDFLKGLLIRVGSTAVAFWLATLLIPGISLDSDSATETVITLVLV
FT                   AVIFGVVNAVLQPIIKTVGCGFYLLTLGLIALVVNGLLFLLTSWIAGEAGLPFHVDGFW
FT                   PEAVLGALFVGIVTWILGAVLDRD"
FT   gene            complement(418806..420608)
FT                   /locus_tag="Micau_0418"
FT   CDS_pept        complement(418806..420608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43985"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6N9"
FT                   /inference="similar to AA sequence:KEGG:Sare_4443"
FT                   /protein_id="ADL43985.1"
FT                   /translation="MTASTSERPASVPVRTPQWTNRPTARLRAGQIVATQVAAAVLVAA
FT                   AGRGVVPTAVALLSAALLLPAAWVRVRGRWLHEWLVTAAAYVTRRRALPPAADPAALLG
FT                   LLRPGSVVGATEASGGAAVLHDAAGLTALLELGDPDDLLGDHAHELPTPFDLLPPAGPD
FT                   APAIRLQLVFSSSPAPVPAVAGGPAGTSYRQLTDGRVAARARVVLAVQVLRADGWPDED
FT                   LLRALSGTLRRLVRRLGPLTARPLGGDAALRVIAELAHHEPGAPVRETWPLLTVGGLTQ
FT                   ATWRLRRWPDPRGEAARGLVGRLLALPATATTVALTAGPRTGTAPVPAELAVRVAAGSA
FT                   AGLSTAERTLRRIAGDVGGELRRLDGEHLAGLVATLPLAVTGGAASPAGSPPPALDLPS
FT                   AAAGLMVGANRHGAALTVRLFRPATTRVLLVGGVPAAQLLVLRALALGARVVVQTGRPR
FT                   FWEPFVRGVGTVGGGVPLLPPGRPAGGAPGSPLHPLLVVVDAGPVPPEAGPAAAWQSVL
FT                   VVRDELTSADTPALARADLAILQPLDPDEAALAGAALGLGGSAEWLTRIRDDMVAVVNR
FT                   RALRWALLSPTPVESQLVGRPARH"
FT   gene            420842..421171
FT                   /locus_tag="Micau_0419"
FT   CDS_pept        420842..421171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43986"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P0"
FT                   /inference="similar to AA sequence:KEGG:Sare_4442"
FT                   /protein_id="ADL43986.1"
FT                   /translation="MTSGMSQTQAEAAVMQQTAAKFEQVDQSLQTMLSGLMAELEVLQQ
FT                   AWRGAGGRSFAQVKQQWAQDQAALQRALRETATAIRSAGRHYDVSDTEAAGRVAGTNRG
FT                   IQLPL"
FT   gene            421192..421485
FT                   /locus_tag="Micau_0420"
FT   CDS_pept        421192..421485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43987"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P1"
FT                   /inference="similar to AA sequence:KEGG:Sare_4441"
FT                   /protein_id="ADL43987.1"
FT                   /translation="MEHGVLVVNFAALQQAGADIQRALSTLESQLGQLERDAAPLVASW
FT                   NGEAREAYEVRQSRWRAASQDLQAMLRDIKLAVEDSATDYLDTEKRNANMFQ"
FT   gene            complement(421547..422761)
FT                   /locus_tag="Micau_0421"
FT   CDS_pept        complement(421547..422761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0421"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: saq:Sare_4440 peptidase S8/S53 subtilisin
FT                   kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43988"
FT                   /db_xref="GOA:D9T6P2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P2"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADL43988.1"
FT                   /translation="MSRPVAYPVVAALATLLVAGVPAAPATARAPAGCASPPAPARPVA
FT                   DQPWPQQRYAPERLTPLATGAGVVVAVVDSGVDRSHPQLAGRVLDGADFLDRSGDGTRD
FT                   CAGHGTGVASIIAAAPQPGVAFRGLAPDARILPVRVSEQQVVDGRESGRTVDAAGFARA
FT                   IRWAVDHDADVLNLSVVLYADDPAVRAAVAYAVRRDVVVVAAAGNLHDNGDPRPYPAAY
FT                   DGVLGVGAIGRDGTRSAFSQTGSYVDVVAPGSEVLMAAPRSGHQRAEGTSYATPFVAGT
FT                   AALLRQYRPRLSAAEVAGLIVAAADPAPGRDAGYGAGVLNPYRAVTESAGATDTRTRPG
FT                   AALPAERPDPAALARQSRRDTARDRALLAAAVAGGAVALVAALALVLPRGARRRWRAAD
FT                   PAVPS"
FT   sig_peptide     complement(422675..422761)
FT                   /locus_tag="Micau_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.915 at
FT                   residue 29"
FT   gene            422914..426114
FT                   /locus_tag="Micau_0422"
FT   CDS_pept        422914..426114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43989"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P3"
FT                   /inference="similar to AA sequence:KEGG:Sare_4439"
FT                   /protein_id="ADL43989.1"
FT                   /translation="MTGWEPATEAEVAMRDALRAQDQQQYFRALTRVDLLLPVANGPTA
FT                   GWGTWTSGGRTHVLAFTSVAALRASLGENAGPTRRVPYPDLAAGWPNPEWWLAVNPGLP
FT                   IEGYLPAWYVAQLSRGDVRLPGRTMGARARLERVENATRGARNTVPEAAPRPPAVPVPP
FT                   AAVTPARVPPAVVPPAAAPPPVVPPPAVPPPAVPPLAGAGAPGRDERLMETDEPATVPM
FT                   RAASVLGRRLPTVPPRRRAADSDVPSRTTSGAEADTDALDGWLTDLRRRPDEPDPFAAA
FT                   PAAPADEPPAAAAPPPARSFFEPSSGGRSARRPSPLDPSRRAGDRATPPTRFAGGQPFP
FT                   RRRPLNEPVREGPTHAFAARPDEPPVPRPDEATQAFRPTRPPEDATEALPRRHAGPADA
FT                   GTAAATHAGPAVAAHAGPATADGWRAAPGGTEDETTRWETIDEPAEELPPSIAEPVSAP
FT                   PAPRRDFTPIVIEGTVIEARDLTEPAPLWSAQPAGPVRAEPAEGAATPWAGTTDPTMPL
FT                   SVDPPVADDTVNLTEPTPARTGATAATDRSTPPDEPTVSLASESEPTTSLFEPPTPAGE
FT                   ATAPLFVSSAASSSASSSAEPTVSLFDRVSTESTAPLAGRDGAEPTVSLFDPAPTEQTA
FT                   PLFDRAPAEPTVSLFDPVPSESTTSLSDLAPDDPTAPLTSPPAEPTASLSDPAPAEQPT
FT                   VSLFEPATGDEPVATSLFAPGEPTVALSTQAPDTAGPAASETTDEPPSGDGSAAEFVPA
FT                   NDVEEDLLAAAGSGSTDGFLTTLLLARVLLPVAPDSATGSRPGDPGFVWHADQVDGGRC
FT                   VSVYTSPERLAEHTEGQIETVRVKFVQLIRRWPDVAWSFRVNPGSPVGATYPGEQVLAL
FT                   ANWAAEVGLGDDPEPAAAPQQAERQRPEAPTNTADRPVTMQKAIAASQLAYYLERGYDR
FT                   VSGFVHRAGELAHLRTPAELYRALGLGHPGSPFSPDDDEIYLLRWPAYRPSLYRIPYGG
FT                   PNEAAMRAMEGWVIERSPFRGNGFAPGESSDVIAEFKVDSARLPHGAELWRVGSDGDSK
FT                   LVAVLDTDELLWRKAGEA"
FT   gene            426111..426476
FT                   /locus_tag="Micau_0423"
FT   CDS_pept        426111..426476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43990"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P4"
FT                   /inference="similar to AA sequence:KEGG:Sare_4438"
FT                   /protein_id="ADL43990.1"
FT                   /translation="MSRDGYVARWRGREYQASPDGDDIRLYQPGPDEGFTEVRPGRYVR
FT                   VVPAAEVDDLAYVRTTCTWQGQPFIVLAEHEGWLRLEYTGGRWPVAEAMGLEAFDFGVY
FT                   QGWAPAAEVADLGEQRV"
FT   gene            complement(426478..427410)
FT                   /locus_tag="Micau_0424"
FT   CDS_pept        complement(426478..427410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0424"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: saq:Sare_4437
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43991"
FT                   /db_xref="GOA:D9T6P5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADL43991.1"
FT                   /translation="MTDQRGGPVDESCVLPEGPWTHRFVGANGSRFHVVEAGTGPMVLF
FT                   LHGFPEYWYAWREMLPAVADAGFRAVAVDLRGYGASDKPPRGYDGYTLAADVAGLIRAL
FT                   GERSATVVGTGAGGLIGWTAASFHPTLVRRLVVLGAPHPLRLRAAIFADPRGQFTSATA
FT                   TLKFQLPRYEHVLARDGAAEVEEILRRWGGPRWVSGPDFADYAHCCRVAMQIPQAAFCA
FT                   MEGYRWAFRSVLRLHGYRFVKLMQKPLVTPTLQLHGALDRASLPRTAQGSGRYVTAPYE
FT                   WRLLDDVGHFPHVEARDVVLGEILRWAKS"
FT   gene            complement(427542..427880)
FT                   /locus_tag="Micau_0425"
FT   CDS_pept        complement(427542..427880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43992"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P6"
FT                   /inference="similar to AA sequence:KEGG:Sare_4436"
FT                   /protein_id="ADL43992.1"
FT                   /translation="MSDDHQPAASGPASPAGRPTPLSATDLPTLRRPAGPPKRPTDNRP
FT                   TGVVAGWITRGGPGPCYGLMDENGTEYAVYGPNAGELRKGDLVTLRLTARDRSVDCGPG
FT                   IPMRIIEE"
FT   gene            complement(428051..430468)
FT                   /locus_tag="Micau_0426"
FT   CDS_pept        complement(428051..430468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0426"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="KEGG: saq:Sare_4435 peptidase M6 immune inhibitor A;
FT                   TIGRFAM: M6 family metalloprotease domain protein; PFAM:
FT                   peptidase M6 immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43993"
FT                   /db_xref="GOA:D9T6P7"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P7"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ADL43993.1"
FT                   /translation="MRKVAVGLLGLSLTATGLVAGTSASAAPTPKLPAAAPSVAEPAQA
FT                   EHDLPNPLEEKRRALRQEGLSEVLSGRAKAQKINGSTVVKVGERAAEGAAAGRSAKSTK
FT                   AGKGPTKDQYVELSRERTDKIFVILAEFGDERHPNYPDQDTDPDTPGPSRFDGPRVNQI
FT                   PEPNRAVDNSTVWQADYSADHFRKLYFGTAPGDESVKQYYEAQSSGRYSVDGEVTNWVR
FT                   VRYNEARYGRSDGYPCASNVCTNTWALVRDAANQWVADQKAQGRSDAEIAADVKAMDEW
FT                   DRYDFDGDGNFNEPDGYIDHFQIVHAGGDQADGDPYQGEDAIWSHRWYAFASDQGNTGP
FT                   ENFPAGGTQIGNTGVWIGDYTIQPENGGRSVFYHEYGHDLGLPDDYNVVSGGDNNNEHW
FT                   TLMAQSRLGAKNDGGIGERGGDLGAWNKLQLGWLDYEVVVAGQKRTLELGPQEYNSNKA
FT                   QAAVVVLPQREYTFQNGKPFEGTKQFFSGNDDDLNNTMTRTVDLTGKTSAALSMKGRYS
FT                   IEADYDYLFFEASTDGGQTWTSLAGTANGAPLKEISPGRYALDGSSNDQWVDVNIPMDA
FT                   VAGKVAQFRLRYQTDGGVSEGGFYGDAITVTADGQTVLTDGAEAGANGWTLSGFSIVEE
FT                   TYTRKFDNYYIAGNRSYVSYDKYLKTGPYFFGYANTRPDYVDHYAYQEGLLISYWNLRF
FT                   ADNDTFAHPGEGRNMIIDAHPRPIYNLTGQPWRARVQVYDAPFSLKKADSFTLHLNSQP
FT                   QYIRGQAAQPLFDDTKQYWYPELPNHGVKLPATGTKIKVLEQNGTSVKVRFS"
FT   sig_peptide     complement(430388..430468)
FT                   /locus_tag="Micau_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.977 at
FT                   residue 27"
FT   gene            complement(430810..433602)
FT                   /locus_tag="Micau_0427"
FT   CDS_pept        complement(430810..433602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0427"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="KEGG: M6 family metalloprotease domain-containing
FT                   protein; TIGRFAM: M6 family metalloprotease domain protein;
FT                   PFAM: peptidase M6 immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43994"
FT                   /db_xref="GOA:D9T6P8"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P8"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ADL43994.1"
FT                   /translation="MLPMSQHRARRRLLVALPAIALAATSLTVTGSAAAQPARSAPVTI
FT                   GADEHYINYAEPEVQPDTGGKEVKGRDGVFSSPADEARAYDRKYAGGNPIAARELAKLE
FT                   AKSIRTGHSPRKIKKAKSTQTAKLLTLLVEFNDKANDDFTDVMVPKTVFEDRTCVPGTV
FT                   QNGPRHNTIPNPATLPHKDNNSMWVPDFSPAHYDKMLYSKKGITERVRKDLKGPDGKPG
FT                   ISLAGRTMHNMYLEMSKGAYTVDGQASPWITVPHSEGWYAASRCFQDENGNWVAGREQS
FT                   MNGHPDNPQGAGRLATDAIDALAAADPNFPWADYDIEDQSDRDGDGNYHEPDGVIDHLV
FT                   LVHANQGKSRGGGDVGIYSVWAHSSTVTGGYTIPGTNLKVSNYIVQPEDAGVGVFAHEF
FT                   GHDLGLPDLYDTSGNADSDVDFWDLMASGSHSGEIFQALPTHMGLWDKWVLGWAEPKTF
FT                   GPGDRSKLVKLGQTSRTPVGTEDGIKIDLPDKVISLATPHSGSNMWYSGADQNWADVKL
FT                   SRTVTVPNAADAKFWMWNNYVIEADWDFGFVEVSTDGGATWSEQKVYAEGGALVSTNDG
FT                   YADPNGRMVDFGNKKYGLTGSTNGWRHDYVDLSSYAGQTVQVRLRYATDEAFVERGWFA
FT                   DDFSVTGGGATTWSDDVESGAAGWTQTGGTFTDTSGAGWYIDSGTQVKSHYYLAEWRNF
FT                   DGFDKGLKYTYDTVYSHEAWKVDRIAYNAPGMLVWYRDTQLGDVNHVTAQMTALPSYGA
FT                   KGGLLIVDSHNDPLRRKGVAAEKDPSVLKNLPSRPQSSNAAFGLKPTYPFKECLEAADE
FT                   PYSEYCTKFGPQAPVRGFTDAKGWYPGIEIRDGAAYARDNDASVVVPSRGNQQYTTRVV
FT                   NPDGTPATDYYGSTLGGGAIVLGTGNPGDAGVQYGVSIIIKRAVKDNSYATVYVVPPRS
FT                   "
FT   sig_peptide     complement(433495..433602)
FT                   /locus_tag="Micau_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.676 at
FT                   residue 36"
FT   gene            complement(433823..435811)
FT                   /locus_tag="Micau_0428"
FT   CDS_pept        complement(433823..435811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0428"
FT                   /product="acetate/CoA ligase"
FT                   /note="KEGG: saq:Sare_4434 acetyl-CoA synthetase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43995"
FT                   /db_xref="GOA:D9T6P9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6P9"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADL43995.1"
FT                   /translation="MSEALANLLNETRQFPPPAELAANANVTAEAYEEAAGDRLAFWER
FT                   QAGRLAWAQPWEQVLDWSNAPFAKWFTGGKLNVAYNCLDRHVEAGLGDKVAIHWEGEPG
FT                   DTRTVTYADLHKLTCQAANALTELGVTAGDRVAIYLPMIPEAAVAMLACARIGATHSVV
FT                   FGGFSADALTNRIQDASAKVVITADGGFRRGKPSALKPTVDEAVANCPSVEHVLVVRRT
FT                   GEEVAWSAKDHWWHETVETASPEHEAQAFDAEHPLFILYTSGTTARPKGILHTTGGYLT
FT                   QTSYTTHAVFDLKPETDVYWCTADIGWVTGHSYIVYGPLSNGATQVMYEGTPDTPHKGR
FT                   FWEVVDKYKVTILYTAPTLIRTMMKWGEDIPAGYDLSSLRLLGSVGEPINPEAWIWYRQ
FT                   HVGRGELPVVDTWWQTETGAIMISPLPGVTEAKPGSAMSPLPGIVADVVDDQGQSVPNG
FT                   GGGYLVLKEPWPSMLRTIWGDDNRFLETYWSRFGAGANTGDEWVYFAGDGAKKDDDGHI
FT                   WLLGRVDDVMLVSGHNISTTEVESALVSHPSVAEAAVVGATDPTTGQAIVAFAIPRGSA
FT                   EISGDAGEQLIAELRNHVAKTLGPIAKPRQIMLVPELPKTRSGKIMRRLLRDVAENRSL
FT                   GDVTTLQDSSVMELISSGMSGGKSDED"
FT   gene            436034..436780
FT                   /locus_tag="Micau_0429"
FT   CDS_pept        436034..436780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43996"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6Q0"
FT                   /inference="similar to AA sequence:KEGG:Sare_4433"
FT                   /protein_id="ADL43996.1"
FT                   /translation="MTTDPLAPLLALADVATAVEQARERVDLAHRHRALRRQGGQVAAE
FT                   VSLRSAVASAALEGRVHDREEVRAGTVTDPVLQGALRVAGALPGLSDLWPKAPRQVMAR
FT                   LHVLAARDVVTEEELGRPVADPVVAARLDGLAALVAGGTKVPPLVLAAVVHGELLNLRP
FT                   FPGPSGVVARAAARLVLISTGFDPRGLVAVDVGHREREPEYVGAAGAFATGTPDGLRSW
FT                   LRHYMSAVEVGADQITLIGDEILAAS"
FT   gene            complement(436794..437600)
FT                   /locus_tag="Micau_0430"
FT   CDS_pept        complement(436794..437600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0430"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); KEGG: saq:Sare_4432 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43997"
FT                   /db_xref="GOA:D9T6Q1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6Q1"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADL43997.1"
FT                   /translation="MGRSAAFFDLDKTVIAKSSALAFGRPFYRDGLITRRDVVKSAYAQ
FT                   LMFRLGGTDEQTMARTRDYLATLCKGWPVEQVRQIVAETLHELINPYVYAEAAALIEEH
FT                   QAAGRDVVLVSASGDEMVRPIGELLGITDVIATRMGVVDGRYSGEVEFYAAGPSKVEAV
FT                   SELALERDYDLADSYAYSDSYSDRPLLECVGHPTVVNPDRALRKLAVENAWPVLEFRHP
FT                   IPLGRRLRERPAVPVAAAALGVGVGVAIGIAWYGRHRRTRAAAPTA"
FT   gene            complement(437934..438902)
FT                   /locus_tag="Micau_0431"
FT   CDS_pept        complement(437934..438902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0431"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sti:Sthe_3261 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43998"
FT                   /db_xref="GOA:D9T6Q2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6Q2"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADL43998.1"
FT                   /translation="MIDKPDIDERLLAAEVAAAWSVDVVDLAFMPVGLDGHAWAYRVET
FT                   SDGGRCFLKVRRGDFTPAAVLLPGFLRTQGLRQVVAPLDLRLDGGVARRFGDYRLLLYP
FT                   FQDGDSLWGRGLTDRQWTEYGDFLGRLHRVTPSAEVAAVLPVETYRSSAGDRLRALGGQ
FT                   AAASETLGAFWKRYGAALRRLAETVDDLASRVTPGQHVICHADIHPGNLIADGDGTLHV
FT                   VDWDAPILAPRERDLMFVHSADFGEHPIDAHRAELFREGYGALEPDPVLLSYYRGERHL
FT                   DDVAAFLGSILGPEASAESRANDLHWLIRIAEAVADPGYAP"
FT   gene            complement(438945..439640)
FT                   /locus_tag="Micau_0432"
FT   CDS_pept        complement(438945..439640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_1398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL43999"
FT                   /db_xref="GOA:D9T6Q3"
FT                   /db_xref="InterPro:IPR024053"
FT                   /db_xref="InterPro:IPR036208"
FT                   /db_xref="InterPro:IPR037140"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6Q3"
FT                   /inference="similar to AA sequence:KEGG:Sare_1398"
FT                   /protein_id="ADL43999.1"
FT                   /translation="MTDSPHPLTPPSVRPHSRSAPTAGGEIWLRDPSPTLLAAIAIGLV
FT                   VVVLASIVSVFATPRRPDLPPPLEGQAILASPTRAGSVTETPAESYAPPSVSFSSRAVA
FT                   PSRTAAPTRRPTPSSRPTSPKPSIPRSKPPVVGPGELAPLPASRESRLRSHGGGPSTFI
FT                   DFVNSHGSTVVVHWINYDGRRQQYAVLRPGQSYRQQTYVGHPWVVADERGRGLVCFEPD
FT                   RQTLRAVIR"
FT   gene            439888..440991
FT                   /locus_tag="Micau_0433"
FT   CDS_pept        439888..440991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44000"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T6Q4"
FT                   /inference="similar to AA sequence:KEGG:Sare_4422"
FT                   /protein_id="ADL44000.1"
FT                   /translation="MPPRTPLPPYRRLPLLVTSDGDLLDELLRLAAAGGTEVELAADPA
FT                   AARARWAPAPLVLIGADQAAACLRARLPRRARTVLVGRSGELDPGTELAELIGSEHVAT
FT                   LPAAEPWLVDRFAECVAGPAGPGQGRVVAVLGGRGGAGASVLAGGLAVSAARSRLRTLL
FT                   VDADPLGGGLDLVLGWEQLDGLRWPELAGTDGRVDPPSLIRALPSRGDLVVLSWDRGDL
FT                   RHLPAEAMAATVDAGRRGRDLVVLDLPRHLDDAAVVALQAADRALLVVPAELRAAAAAA
FT                   RVAAVAAPHCIDLSVIVRGPAPGRLRAAEVSRALGLPLAGTLRPEPGLCRGLERGEAPG
FT                   ASGKGPLAALCQRIVDELVGSSAAGAA"
FT   gene            440988..442199
FT                   /locus_tag="Micau_0434"
FT   CDS_pept        440988..442199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0434"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   saq:Sare_4421 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44001"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7G9"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADL44001.1"
FT                   /translation="MTAPADPGELAARVRHRFAAEATPVTPAAIVSAVRAEPATAVLGD
FT                   TTLLRIADRVHDDLVGAGPLAPLLADPQVTDVLVNGVRVWVDRGRGLRQVAVPLGSLDD
FT                   VRRLAQRLTSAAGRRLDDASPYADARLPDGTRLHAVLPPVATDGPYLSLRTFRQRPFTL
FT                   DELVERGTVPRPIAPLLAALVAARLAYLVSGGTGSGKTTLLNTLLGLVPGTERIVLVED
FT                   AAELRPVHPHVIGLQARTANVEGAGAVGLGDLVRQALRMRPDRLVVGECRGAEVVDLLA
FT                   ALNTGHDGGAGTLHANAPADVPARLEALGMLGGLPRLALHAQVAAALQVVLQLRRTGEG
FT                   RVLDSIGLLLPDGPDRVVTVVPAWARGRGLAPAALLLAGLLRERGAPVPPILQAAWPGP
FT                   AEPS"
FT   gene            442541..443104
FT                   /locus_tag="Micau_0435"
FT   CDS_pept        442541..443104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44002"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H0"
FT                   /inference="similar to AA sequence:KEGG:Sare_4420"
FT                   /protein_id="ADL44002.1"
FT                   /translation="MAALCGAVTGALLGGPVAALVLATYGVLAARAVLRRRTHRTATLA
FT                   HRRDLDRLAAVAADLRAGLPVDGGVDDGPGRVARLARAAGRLADQTGAPLADLLERIEA
FT                   DARAADRGLAAAAAQAAGARATAWLLAALPLGGIGLGYGIGVDPVAVLLHTPVGAGSAV
FT                   AAVVLQVGGLLWAERLGVTPGRAA"
FT   sig_peptide     442541..442600
FT                   /locus_tag="Micau_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.651 at
FT                   residue 20"
FT   gene            443104..443832
FT                   /locus_tag="Micau_0436"
FT   CDS_pept        443104..443832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0436"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   stp:Strop_4037 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44003"
FT                   /db_xref="GOA:D9T7H1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H1"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADL44003.1"
FT                   /translation="MSRQVLAAVCLGGAASLLVVAGPVVRPARRLRRLAPTPPPTRPAW
FT                   WPDRVRLGAALAGIAVAVVVGGVTGVFLGLLAGAAADRLLRRIEPRAARERRLRETADL
FT                   PLAADLLAAALRAGAPVDRSVLAVAEALGGPLADRLGRVGRTLRLGGSPGEAWAHLEGV
FT                   TGAEPVAAAAVRSSNSGAALARALTRLADDLRAERSTSAEAAARRAGVLIVLPLGLCFL
FT                   PAFILAGLVPVIVAVLGDVL"
FT   sig_peptide     443104..443169
FT                   /locus_tag="Micau_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            443856..444023
FT                   /locus_tag="Micau_0437"
FT   CDS_pept        443856..444023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44004"
FT                   /db_xref="GOA:D9T7H2"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H2"
FT                   /inference="similar to AA sequence:KEGG:Strop_4036"
FT                   /protein_id="ADL44004.1"
FT                   /translation="MRKLLTRLRGDAGMNTAEYAVGTLAAVAFAGILLKVLTSGNVQSA
FT                   LTAVIDRALK"
FT   gene            444086..444514
FT                   /locus_tag="Micau_0438"
FT   CDS_pept        444086..444514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44005"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H3"
FT                   /inference="similar to AA sequence:KEGG:Strop_4035"
FT                   /protein_id="ADL44005.1"
FT                   /translation="MSTEPGSTRDAVGTRAGEVRRRWRLWAACERGSFTAELAAGLPAL
FT                   MLLLVAGLTAVNAVGTRVACVDAAREAALAAARGEPGTVAATRYAPDGAEVSVTVTGDR
FT                   VTATVRAPVRTFGTRLPRLVVAAEAVAAVEPGAPGPVP"
FT   gene            444685..445005
FT                   /locus_tag="Micau_0439"
FT   CDS_pept        444685..445005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0439"
FT                   /product="Helicase/secretion neighbourhood TadE-like
FT                   protein"
FT                   /note="TIGRFAM: Helicase/secretion neighbourhood TadE-like
FT                   protein; KEGG: saq:Sare_4416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44006"
FT                   /db_xref="GOA:D9T7H4"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H4"
FT                   /inference="protein motif:TFAM:TIGR03816"
FT                   /protein_id="ADL44006.1"
FT                   /translation="MCLLAIGLVFVLVGVFGAAVGAARCARHQARNAADFGALAGAVQV
FT                   LDGADVACARAADLVSANGGRMTGCRADGLDLIVTAQVRVAPLPGLTRDAVATSRAGPA
FT                   RS"
FT   sig_peptide     444685..444753
FT                   /locus_tag="Micau_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.374 at
FT                   residue 23"
FT   gene            complement(445060..445638)
FT                   /locus_tag="Micau_0440"
FT   CDS_pept        complement(445060..445638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44007"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H5"
FT                   /inference="similar to AA sequence:KEGG:Sare_4415"
FT                   /protein_id="ADL44007.1"
FT                   /translation="MSPDNLQAQHRFIIRQRLRMMVNQYEVHSVAPDGSEGGLLAFAQQ
FT                   KRLAFKEQVTIYTDDSKQYPLLGFKARQRLDLGATYDVTDHAGNPIGLFRKDFAQSLLR
FT                   STWHVEQPGLPPATGQERSLPVALLRRFVDSLSWLPYHFDFMAGGQPVFSVDRKWGLRD
FT                   RYNVEIQHPQIDRRLVIAMAVGLDALQSR"
FT   gene            complement(445839..446045)
FT                   /locus_tag="Micau_0441"
FT   CDS_pept        complement(445839..446045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1039 23S rRNA m(2)G2445
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44008"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H6"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1039"
FT                   /protein_id="ADL44008.1"
FT                   /translation="MADTIAETVELLYTIDQENLTPDQQIALGTAMATLAQAERLEQIN
FT                   ERLRGIHQVLNSWAMKATVDGGR"
FT   gene            complement(446302..448797)
FT                   /locus_tag="Micau_0442"
FT   CDS_pept        complement(446302..448797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0442"
FT                   /product="Protein of unknown function DUF1998"
FT                   /note="KEGG: saq:Sare_4414 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: Protein of unknown
FT                   function DUF1998; DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44009"
FT                   /db_xref="GOA:D9T7H7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H7"
FT                   /inference="protein motif:PFAM:PF09369"
FT                   /protein_id="ADL44009.1"
FT                   /translation="MTDHSPGPRRAPGELLRRLRLRHPTDPVTHVERVPARAGEPAGWP
FT                   GWAPEELRAAFARRGVTAPWRHQAEAAELAYAGRHVVVATGTASGKSLAYQLPALSTLL
FT                   ADPRATVLYLAPTKALAADQLRAVAGLELDGVRPATYDGDTPRAEREWIRRHSRFVLTN
FT                   PDMLHHGVLPGHAHWSGFLRRLAYVVVDECHTYRGVFGSHVAHVLRRLRRQCARFGRTP
FT                   VFLLASATSGDPAAAAERLTGLPVTAVTEDTSPRGGVTFALWEPPLLPPTDSSVDADLV
FT                   QVRRSALRETADLLADSVVEGVRTLAFVRSRRGAEVVAANARRSLDEAVPGLGDRVAAY
FT                   RAGYLREERRELERALLHGDLLGLASTNALELGVDLVGLDAVLICGWPGTRASLWQQAG
FT                   RAGRSGDEALAVLVARDDPLDTYLVHHPEALFGRPVEATVLDPANPYVLAPQLACAAHE
FT                   SPLTPADLDLFGEGAKEAVDSLVEAGALRQRPTGWYWRHRERPEVDLRGEGGAPVCVVE
FT                   ESTGRLLGTVDGGSAHFLLHTGAVYLHQGVSYVVDSLDLADGCALVHAEEPDWSTHARD
FT                   VTSLSVVSVRSYVDAGPVGLFLGEVDVTSQVVSYQRRRIATGEVIDTRPLDLPARELRT
FT                   VAVWFTLSPESLTAAGVEAADVPGALHAAEHAAIGLLPLMATCDRWDIGGLSTALHPDT
FT                   EAPTVFVYDGHPGGAGFAERAYGTAAAWLRATRDAIAECGCETGCPSCVQSPKCGNGNN
FT                   PLAKAEAVKVLDVVLTNLATAGGEAAVTGPEAVAGPEAAAGPEAVAGPDSGGPERGEVL
FT                   PRQDDRAARPAQAAGAPPA"
FT   gene            448931..449281
FT                   /locus_tag="Micau_0443"
FT   CDS_pept        448931..449281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0443"
FT                   /product="anti-anti-sigma factor"
FT                   /note="KEGG: saq:Sare_4413 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44010"
FT                   /db_xref="GOA:D9T7H8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H8"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADL44010.1"
FT                   /translation="MELSLATRAVGEHTVLEVGGEVDVYTAPRLRERLLELIDGGARHV
FT                   VVDLGRVDFLDSTGLGVLVGALKRLRSAGGSFALVCDKEPLLKIFRITALDQVFPLHPT
FT                   VDAAIAADSTGA"
FT   gene            449281..449718
FT                   /locus_tag="Micau_0444"
FT   CDS_pept        449281..449718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0444"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: saq:Sare_4412 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44011"
FT                   /db_xref="GOA:D9T7H9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7H9"
FT                   /inference="similar to AA sequence:KEGG:Sare_4412"
FT                   /protein_id="ADL44011.1"
FT                   /translation="MATVKLSFSPAPVHVRTARLVGVAVARRAGVREDLLDEVRLAIGE
FT                   ACTRAVALHRQYGLADPVYVEMSDGGGYTVRVVDRAPIEAGLGLAALGPDELAKESLSE
FT                   DALTTGVGFALLAGFVEDLQVRPVDDGVGTEVRMSWPAGRA"
FT   gene            450040..452388
FT                   /locus_tag="Micau_0445"
FT   CDS_pept        450040..452388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0445"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   KEGG: saq:Sare_4411 membrane-bound proton-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44012"
FT                   /db_xref="GOA:D9T7I0"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I0"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADL44012.1"
FT                   /translation="MSGTLAADGGALSLTGANVTYVVIAAVIALVALVFAAALTRAVLA
FT                   AGKGTTNMQEISGAVQEGASAYLLRQFRTLAIFVVIAVVLLFLLPVHDTDGNETLVKAG
FT                   RSAFFVVGALFSAFIGGAGMWLATRANLRVAAAAREREGGREAAMKIAFRTGGVVGFLT
FT                   VGLGLFGAALVVLIFRGDAPTVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVE
FT                   QGIPEDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGRAAFGETGLVFP
FT                   LIISTIGVLVAIVGVFITRLRASDRNGLTAINRAFYLSALIAAVLVAIAAFAYLPATFA
FT                   ELEGGLTDVDRNPRLVAIGAVVIGIVLAAAIQALTGYFTETNRRPVQDIGKSSQTGPAT
FT                   VILAGISVGLESAVYSALLIGAGVFGAFLLGGSSITLSLFAVALAGTGLLTTVGVIVAM
FT                   DTFGPISDNAQGVAEMSGDIDEHGARTLTELDAVGNTTKAITKGIAIATAVLAATALFG
FT                   SYTDTLRSAYEDAGVGDVGTEILNSLNVSNPRNLVGLIIGAAVVFLFSGLAINAVSRSA
FT                   GAVVMEVRRQFRELPGIMDRTQRPEYGKVVDICTRDAQRELMTPGLLAILAPIAVGFGL
FT                   GPGALAAYLAGAIGAGTLMAVFLANSGGAWDNAKKLVEDGAYGGKGSDAHSATVIGDTV
FT                   GDPFKDTAGPAINPLIKVMNLVSLLIAPAVVAWSVGDDKNPALRITIAVVAALIIAAAV
FT                   VFSKRKGVAMTDEDSGAGTPDQRPETVNA"
FT   gene            452490..453032
FT                   /locus_tag="Micau_0446"
FT   CDS_pept        452490..453032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44013"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I1"
FT                   /inference="similar to AA sequence:KEGG:Sare_4410"
FT                   /protein_id="ADL44013.1"
FT                   /translation="MRTRRAATAGKLTVVLATLVLVVAGCGGGPNPRVWAASVCQALTP
FT                   WRAEISKLTSSTQQQMTAQTTPAQAKENLVRLFAGAEQASETARRKVEEAGVPEAERGA
FT                   EVSAGFLGSLSKMRDAYGRARSAIDRLDTAQAGPFYDGVRAAVDTLNKEYDASALDTSK
FT                   LNSTELKEAFDEVPECR"
FT   sig_peptide     452490..452600
FT                   /locus_tag="Micau_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.758 at
FT                   residue 37"
FT   gene            453023..453631
FT                   /locus_tag="Micau_0447"
FT   CDS_pept        453023..453631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44014"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I2"
FT                   /inference="similar to AA sequence:KEGG:Sare_4409"
FT                   /protein_id="ADL44014.1"
FT                   /translation="MSLTPPTPKPARQPSLFSTEAADPALADLAGLLAGPGEVGRMGGT
FT                   ARISVVVDAAWRVHVLVAELGARGVPASWEPTEDGRHRVRTAYTSMLAPLARAWLRGGV
FT                   KRPPARFHLDGRRLRLWAAAAGTAEPAGFRLRLGPADEPSWPVVRAALAAVGLPAAFVE
FT                   PDEGGPAFRIGGRRMSRLAELVGERPATAPVADWPGSRG"
FT   gene            453900..456710
FT                   /locus_tag="Micau_0448"
FT   CDS_pept        453900..456710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0448"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: stp:Strop_4027
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44015"
FT                   /db_xref="GOA:D9T7I3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I3"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADL44015.1"
FT                   /translation="MPSNAGTTRLVIVESPAKAKTISGYLGPGYVVEASFGHVRDLPRN
FT                   AADVPAKYKGEPWARLGVDVDNGFHALYVVSPDRKQQISKLVKLAKEVDEIFLATDEDR
FT                   EGEAIAWHLVETLKPKVPVKRMVFHEITKPAIQAAVANPREIDRDLVDAQEARRILDRL
FT                   YGYEVSPVLWKKVMPKLSAGRVQSVATRIVVERERQRMAFRTAEYWDILATLAVAKPGE
FT                   GPRTFNATLVALNGDRIATGKDFEPTTGRVRAGAGVVHLDEGGARGLAARLADQPFTVT
FT                   RVEEKPYRRRPYAPFITSTLQQEAARKMRFSSQQTMRTAQRLYENGYITYMRTDSVNLS
FT                   ETAITAARRQIVELYGERSVPPEPRRYTGKVKNAQEAHEAIRPAGDNFRTPGEVAKELS
FT                   AEEFKLYELIWRRTIASQMTDAVGSSVSVRIRAVSSAQEEADFGATGKTITDPGFLRAY
FT                   VESSDDENAEAEDAERRLPTLVKDQPLTADELAAQGHHTQPPARYTEASLVKALEELGI
FT                   GRPSTYASIMQTIQDRGYVVKRGQAMIPSFLAFAVIGLMERHYPRLIDYDFTASMENEL
FT                   DEIAGGDHAAVDFLTSFYFGSTNGTGDQAIAHAGGLKKLVTENLSEIDARSVNSIPLFT
FT                   DDEGREVVVRVGRYGPYLQRALPGEQQAPTPAASGEGEESGSQGDRAPIPEGLAPDELT
FT                   PEKVHELFLGGGGERKLGDDPSTGEPIVLKSGRFGPYVASGERKSSLLRSQTPDSLTLE
FT                   QALQLLRLPRLIGVAPDGVEVFANNGRYGPYVKRGDEFRSLDSEDKMFTVTLDEALALL
FT                   AAPKTRQRRAAAPPLREMGNDPLTEKPLVIKDGRFGPYVTDGEFNASLRRGQTPEELTL
FT                   EQASEMLAEKRAKGPAPKKKAAKKAAPAKKTTAAKKTTAAKKTTAAKKAPAKKAAPKKA
FT                   TSTPNE"
FT   gene            complement(456757..457677)
FT                   /locus_tag="Micau_0449"
FT   CDS_pept        complement(456757..457677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44016"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I4"
FT                   /inference="similar to AA sequence:KEGG:Xcel_2602"
FT                   /protein_id="ADL44016.1"
FT                   /translation="MPGDDADELSWLLFHQERVLEATQARRFLSEKAIRHRLGSGRWRQ
FT                   AHRRVYVTHNGPVGPKEWRWVAVLAAGPAATLGGLTAAQAWGLRRYESRLVHLLLPARH
FT                   QTRTLPPAVRIHRTTALPPEDVLTVGRPRRTMPARSLVDAAQWAATDEEARAVIAAGFQ
FT                   QRLVWGDDLHRVLERLPRARRRRLILATATDAAGGAHSLAELDFLDLVRRAGLPEPSLQ
FT                   VVRRNATGRRRYLDVWFERWRVHVEIDGGQHLDPRTAWADMQRQNDVWATGDRVLRFPA
FT                   WAVRNDPTRVVTQLRAALRSAGWPD"
FT   gene            complement(457789..459096)
FT                   /locus_tag="Micau_0450"
FT   CDS_pept        complement(457789..459096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0450"
FT                   /product="FAD-linked oxidoreductase"
FT                   /note="KEGG: saq:Sare_4407 FAD-linked oxidoreductase;
FT                   TIGRFAM: FAD-linked oxidoreductase; PFAM:
FT                   D-arabinono-14-lactone oxidase; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44017"
FT                   /db_xref="GOA:D9T7I5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I5"
FT                   /inference="protein motif:TFAM:TIGR01679"
FT                   /protein_id="ADL44017.1"
FT                   /translation="MTGTTATWSNWAGNQHSTALLTVRPHSVSDVAEAVRQAAAAGRTV
FT                   RATGSGHSFTATAVADGHRIDLAALETDVTVDVARRLVTVPAGMTLHTLNELLAGHGLA
FT                   MPNLGDIDAQTIAGALSTGTHGTGAKLGCLSTFVVGLTLVTGTGEVLRCSAEENRDVFD
FT                   AARVGLGAVGVLVEVTLRCVDAFVLRAHERPAPLAEVLDDLPGLYDAHDHAEFYWFPYT
FT                   DRVQVKTNDRVPADDRPLPRWRGWLDDEFLSNTVFAGACRLGRAVPALAPRISAVSARA
FT                   LTERTYTGRSDRVFCTPRRVRFVEMEYGLPREALPTALAELRRIVDRLPFKVLFPVEVR
FT                   FTAADDIWLSHSYGRDSAYIAVHQYVGMPYEPYFRAFEQVATELGGRPHWGKLHWRTAE
FT                   SLASAYPRFADFQSVRARLDPHNLFQNPYLTQVLGA"
FT   gene            459325..459900
FT                   /locus_tag="Micau_0451"
FT   CDS_pept        459325..459900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0451"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_4025
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44018"
FT                   /db_xref="GOA:D9T7I6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL44018.1"
FT                   /translation="MLDACAELVDEVGYEGLTTTLLAERAEVAIGSVYQFFPDKRAIVQ
FT                   ALTLRTMESYLQRLDERFSSDDLTHWWDGVDAAIDEYISMHRTVPGFRTLHFGDVVDLH
FT                   LLDDQRDNNGVIAEQLARVLTERFGLAVVPDLRFHLEVAVEAADALIKLAFRRRTDGDE
FT                   RVLVEAKALIREYLHRQVNAPTEAVHQG"
FT   gene            complement(459981..461189)
FT                   /locus_tag="Micau_0452"
FT   CDS_pept        complement(459981..461189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0452"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   saq:Sare_4405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44019"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I7"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADL44019.1"
FT                   /translation="MAIDRDKTRDRLDRATAHLDPPYAVVDLTAFDANAEALAGRSGGK
FT                   PLRVASKSVRVRELLTRALKRPGWHGVMAFTLPEALWLVRSGVSDDVLVAYPTAHRGGL
FT                   AELAADPALADAVTLMIDDTAQLDLIDRVCPPARRPALRICLDLDASWRPLGGRVHVGV
FT                   RRSPVHSATAAGALAAAVAGRPGFRLVGLMSYEAQIAGLGDAPPGQAMLGSAIRVAQRG
FT                   SYRELLARRSAAVGAVREHADLEFVNGGGTGSVAATSADPAVTEVTAGSGLYGPTLFDA
FT                   YRAWQPTPAAFFACAVVRRPAPGLATVLGGGWIASGPAADSRLPRPWLPEGLKLLGAEG
FT                   AGEVQTPLAGEAADGLRVGDRVWFRHAKAGELCEHVNEVHLVEGDAVVATVPTYRGEGH
FT                   AFL"
FT   gene            461407..463563
FT                   /locus_tag="Micau_0453"
FT   CDS_pept        461407..463563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0453"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: saq:Sare_4404
FT                   dTMP kinase; PFAM: thymidylate kinase; major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44020"
FT                   /db_xref="GOA:D9T7I8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I8"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADL44020.1"
FT                   /translation="MSSPGTAADHSGVAAIRSVLRIRPFRRLWIVLSAASFGDWLGLLA
FT                   TALFAASQVSGSTAQGAAFGGVTAIRLLPALVLGPVAGVFADRFDRRWTMVICDLLRFV
FT                   LFASIPLYALTGAAGGLVVGWALIATFLIESITLMWIPAKEAAVPNLIPRTRLEAANQL
FT                   TLITTYGLTPVAAAVALAVLDRGVRGAVGGDLPGWAEPAQLALWFNAFSRLATALVVAF
FT                   GIKEISHAQRGEAERSEQSMFRQFSEGWKYIGQTPLVRGLVLGIFGAFAGGGIVVGTAK
FT                   FFANSLGAGDAAFSLLFGAIFVGLALGIGLGPMIVRDMSRRRWFGMSIVLASASVLVLA
FT                   FAIHLSMAILGAILVGAGAGMAFLAGTTLLGGEVADEVRGRVFAVVQIGTRLVLILAIA
FT                   LSSLLVGVGGSRQLTIADLGISISSTRLLLLAAGAAGIIAGISAFGQMDDKKGVPVLAD
FT                   LWGSIRGRPLMPAEPFVSSGLFVVFEGGEGAGKSTQLAELAERLRAQGRDVVVTREPGA
FT                   TPVGERIRSLVLGTTPGEAPSPRAEALLYAADRAHHVATVVRPALVRGAVVISDRYVDS
FT                   SLAYQGAGRTLPVDEVSWLSSWATGGLKPDLVVLLDVEPRTGLSRVEDRAEGTDRLEAE
FT                   SLTFHERVRYAFLDLAAGDPKRYLVLDASRPIDETADAVARRVGELLADPAGIVHPRPA
FT                   QGPDTSVQPELSDAELVTMEQPRR"
FT   gene            463560..464831
FT                   /locus_tag="Micau_0454"
FT   CDS_pept        463560..464831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0454"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   saq:Sare_4403 DNA polymerase III, delta prime subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44021"
FT                   /db_xref="GOA:D9T7I9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7I9"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADL44021.1"
FT                   /translation="MTDVFGDLVGQDEAVAMLRRAAASAAALLRAPVTSPAGGHDDLDA
FT                   LAEEHDGDPGPVAPADPGGGMTHAWIFTGPPGSGRSVAARAFAAALECVHGTGCGTCPG
FT                   CHTTLAGTHADVRLVVPEGLSIGVNEMRALVLRAASAPSGGRWQIVIIEDADRLTEAAG
FT                   NALLKAIEEPPPRTVFLLCAPSTHPDDISVTIRSRCRVVPLRQPPPAAVAEVLVRRDGI
FT                   APDVAEWAAAAAQGHVGRARRLARDPEARQRRDAVLAVPRRLTGVGAAFDAASALIEAA
FT                   EAEAAASVAEIDEAERTALQTALGAGGTGRGAAGAMRGAAGQLKDLEKRQKSRATRAQR
FT                   DALDRALVDLAGFYRDALTMAWRAPVAPVHTDTASLAGAGAQKWDAEGSLRRLEAVLEC
FT                   RAAIEANVKPRIAVEAMMLALWRG"
FT   gene            464965..465294
FT                   /locus_tag="Micau_0455"
FT   CDS_pept        464965..465294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0455"
FT                   /product="uncharacterized protein family UPF0133"
FT                   /note="PFAM: uncharacterized protein family UPF0133; KEGG:
FT                   stp:Strop_4021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44022"
FT                   /db_xref="GOA:D9T7J0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADL44022.1"
FT                   /translation="MPRGEIDEAWIEEAVRRYRRIENLQAEFDHAVATVEVTVRSPDGL
FT                   VEVVVTAGGRITDVRFLGPLHHRSPRDVAGSVQAAVTAAADAAQWAREKLHNETFAAYR
FT                   PLAGA"
FT   gene            465296..465601
FT                   /locus_tag="Micau_0456"
FT   CDS_pept        465296..465601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44023"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J1"
FT                   /inference="similar to AA sequence:KEGG:Sare_4401"
FT                   /protein_id="ADL44023.1"
FT                   /translation="METLRALAARLDEAGATLATLSRTVTATDPPHPAFGAHAAGRPGE
FT                   VGRALHRQWTVATADRAREAQAAAVRLAAAAAALRSAADRYAAADDAVARRLAREA"
FT   gene            465601..466269
FT                   /locus_tag="Micau_0457"
FT   CDS_pept        465601..466269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44024"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J2"
FT                   /inference="similar to AA sequence:KEGG:Sare_4400"
FT                   /protein_id="ADL44024.1"
FT                   /translation="MDALDRLAEPGLDLLARVDTLLAAGAPEGHRLWPLLRRMQVLPGA
FT                   AVREFLDLHPAPLTGAGHAVRRLVRGYDDTCALLADQVAWSGAAASAYDEARAALLRHL
FT                   DEGPDSLVGRLESTAGYADALAGWVEGSRAALARALAEVLGSAEAVAVHAATRPGAEAG
FT                   RAGASAAAEIATRILGVLGVAYDGAETLLRQWGPSLAETPWRDRATTAPRYGGTTRIGY
FT                   "
FT   gene            466529..467371
FT                   /locus_tag="Micau_0458"
FT   CDS_pept        466529..467371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0458"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: saq:Sare_4399 PSP1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44025"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J3"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADL44025.1"
FT                   /translation="MGMLCAVSFNRYGRLYYLDPGELRPQVGDRVLVPTDEGPEVAECV
FT                   WAAQWVSEDTDSFPKLAGIAGDEDLRRDEMLRRRKAEAKVAAKRLIREHGLPMKVVAVD
FT                   HVLATPENGSDRTTIYFTAPHRVDFRSLVRDLGATLHCRVELRQLSARDSARVQGGIGS
FT                   CGRDLCCATFLTDFEPVTIRMAKDQDLPLNPLRISGACGRLMCCLKYEHPLYQKFQESA
FT                   PAVGSRVSTPQGEGKVVGHSVPRDAVTVRLDADGSRSMCSRASVCGPRQAHDQHYPQP"
FT   gene            complement(467497..469227)
FT                   /locus_tag="Micau_0459"
FT   CDS_pept        complement(467497..469227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0459"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: saq:Sare_4398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44026"
FT                   /db_xref="GOA:D9T7J4"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADL44026.1"
FT                   /translation="MTDEPPRPPAPEARPGERATRRPRSIDPRELGFTPRRPVPWLAPL
FT                   LLISTGLRTLLAMLFGAYLDKRELQNAFSDGTFRQVGPDGGLWLDYVADLGDGFDATYS
FT                   VAYLLAQPELTVDGHTLPRAQTLVMGGDQVYPAAGYEAYEDRCKGPYQAALPVAPPEQP
FT                   KLFAVPGNHDWYDGLTAFLRLFVRTRDRHFGGWGTGQSRSYFAVELPAGWWLLGLDDQS
FT                   GSYLDDPQLTYFDEVARKLTPESKVILAVPAPTWVKAVDHPNAYDSIDYFIRTLVAPTG
FT                   AQVRVLVSGDLHHYARYAGTDRQLITCGGGGAYLYPTHRLPEKLEVPPRDTLTRRASNT
FT                   REYDLAARYPDKARSRRYGWGIFARLPFRNPGFTTLLGTLHTLLMLAMAGVAVQQVGTT
FT                   EQRLFSVPLAIMLVVAMMGAVFFAKPPTAGGKRHARHWILGVAHGLAQVALAAGGTWVW
FT                   LQLPFYDWPWPLPAVAAVVLYGPLSGLVASQLVALYLLVAGAFGVNLNELFAAQGIEDS
FT                   KAFLRFRIDPDGTLTIYPIAVDKVSHDWQLNPDQSPTAAWLTPKTPLTPRLAEPPIVIR
FT                   "
FT   gene            469360..469433
FT                   /locus_tag="Micau_R0009"
FT                   /note="tRNA-Thr1"
FT   tRNA            469360..469433
FT                   /locus_tag="Micau_R0009"
FT                   /product="tRNA-Thr"
FT   gene            complement(469570..470223)
FT                   /locus_tag="Micau_0460"
FT   CDS_pept        complement(469570..470223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO1182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44027"
FT                   /db_xref="GOA:D9T7J5"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J5"
FT                   /inference="similar to AA sequence:KEGG:BRADO1182"
FT                   /protein_id="ADL44027.1"
FT                   /translation="MRQEHPQRVPDRTDPPGVEGRWAVARWRRALAVLAPLVAAVLGAA
FT                   MATQWEVGGGRAVSSLPAPARWMAENLPLFDGGEPAWIWRGPFFVSVLLTLPLVWTVTG
FT                   HATATPRRLTRYGLLAAAIAIGLEYNSPGYGWMFDLVALLTALAGTVWCGLQGLRRGVL
FT                   PRRVAWALIAALPLTPPSGFLTFWYLPPGLTMGVLLAWAAAAGWPRRPGVRTTA"
FT   gene            complement(470306..471169)
FT                   /locus_tag="Micau_0461"
FT   CDS_pept        complement(470306..471169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0461"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ami:Amir_2441 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44028"
FT                   /db_xref="GOA:D9T7J6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL44028.1"
FT                   /translation="MVDGSNPLGEFLRARREATSPAEAGIVSSGRRRTPGLRREEVAQL
FT                   SGVSADYYARLEQGREQHPSEQMLNALARTLGLDAEEAAHLHLLARSGRKPARRGTRET
FT                   VRPSLLRLMDGWLHTPALIVDRRMDVLAANRLGRALFAKLFEADEPNLVRFVFLDSAAR
FT                   SFYPHWDRVAQSSLGALRAAAADMLDDARLTELVGELSLKSPEFRRLWARHDVRGKTHE
FT                   AKLFHHHDVGELTLTYDSLTVAGATGQQLVVYQAEPGSRPAQALALLGTVAADLPAPGR
FT                   RTRAAS"
FT   gene            471263..471985
FT                   /locus_tag="Micau_0462"
FT   CDS_pept        471263..471985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0462"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   msm:MSMEG_0258 oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44029"
FT                   /db_xref="GOA:D9T7J7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL44029.1"
FT                   /translation="MESTQKVVLVTGASSGIGEATALRLAAEGHAVVAGARRRERLAAL
FT                   AARHDNIRVRRLDVTGRDDVVAFVDSAVAEFGRVDVLVNNAGLMPLSRLDALLVDEWDR
FT                   MIDVNVRGLLHGIAAVLPVFQRQGSGHLITVASVGAHEVVPTSAVYSATKFAAWAITEG
FT                   LRLEADPSLRVTTITPGVVESELAESITDPVAREAMRKYRRNAISPDAVARAISYAVGQ
FT                   PADVDVNEIIIRPTRQRG"
FT   gene            471988..472410
FT                   /locus_tag="Micau_0463"
FT   CDS_pept        471988..472410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0463"
FT                   /product="uncharacterized protein family Atu4866"
FT                   /note="PFAM: uncharacterized protein family Atu4866; KEGG:
FT                   atc:AGR_C_1570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44030"
FT                   /db_xref="InterPro:IPR020955"
FT                   /db_xref="InterPro:IPR038646"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J8"
FT                   /inference="protein motif:PFAM:PF11512"
FT                   /protein_id="ADL44030.1"
FT                   /translation="MSGTSHRKAATVLLTAALTACGTETPPVPQAAPSATPARPSVCEA
FT                   LHPYVGMWVTADGHIRQELLPDGRYDEARGDRASAYTGRYEVTGEHIDYWDDSGFTADG
FT                   RFDGDVLHHGGYLFYREGSAAHRQAVAGRASTRPSG"
FT   sig_peptide     471988..472083
FT                   /locus_tag="Micau_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.522 at
FT                   residue 32"
FT   gene            complement(472464..473291)
FT                   /locus_tag="Micau_0464"
FT   CDS_pept        complement(472464..473291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0464"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   stp:Strop_2137 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44031"
FT                   /db_xref="GOA:D9T7J9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7J9"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADL44031.1"
FT                   /translation="MAKTLTITTRNASFQQWQALLTNRTKRQRSGEFLVQGVRPITVAL
FT                   EQGWEIRALLHPDRQPLSRWCRDLLDRSDARRVALAPELMRELSGKEEESPELLAVVAQ
FT                   PADDLARIPVGPAMLVVVFDRPKTPGNIGTLIRSADAFGASGVIITGHAADPYDPKAVR
FT                   ATTGSLFALPVVRVPSHRDVLDWVAAVRADGLPQVQIIGTDEHGDVDVAEHDLTGPTLL
FT                   LIGNETHGLSKGWQEASDRMVRIPIVGAASSLNAAAAGTVALYEAARQRAERR"
FT   gene            473421..475595
FT                   /locus_tag="Micau_0465"
FT   CDS_pept        473421..475595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0465"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: predicted
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44032"
FT                   /db_xref="GOA:D9T7K0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K0"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADL44032.1"
FT                   /translation="MTSPPLTKVADREGSPAEEPAGTATGREPGREATPSRFRADVAGL
FT                   RAVAVGLVLLYHAGLPFIPGGFVGVDVFFVISGFLITGQLISEIERSGRVSLTGFYARR
FT                   AKRILPAATVVLAATAVAVRLFVPRGEWQVIGGDIAAAATYVVNWRFADRAVDYLAEDV
FT                   APSPVQHFWSLAVEEQFYLLWPLLIVLAILAARRLRRANVRPVLWVGLAVLAVPSFVWS
FT                   IVETANSPERAFFVSTTRLWELAVGAAVALLAVRAARMPRSVAVVLGWLGLAAIVAAAL
FT                   LVSGKTAWPGYAAALPTLGAAAVIAAGAAAGSRGPVLVLGMRPFQWIGDLSYSLYLWHW
FT                   PMLVVAAAHFGDLSVTEGLVVALASVIPAWLTFRLVENPLRYSRKISTSPRLALSLGGN
FT                   FTLAGICAGLVLVLMGAWAAAATTTKGRYAPGAALLSTAPGTAPIGPVPERFDAITPDP
FT                   LQIRQGFMDVPDTNRDKCFQQVEGAEVLSCTYGVPNGSTTVALVGDSKMDQWLPAFQVL
FT                   AAQNDWKLLIMAKAGCAFTSAQVLKGDGSGKPYTDCIEWNRALLDRLVQERPDYVVTSQ
FT                   SASTALDSGGERATVAAMVSGVRASWKKLDSVGTKVVVLANNPHPGAAVACADKNRKRL
FT                   SACAFDREKHDQDPAYRMQRQAVAGAPKVKMIDLFDAVCPTDRCPVVFGNVLIYRGGSH
FT                   IGAAYVKTTAPHLARALSDVGVPARFTPAG"
FT   gene            475638..476222
FT                   /locus_tag="Micau_0466"
FT   CDS_pept        475638..476222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0466"
FT                   /product="Protein of unknown function DUF3592"
FT                   /note="PFAM: Protein of unknown function DUF3592; KEGG:
FT                   lhk:LHK_02883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44033"
FT                   /db_xref="GOA:D9T7K1"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K1"
FT                   /inference="protein motif:PFAM:PF12158"
FT                   /protein_id="ADL44033.1"
FT                   /translation="MRRPLWLSLAYVLLAVAGGALLWLPFHTQMALDDWGVTLRERGTP
FT                   AQATVVDQVTESGGNRSSSSRTMYFSYAVDGRTHSQEVPCFEVCRAAGTEVPIWVNPAD
FT                   PNDFVTDFGQLSGHRGRVQGVLGVVGLFALGAGVVLTLSRIRRAARPGDRAGRPGHDAA
FT                   RRDRPRRMAPTPVGDGRGYTGRGKRKRNAGR"
FT   sig_peptide     475638..475733
FT                   /locus_tag="Micau_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.739 at
FT                   residue 32"
FT   gene            complement(476262..476882)
FT                   /locus_tag="Micau_0467"
FT   CDS_pept        complement(476262..476882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0467"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: stp:Strop_3980 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44034"
FT                   /db_xref="GOA:D9T7K2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K2"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADL44034.1"
FT                   /translation="MTTREITSEAELRELIGTPMPRAAAKDRRTLHERDREWLAASPFC
FT                   LIATAGADGTCDVSPKGDPPGFALVLDDTTIAIPERPGNRRADGYRNVLANPHVGLIFL
FT                   IPGRTDTLRINGRARLISDAPWFADMEVKGHRPVLAVEVAIEQIFYHCAKAFLRSELWQ
FT                   PETWQPDVLPTRARLIKEVEAPAESLADLERHYGPAYLETLYR"
FT   gene            476972..477556
FT                   /locus_tag="Micau_0468"
FT   CDS_pept        476972..477556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44035"
FT                   /db_xref="GOA:D9T7K3"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K3"
FT                   /inference="similar to AA sequence:KEGG:Sare_4364"
FT                   /protein_id="ADL44035.1"
FT                   /translation="MPGLPPEPAGRDRFAACVRTRRMEAEMESRLKVLGHPVHPMLVMF
FT                   PVALFVTAVIFDVVDTVGGPGFLAEVAYWNITVGLIGGLLAAAAGAFDLLALPAGTRAK
FT                   RVGVTHAAANVAVILLFAAVWAVRLNADSRAAGGALVAIEVVALAILGVSAWLGGELVD
FT                   RLGVGVDPEHDLNAPSSLRPSSATQRIGDAR"
FT   gene            477553..478089
FT                   /locus_tag="Micau_0469"
FT   CDS_pept        477553..478089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0469"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: saq:Sare_4363
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44036"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K4"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADL44036.1"
FT                   /translation="MTEQGSGRGWRGRQQGWDPMGELQSLRSELSRLVGGRSGSQDVDL
FT                   AETADGWEVVVRLPGVAPEEVAVELDDRELCVRARSEAEVNADHGIPGGFTTRGFEYRV
FT                   DLPSRVDPDRIDAVMDHGLLRIRLPRATRPAPRTITVGRTGPRPGADRTPMPADPAADR
FT                   ELHHPDTALDEIDRP"
FT   gene            478097..479254
FT                   /locus_tag="Micau_0470"
FT   CDS_pept        478097..479254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0470"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   stp:Strop_3977 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44037"
FT                   /db_xref="GOA:D9T7K5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K5"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADL44037.1"
FT                   /translation="MTSPPDSRSPRRDLEPSALGPVGERVPDVERIAVLRANALGDFIF
FT                   VLPALDALRSAYPSAEIVLLGAPWHAALWRDRPGPVDRVLVVPAAPGIRDPGPGESPGD
FT                   VPAFLAAARAERFDLALQVHGGGGNSNPFVAGLGARVTAGLRAEGAPPLDRWLRYVYYQ
FT                   HEVIRYLEVAALVGAPATTITPSLAVTAADRAEAAAVLGEPTRPRVALHPGATDTRRRW
FT                   PPERFAEVARELTGDGYEVLVTGTPAEQETVDAVVAAAGVPVRPQVGTLSLGALAAAYA
FT                   DCALVVSNDTGPLHLAAAVGAPTVGVFWVGNLINGASPLRGRHRPIAAWTTHCPVCGVD
FT                   CTPGIYPHRPGDGECPHRVSFVADVPVAEVVEAARELLTPPRATR"
FT   gene            complement(479229..480101)
FT                   /locus_tag="Micau_0471"
FT   CDS_pept        complement(479229..480101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0471"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   saq:Sare_4361 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44038"
FT                   /db_xref="GOA:D9T7K6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL44038.1"
FT                   /translation="MTRPLDPGTPGRFRHHRRLDVLIPTRNRPAELAVTLSGLAAQEGV
FT                   PGFGVVVSDQSDGDPAYAHPAAATMVRALRHRGHPVLLTRRLPRRGLAEHRSYLLAQSA
FT                   ADAVLCLDDDVWLEPGALSRLVTALDELGCGFVGNAVHGLSYADDVRPETHQHYEEWTG
FT                   PPVPERIQPGTPEWHRASIHPAANLLHVTEKLDLAADEWRAYKISWIGGCVLYDRAKLV
FT                   EAGGFDFWERLPERHQGEDVAAQLAVLERHGGAGVLPSGAYHLESPTTVTERDVEAWEV
FT                   VLSESPAEV"
FT   gene            complement(480098..481936)
FT                   /locus_tag="Micau_0472"
FT   CDS_pept        complement(480098..481936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0472"
FT                   /product="rfaE bifunctional protein"
FT                   /note="KEGG: saq:Sare_4360 RfaE bifunctional protein;
FT                   TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44039"
FT                   /db_xref="GOA:D9T7K7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K7"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADL44039.1"
FT                   /translation="MAGAAAEERRLATVVASWQQRPVLVVGDAMLDEWRFAESERLCRE
FT                   APAPVLTLRRRISAAGGAANTAVNVAALGGRAALVAPVGADVAGDELHDCLDRAAVWDR
FT                   TVSQPGRPTPVKRRMLAGNQILLREDSGGPEDGLDADGVARLLTALHCATEELRAVAAG
FT                   QPLTLVVCDYGLGALPSAVRAWLIANRDRYGTVALDAHDLADWRGLNPTVVTPSFAEAT
FT                   RLLARAAAGFAHAERGAVPSGDVHLNHPAEADGPSELMVGAAPGGSGERVPGSPHPTSG
FT                   TPAAEVPAGPTGEPVPGEERVALTGDGLSVTGTGVTVSAAAGAGVDRAVLAESRLPELR
FT                   EHTGADVVAVTLDTEGAVVGGAEGEPRRSHSTPVPASHAVGAGDAYLAAMTLALAADAG
FT                   LPTAAQLAQLAATITVADTGTCVCRRQDLLAALGTGADEGGHPALVGADELAALVDEHR
FT                   QAGRSVVFTNGCFDVLHPGHVRYLTQARALGDLLIVAVNSDGSVRRLKGPDRPVNPVED
FT                   RIALLAALACVDHVVVFEEDSPARLIEAVRPDVYVKGGDYPPEMVPEAPLVRRLGGQVR
FT                   TLGYVPDRSTSAIIDRIRAHPVGDTVGDTVGEGRPA"
FT   gene            482063..482620
FT                   /locus_tag="Micau_0473"
FT   CDS_pept        482063..482620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0473"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="KEGG: rxy:Rxyl_2045 peptidase C56, PfpI; TIGRFAM:
FT                   intracellular protease, PfpI family; PFAM: ThiJ/PfpI
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44040"
FT                   /db_xref="GOA:D9T7K8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K8"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADL44040.1"
FT                   /translation="MAATLQGKRIAFLAADGVEEVEYTKPREAVENAGAQVELVSIESG
FT                   TIQAFNHLDHGKQYQVDVTTEEADAGAYDGLVLPGGVANPDFLRTDPEAVRFVKAFFDA
FT                   GKPVGVICHGPWTLVEADVVRGRTITSWPSLRTDLTNAGAKWVDQEVVTDNGLVSSRKP
FT                   DDLPAFCAKIVEEFAEGRHAAR"
FT   gene            482674..484341
FT                   /locus_tag="Micau_0474"
FT   CDS_pept        482674..484341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0474"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: sna:Snas_6232 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44041"
FT                   /db_xref="GOA:D9T7K9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7K9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADL44041.1"
FT                   /translation="MTAQAARPALPARQIRLLMFGLMTGMLLAALDQTIVGTALPTIVG
FT                   ELGGINHYSWVVTAYLLASTASTPLYGKMADLYGRRPVFLFSIGMFLLGSLLAGLSQDM
FT                   TQLIVTRGVQGLGAGGLMTLAFTIISDVVSPRERGRYQGLFGAVFGVSSVAGPLVGGYF
FT                   AENNWRWIFYINVPLAILAIVVCWHVMRLVPFERREHTVDWIGAALLVAGVSCLLLALS
FT                   WGGAEYAWGSGVIVGLFAAGAVLGVLFVAQEARTKEPILPLRLFRSATFALANGAGFVL
FT                   GLVMFGSIIFIPLYLQIVKGASPTRSGLLMLPMMAGVIVTSVLTGRAMSRIGRYKWFPV
FT                   AGAAVLVVGMLLFQQLQVATSLWLAFGYMVVIGVGLGLCMQSLILAVQNAVSVRDLGAG
FT                   TSSATFFRSLGGSFGVAILGAVLSSRLTAEMSARLPGALAQLPPEQRAAVTAGGDFSIN
FT                   DPAAILALPAPVRAAVQAAFVESLHLVFLTTGLIAVIAVLVTLAMPNLQLRGTGPQGAT
FT                   GGADPLGGKAPAPGGKPLTKESKDEAAADMEAKSQTML"
FT   gene            complement(484349..484840)
FT                   /locus_tag="Micau_0475"
FT   CDS_pept        complement(484349..484840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0475"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: saq:Sare_4359 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44042"
FT                   /db_xref="GOA:D9T7L0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L0"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL44042.1"
FT                   /translation="MSISWADSYVGQLRALAGDRTLMFVGARAVVRDNAARVLLIQRSD
FT                   NGQWALPAGAMELGESIADCAVREVREETGLRALRVSAFALYTGPDRTHTNMYGHTYQV
FT                   FTTAFRVDEWDGELARFTDETTDSGFFRPADFPHPLSSSVHETLADLDVFEQTNRLILK
FT                   "
FT   gene            484926..486575
FT                   /locus_tag="Micau_0476"
FT   CDS_pept        484926..486575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0476"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_4358 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44043"
FT                   /db_xref="GOA:D9T7L1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L1"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADL44043.1"
FT                   /translation="MRSTMMDAPLQVARILEHGSTVHGAAEVVTWTGAEPRRMTYAEVG
FT                   RAAARLAHALRDECGVTGDERVGTFMWNNNEHLVAYFAVPSMGAVLHTLNIRLFPDQVA
FT                   YIANHAQDRVVLVDSTLIPLLARVIGEMTIVAHVVVVGGGDPAPLLAAAGDRITVHHWD
FT                   ALLAGRPDHFDWPEVDERDAAALCYTSGTTGNPKGVAYSHRSIYLHSLQVCMPEGFGLG
FT                   PNDRELAIVPMFHAMSWGLPYAAFLSGASLIMPDRFLQAEPIAAMIAAERPTLAGAVPT
FT                   IWTDLLAYLDAHEVDLSSLKEVIVGGSACPPALMHAFHDRYGIDVIHAWGMTEMSPLGS
FT                   VSRAPAGATGDDAWRYRYTQGRVPAGVTARIVGPAGEPLPADGTSVGELEVRGPWVTAR
FT                   YIGDDAPEEEKFRDGWLRTGDVGTLSPDGYITLTDRAKDVIKSGGEWISSVELENALMA
FT                   HPAVLEACVVGVPDERWDERPLATVVVREGASVTAEELRDFLAGSVARWQLPERWAFID
FT                   AVPKTSVGKFDKKVVRSRYADGGLDVRELTAS"
FT   gene            complement(486756..487769)
FT                   /locus_tag="Micau_0477"
FT   CDS_pept        complement(486756..487769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0477"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   saq:Sare_4357 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44044"
FT                   /db_xref="GOA:D9T7L2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADL44044.1"
FT                   /translation="MKAIVYERSGDASVLQVVERPVPEPGPGEVLVRMAVSGVNPTDWK
FT                   ARQAWPLPAGWQIPHQDGAGVVEAVGEGVDRTLIGERVWVWEAAWQRPWGTAAEYTLVP
FT                   VRHAVPLGPASFDLGAALGIPFMTAHRCLTAGEFMPDKLHAGALSDHVVLVQGGAGAVG
FT                   NAAIQLARWADACVITTVSSPEKAQLAAAAGASFVINYREQDVVEEVRKVAPDGVHTIV
FT                   EVSAARNAAADVRMLRTGGAVCVYADDGGGEVTLPIRPLMGPNARWQFVLIYTAPKVAK
FT                   AQAVTDIAAAVAQGAIRVGEEAGLPLHRYPLAEAAAAQQAVQDSVVGKVLVSTADE"
FT   gene            complement(487860..488984)
FT                   /locus_tag="Micau_0478"
FT   CDS_pept        complement(487860..488984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0478"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   svi:Svir_26960 theronine dehydrogenase-like Zn-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44045"
FT                   /db_xref="GOA:D9T7L3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADL44045.1"
FT                   /translation="MYEGPHEVAVNEVDDPRIEDPNDVVVQVTTTAICGSDLHMYEGRT
FT                   AAEPGIVFGHENMGVIVETGPGVTSLRVGDRVSMPFNVACGFCRNCREQRTGFCLTVNP
FT                   GFAGGAYGYVSMGPYRGGQAEYLRVPFADFNCLKLPPGTEHENDYAMLADIFPTGYHGV
FT                   AMTGLRPGENLTVMGGGPVGLMAAYSAVLIGASEVFVVDRVPDRLRLAESIGATAIDFS
FT                   AGDPVEQIRDRTDGVGTDHGVDAVGYQASAPSGEEQPALVLNTLVEVVRATGAIGVVGL
FT                   YLSADPGAPDEHSARGELLFKVGKLFEKGLRIGTGQANVKTYNAYLRNLITAGRATPSF
FT                   VVSKELPLDAAPEAYQRFDRREPGYSKVVLKPAA"
FT   gene            complement(489038..489691)
FT                   /locus_tag="Micau_0479"
FT   CDS_pept        complement(489038..489691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0479"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: saq:Sare_4356 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44046"
FT                   /db_xref="GOA:D9T7L4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L4"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADL44046.1"
FT                   /translation="MVDAVLFDLDGVIVDSEPVWEEVRRAYVAEHGGVWQPDTQRRLMG
FT                   MSTAEWAEYLSGELGVDRSAEQVATEVVTEMARRYAQHVPLIDGADAVVRRIAARWPLG
FT                   LASSSPTRLIAAALDATGLAGAFGATLSTEETARGKPAPDVWLAVAQRLGVDPARCVAV
FT                   EDSSNGVRSAAAAGCRVVAVPHASYPLDPDAEALAAVLLPSIGALTPEVVAGID"
FT   gene            complement(489724..490668)
FT                   /locus_tag="Micau_0480"
FT   CDS_pept        complement(489724..490668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44047"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L5"
FT                   /inference="similar to AA sequence:KEGG:Sare_4355"
FT                   /protein_id="ADL44047.1"
FT                   /translation="MVTTGGTFARGDLPTDAEVHVAALDESGVTRQMWTLYEPVHAVTY
FT                   FHPRARAAFEAVGLRGYWRGYFAGRAAPLGPVDAPTVTAAFFSFAPAMVARALPSVWRL
FT                   ATPEETLRARLTGGVQALAEFTYELPESHLVEAADLLEEAAGRVDVAGRVLGAVNAALP
FT                   RGEYPLARLWQAATTLREHRGDGHVAALVTTGLEPAEVVAWRCRVDQSREFHQPARGWT
FT                   DEQWTAAEQRLVDKGWLTADLNPTPYATETFRVVEEATDRAAAGPWRALGAERTGRLRE
FT                   LLEPIATRCRTIIPAKAPIGLPAQRSAGAALPR"
FT   gene            complement(490712..491464)
FT                   /locus_tag="Micau_0481"
FT   CDS_pept        complement(490712..491464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0481"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   stp:Strop_3970 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44048"
FT                   /db_xref="GOA:D9T7L6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L6"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADL44048.1"
FT                   /translation="MGTLGLRAGTVCAGLGGGPPGAHPPTLQGVDVSERVENRSAGQAP
FT                   ATKAQRRLAAQLAEKKAAEARRRRQSILGAAVGVLAVVALVGGLVWLNSGDDDKTSTAG
FT                   SSASPTAPAEPTAAPAPELPAGFDPALKTKPTVQAGTGELTKLTVTTLVKGTGPAVKAG
FT                   QNITTNYVGVFYKDGKQFDASWDSGQPATFQIGVGQVIKGWDQGLVGVPVGSRVQLDLP
FT                   AELAYGNDAAGGRPAGPLRFVVDVLAAQ"
FT   gene            491528..491920
FT                   /locus_tag="Micau_0482"
FT   CDS_pept        491528..491920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0482"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: fre:Franean1_1623 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding; TIGRFAM: putative
FT                   F420-dependent enzyme; PFAM: pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44049"
FT                   /db_xref="GOA:D9T7L7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L7"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADL44049.1"
FT                   /translation="MAILSEEDLALLGEPQLAHVATIEADGTPHVTPVWVDTDGEHIVF
FT                   NTAKGRQKYLNMSRNPVVAVSVADKADDFRTLWIKGTVEFVTEGADEHIDRMAKKYLGQ
FT                   DTYPWRRPGEERVIVRVTPTEKLGRG"
FT   gene            complement(491969..492961)
FT                   /locus_tag="Micau_0483"
FT   CDS_pept        complement(491969..492961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0483"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   saq:Sare_4353 Ku family containing protein; SMART: Ku
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44050"
FT                   /db_xref="GOA:D9T7L8"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L8"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADL44050.1"
FT                   /translation="MRAIWKGAVSFGLVSIGVKVYSATEEKDIRFHQVHREDGGRIRYK
FT                   RTCSVCGEEVTYDDIAKGYDIGGGEMVILTDEDFADLPLSTSHAIDVLEFVPAEQVDPI
FT                   LYNKAYFLEPEGSATKPYVLLRDALSDSERVAIVKVALRQREQLATLRVREGVLLLNTM
FT                   LWPDEIRRPDFGFLDEDLKVRPPELAMASSLIDSMAGEFEPDAFTDDYRAALQEVIDAK
FT                   VEGREVVQPEEEEAAPAAAVDLMAALKASVERARAARGEAPSGGGAEPTPISSARSAKK
FT                   AAKKAPAKKTEPAKKTTAKKAPAKKTAAKKAEPAKKTAAKKTPAKKKTA"
FT   gene            493028..493987
FT                   /locus_tag="Micau_0484"
FT   CDS_pept        493028..493987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0484"
FT                   /product="DNA polymerase LigD, ligase domain protein"
FT                   /note="KEGG: saq:Sare_4352 DNA polymerase LigD ligase
FT                   region; TIGRFAM: DNA polymerase LigD, ligase domain
FT                   protein; PFAM: ATP dependent DNA ligase; ATP dependent DNA
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44051"
FT                   /db_xref="GOA:D9T7L9"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7L9"
FT                   /inference="protein motif:TFAM:TIGR02779"
FT                   /protein_id="ADL44051.1"
FT                   /translation="MRNYSQEVPGAPLKPMLATTGQLPAGAAWSYEFKWDGVRALADIS
FT                   RGDRHFYARSGVEITTAYPELLNLAEQVGDALLDGEVVLFTDGQPSFTALAERMHVRNP
FT                   AKAARLAATVPVTYMIFDLLRLDGVDLTARPWRERRAALESLGLGAARWAVPPVFGDGP
FT                   ATYAAAGEHGLEGVMAKRVDSLYRPGVRSLDWVKVKLEVTADFVVGGWRPGARRVGGLL
FT                   VGVPGPDGRLVYRGRVGGGIGAALERELLRELEPLRSTDSPFAAGVPREDARGAIWVTP
FT                   RIVVEVKYGQRTPDGRLRFPRILRLRPDKPPEEVDDAL"
FT   gene            493977..494885
FT                   /locus_tag="Micau_0485"
FT   CDS_pept        493977..494885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0485"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; KEGG: saq:Sare_4351 DNA polymerase LigD polymerase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44052"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M0"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ADL44052.1"
FT                   /translation="MPSERLKVEVEGRSLELSNLDKVLFPKAGFTKGEVIDYYTRIAPV
FT                   LLPHLRDRALTRIRFPNGVDGGSFFEKNAPAATPGWVRTENLPAPGSTKGRETIDYVVC
FT                   DELPTLVWLANLAALELHTPQWKIGAHPDMMVVDLDPGAPAALKQCCRVALLMRDRLAD
FT                   DGISSFPKTSGKKGMQLCCPIAGTQDAEVVSDYAKRIAQELEQAHPKLVVSKMAKNLRP
FT                   GKIFIDWSQNNAAKTTVAPYSLRAQSVPSVSTPLTWDEVEAGAAGKRPSTRPYTAGEVL
FT                   KRVEKQGDLLAPLLDGGPELP"
FT   gene            complement(494818..495900)
FT                   /locus_tag="Micau_0486"
FT   CDS_pept        complement(494818..495900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44053"
FT                   /db_xref="GOA:D9T7M1"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M1"
FT                   /inference="similar to AA sequence:KEGG:SGR_5039"
FT                   /protein_id="ADL44053.1"
FT                   /translation="MTTEPPRRRLVPAIALLLLAPWTAECSWGGFTLTGMPFVVLVLAP
FT                   MYGGAALLIRETARRFGLGWPGIALLAAAFGVIQAGLVDQSLFNPGFLDDTEFADTRAA
FT                   AEATLVPGLGFSARQAVDYVGNHVVLTVCAPIALVESYLGAGRRARPWLGRPGLTAAAL
FT                   LWLGGSLLVFADDGGRKNFLASPVQLAVATGVALALITAALLRHRHAGPPPDAPAPAGP
FT                   TPAGRPQTEAGPPRPLRPALVVAAAYVGSTIAPGWPGVVLALALAGIAAALLTRWSRRP
FT                   GWGQRHVLATGTAGLVVAAALAYTVPTYAPASPTAALVGDVAISVIVLLLVGGAWWRVT
FT                   AVRDRRRAAAPAGRPASPPA"
FT   gene            complement(495996..496370)
FT                   /locus_tag="Micau_0487"
FT   CDS_pept        complement(495996..496370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44054"
FT                   /db_xref="GOA:D9T7M2"
FT                   /db_xref="InterPro:IPR025363"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M2"
FT                   /inference="similar to AA sequence:KEGG:Sros_0284"
FT                   /protein_id="ADL44054.1"
FT                   /translation="MLTLVAYGLAIVLSLFIVLIGARFLLVPRAAAAGYGVPAAEGTGD
FT                   PAYLTIKGLRDLTYGLVGLALIAFTSADAVAWFMLVVALAPLGDTLIVLRHGGSRATAF
FT                   GIHFATAVVVLLDAALLFAL"
FT   sig_peptide     complement(496272..496370)
FT                   /locus_tag="Micau_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.497 at
FT                   residue 33"
FT   gene            496459..497037
FT                   /locus_tag="Micau_0488"
FT   CDS_pept        496459..497037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0488"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sma:SAV_5724
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44055"
FT                   /db_xref="GOA:D9T7M3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL44055.1"
FT                   /translation="MSIQARRERERADRERAIITAARDLAESEGWDAVTTRRLAAEIEY
FT                   SQPVLYSHFKGKDAIMAAVALEGCAELAVELAAARAAATDPRAAVAAIATAYAAFAERR
FT                   PALYDAIFTLPVALSFASQDTPVELVRAFAELAETLRPFTGDDDLETFTETFWSALHGQ
FT                   VTLMRGGRLRRDEHERRLALLVDRFARLG"
FT   gene            497065..497760
FT                   /locus_tag="Micau_0489"
FT   CDS_pept        497065..497760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0489"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44056"
FT                   /db_xref="GOA:D9T7M4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADL44056.1"
FT                   /translation="MATRAPAAVATDEPLLTYLDDATGERTELTGPQLGRWAARSAGLL
FT                   RDGCGLRPGDRVAVLLPPHWRTAAVLIGAWSIGLTVSFRPRALAGLPVLEPGADRPYDA
FT                   VFVTPERLDDWLEDVPEGTHRYLVGTGPGPLDEVPPGWLDWSAEVLRHPTDPPDYTAVD
FT                   PSDPATPDGTSFGAWRRLAAEIATQMNLHQGDRLVIDPTEDEQPLKWLLAPLSAGATVL
FT                   IHATPTPTP"
FT   gene            498152..499009
FT                   /locus_tag="Micau_0490"
FT   CDS_pept        498152..499009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0490"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gob:Gobs_1242 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44057"
FT                   /db_xref="GOA:D9T7M5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL44057.1"
FT                   /translation="MDGTDALVWREFGEDDLPALTGLAQACLATDGGLPLFGRTPLARA
FT                   RLLQTRTHGAWSGDDLVAAVGVGTGRTPATATGLVHPAWRGRGLGGALLDRAEKQAGDA
FT                   GLLVTTETWTAGAEELFAARGYTRTFLEWVLRHDLDALPEVAAPDGVTVEPATLGPELF
FT                   ATYRASFADRPGFVEPEAGEWLGDLRDDEDFRPELTLLARGPDGAPAGFVTVLDNWIDQ
FT                   VGVVPGWRGRRVGAYLVARVLRGLADAGADAAWLCVNDDNPAAGLYRRLGFRDFGRRAR
FT                   YLHG"
FT   gene            499002..499325
FT                   /locus_tag="Micau_0491"
FT   CDS_pept        499002..499325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rmr:Rmar_0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44058"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M6"
FT                   /inference="similar to AA sequence:KEGG:Rmar_0327"
FT                   /protein_id="ADL44058.1"
FT                   /translation="MADPTREAILRALADLWANGCPVPAPELHERLADVGLRRWRSVAR
FT                   RHRGRRLGPDDRLRDLVRGLVAAFEPDPKLVGPLVRDYECVARAIADAVTSTEPPGAVA
FT                   DAR"
FT   gene            499418..500371
FT                   /locus_tag="Micau_0492"
FT   CDS_pept        499418..500371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_4739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44059"
FT                   /db_xref="GOA:D9T7M7"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M7"
FT                   /inference="similar to AA sequence:KEGG:Snas_4739"
FT                   /protein_id="ADL44059.1"
FT                   /translation="MHRKPTIHLAVLVAAAATFLTAGGASATTAPVAASPAVAECDPGA
FT                   DTHSAARVREGATVKEPELYSTNEAKAYGVIKDSPRLANGSVTVPTIFHMISDHELSAA
FT                   EKARWNTLIAAQMTVLNDSFAGRTAADASDTPFRFSLVDTTWTVNSSWYTVVPGKSERD
FT                   MKKALYTGDSRTLNVYAANIGDGLLGWAYFPKGYNNGRDYIDGVVMLDESMPGGTAGKY
FT                   ALGDTLTHEVGHWLMLEHTFAHGCSASGDFVADTPREAAPQFNCPIGADTCTAPGLDPI
FT                   HNFMDYTQDSCMNMFTPGQADRMSDAWVAFRAGGRG"
FT   sig_peptide     499418..499501
FT                   /locus_tag="Micau_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 28"
FT   gene            500522..503428
FT                   /locus_tag="Micau_0493"
FT   CDS_pept        500522..503428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_7437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44060"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M8"
FT                   /inference="similar to AA sequence:KEGG:Sros_7437"
FT                   /protein_id="ADL44060.1"
FT                   /translation="MRARRMLAASLGIVLGAGLISVDTAPAQAYEHRTTGKSGWAYTDS
FT                   QQPRKSFVNTDGDAPVGAWTDATGTKHKSRSYFTFDISRFRGTVVHKADLVVAERSAAD
FT                   CATAQPVELWRTDPITATTSWASSPRRRELLGTVQAGGEAACPGYLAWDIMPALQKLAD
FT                   QGKQTLTVEIRVPHGSEGKLSHGRKLRPFPVINSEANHAPTVGQIGIDFPAWACGTKTE
FT                   PQPVGPRNHGLMVKGADADSNDANYRGQFAAWPVGHEDQRAEQFGYSYGGALSKLDWDM
FT                   SQYPHGTVVAWTARAYDDHDFSPWAEPCYVKVDAQRPAAPVVTSEKYPNDGLPHGGAGV
FT                   PGTFTFKANGSPDVVGYYWGRFGDAYNYIPAPAPGADVTLEYTPTSFSDSLSVRSVDSA
FT                   SNSSETVRYEFWVKSTAPEVQVTMAGIGLPSKLAVSTNVEGVTEFGYRIGAGGETRVPV
FT                   NPDGPTEIPVTFAEAGLVKVEVRSYVGSEFVGGYTENVSVRDLPTVESADFSFPEHDGV
FT                   VDRPGSFTFRPGRTAVVAYEYSFGDGNLLRVDAAADGTAVLHWTPTEPGWYALTVRSVS
FT                   ADGTVSETQEHQFNVIDTKPSVYSSTYYEYGAWGGVGMPGEFQFDTVMPDVDAYVYRLN
FT                   DGPEQVVDTDSSWTRVMLTPDRSGSNTLTVRTRFLDGSFSPTRTYTFEVSDAPVVTSSD
FT                   YPENDSAGQPGQTGRFTFNPGRPGVTEYRYVLEYSGEEQVVAAGADGRATIEITPTHSG
FT                   YTLLTVTSRTADGTVSPERRYYFRVREPRVNVSSAYDEYSPRGGVGSVGTFGVYTEISE
FT                   VTTFEYQLNGGAWQSVPKKPDAFVTDITVTMDRNGANLISVRGRTASGDQTPQTDYPFL
FT                   VGTAPLVASGTYPAGQWSGGVGVAGEFTFTQGSPGVTEFEYTVDDGQPVTVAANAAGVA
FT                   TATFTPTSAGSYTMRVRGRTADGVWTDTTSYYFLVNYS"
FT   gene            complement(503476..505266)
FT                   /locus_tag="Micau_0494"
FT   CDS_pept        complement(503476..505266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0494"
FT                   /product="helicase domain protein"
FT                   /note="manually curated; PFAM: helicase domain protein;
FT                   type III restriction protein res subunit; KEGG:
FT                   saq:Sare_4341 helicase domain-containing protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44061"
FT                   /db_xref="GOA:D9T7M9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7M9"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADL44061.1"
FT                   /translation="MVGLRQVSRGADGMPGDRVPGDEFPGSGFRAMREDAGVSGGPLIV
FT                   QSDKTLLLEVDHPDAQACRMAIAPFAELERSPEHVHTYRLTPLGLWNARAAGHDAEGVV
FT                   DSLIKYSRYPVPHGLLVDVAETMDRYGRLQLANDPVHGLVLRALDRVVLIEVAKSKKLA
FT                   GMLGAKLDDDTVAVHPSERGRLKQALLKLGWPAEDLAGYVDGEAHPIELAESGKDGGKP
FT                   WTLRSYQREAVEAFWAGGSGVVVLPCGAGKTLVGAAAMAEAKATTLILVTNTVAGRQWK
FT                   RELIARTSLTEEEIGEYSGERKEIRPVTIATYQVLTSRRGGAFTHLDLFGARDWGLVVY
FT                   DEVHLLPAPIFRFTADLQARRRLGLTATLVREDGREGDVFSLIGPKRYDAPWKDIEQQG
FT                   WIAPAECTEVRVTLTDAERLAYATAEAEERYRMAATARTKLPVVRALVDRHPSEQVLVI
FT                   GGFLDQLHQLGEYLDAPIVQGSTTNKERERLFDAFRSGEIRTLVISKVGNFSIDLPEAA
FT                   VAIQVSGTFGSRQEEAQRLGRVLRPKADGRQAHFYTVVSRDTIDTEYAAHRQRFLAEQG
FT                   YAYTIVDADDVLGPSLPTVD"
FT   gene            505372..506247
FT                   /locus_tag="Micau_0495"
FT   CDS_pept        505372..506247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0495"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding domain 1 protein; KEGG: sna:Snas_6098
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44062"
FT                   /db_xref="GOA:D9T7N0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N0"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADL44062.1"
FT                   /translation="MQRVRFLARVTALAVVVLVGVGACALDPQAEGAGGSTPGPVGLTE
FT                   GASGASASPTPEQPVTSPSAQPSRTASPKPSRSPGATKTTKPEPKPSASAGCPQGEHQR
FT                   AVETYLTRLGGFGTLTVDGEQSAADCAAIKKFQIRYGISPSSGRAGPTTYDVAKRLAAT
FT                   DTARCKAGSRLTFCVDLTRQTVWAMRGGKVVMGPTVTRTGMSGYATPAGTYSVGRKNPR
FT                   EWSNPYEVWLPYWQQFNGGIGFHETTTYLHNGAIGSHGCVNLLHRDAVRLWELGSVGTR
FT                   VVVIGRRPGT"
FT   sig_peptide     505372..505449
FT                   /locus_tag="Micau_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.835 at
FT                   residue 26"
FT   gene            506369..506605
FT                   /locus_tag="Micau_0496"
FT   CDS_pept        506369..506605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44063"
FT                   /db_xref="GOA:D9T7N1"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N1"
FT                   /inference="similar to AA sequence:KEGG:Sare_4340"
FT                   /protein_id="ADL44063.1"
FT                   /translation="MTVDQDVLPEDERTRQQEVPTAVVLAYAAAAAGVFGWFLFGLLVQ
FT                   QQGFVDSVGESAGAAFALLLAVSVIGTLRRNGE"
FT   gene            complement(506607..509069)
FT                   /locus_tag="Micau_0497"
FT   CDS_pept        complement(506607..509069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44064"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N2"
FT                   /inference="similar to AA sequence:KEGG:Sare_4339"
FT                   /protein_id="ADL44064.1"
FT                   /translation="MTTSLADHLRALPDESLAALLQLRPDLVVPVPADVSALALRAQSR
FT                   VSVARALDGLDQFTLQILDAARLTRGPEGATSTDQILAMATAGPQPPAPTAVRAAVDRL
FT                   RARFLLYGPEHDLCVAGGIDEVSPYPAGLGRPAAELDPRAAALCADPARLRRTLLSAPP
FT                   SARAVLDRLAAGPPVGTVAPGALEAPATGAEDVLPPDLVNGGAPTGSPIRWLVEHRLLV
FT                   RMSGGRNGTVELPREVGLVLRRDAGPLGPLRTSPPVVSGPPREVKSVDSAGAGQTMEVV
FT                   RHTEAMLEALTAEPAPVLRSGGVGVRDLRRLARGLGLDEPTTALLFEVAYAAGLTGEME
FT                   LTGAATTRYGGDQQILPTGGYEVWRAVSLAQRWEQLARAWMSMPRQAGLIGQRDDRDRP
FT                   ISVLSAEAERAGAPAARRAVLAVLADLPPGTAPTTDEVLELLDWRAPRRARGRETAHRE
FT                   VLAEAATLGVTGLNALTSYGRLLLAELTEADERGDDPLGLRSDAESGDASTTVRALDGL
FT                   LPAPVDHVLVQADLTVVVPGPPDPALAAELDVVAEHESAGGASVHRVTTASIRRALDAG
FT                   YTADDLHALFRRRSRTPVPQGLTYLVDDAARKHGGLRVGSAGAYVRSDDETLLSEVQAD
FT                   RRLEPLAFRRLAPTVLVTPYQVNRMLTALRDAGYAPVPEDASGATVLARPKTRRAPART
FT                   AIGRAVDPLATPKLPMPRLLGVVEQIRRGEAAARAARRAPAVVRGAPAAGGPAPVSGHG
FT                   DALAVLQQAVRDKALVWVGYVDAHGATASRLVRPVSIGAGYLRAEDDRTEMLHTFALHR
FT                   ITAAVLEE"
FT   gene            509107..509730
FT                   /locus_tag="Micau_0498"
FT   CDS_pept        509107..509730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0498"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sco:SCO4323 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44065"
FT                   /db_xref="GOA:D9T7N3"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N3"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADL44065.1"
FT                   /translation="MSPLMVGFDLDMTLVDSRPGIAAAFRALTARTGVHVDGELAVSRL
FT                   GPPLRTELAHWFPPERVEEAVTLYRELYPAYAITPTVPMPGAEAALRAVQARGGRTMVV
FT                   TAKMGRLAKLHLDHLGLPVDELAGDVFAEQKAVALREHGATLYVGDHVADMAAARAAGI
FT                   PGVAVATGPCSADELTEAGAYLVLDDLVEFPRALDRIIGLALEG"
FT   gene            509774..510145
FT                   /locus_tag="Micau_0499"
FT   CDS_pept        509774..510145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0499"
FT                   /product="Cold-shock protein DNA-binding"
FT                   /note="KEGG: saq:Sare_4338 cold-shock DNA-binding
FT                   domain-containing protein; PFAM: Cold-shock protein
FT                   DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44066"
FT                   /db_xref="GOA:D9T7N4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N4"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADL44066.1"
FT                   /translation="MKWYDAAKGYGFVTSDEGGDVFLPKGALPAGVADLKGGQRVDFSV
FT                   VDSRRGAQAMGVKLLEAPPSVAELRRRPAEELHGLVEDMIKVLEAKVQPDLRRGRFPDR
FT                   KTAQKIAQLVHAVARELEV"
FT   gene            complement(510106..510936)
FT                   /locus_tag="Micau_0500"
FT   CDS_pept        complement(510106..510936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44067"
FT                   /db_xref="GOA:D9T7N5"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N5"
FT                   /inference="similar to AA sequence:KEGG:Sare_4337"
FT                   /protein_id="ADL44067.1"
FT                   /translation="MALSLAISPCPNDTFVFDALVHGRVPGAPAVEVTYADVDVTNTAA
FT                   ERGAFDLVKVSYAALPWLLDDYHLLPCGGALGRGCGPLVLTRGDRTDLSGATVAVPGER
FT                   TTAYLLFRLWAADQAPARIEVVPFHEIMPGVAAGRYDAGLVIHEARFTYPRHGLTALVD
FT                   LGEWWEGDTGLPIPLGAILARRGAVDPVDAAAWIRESVRQAWADPEASREYVLTHAQEM
FT                   EPDVVDRHIGLYVNEFTADLGEAGFAAVEALLGRAADAGLVPQTSSSRATAWTS"
FT   gene            complement(510971..511681)
FT                   /locus_tag="Micau_0501"
FT   CDS_pept        complement(510971..511681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0501"
FT                   /product="Tetracyclin repressor domain-containing protein"
FT                   /note="PFAM: Tetracyclin repressor domain-containing
FT                   protein; regulatory protein TetR; KEGG: saq:Sare_0638 TetR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44068"
FT                   /db_xref="GOA:D9T7N6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N6"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ADL44068.1"
FT                   /translation="MAEQTETVRRTPLTRDRVLRTAVVLADRTGIESLSMRNLAQDLGV
FT                   VPMALYKHVANKDELLDGMIDIVVAEIDPPAAGDWKQSIRRRILSARQMLLRHPWASLA
FT                   IESRTTPTPAVLAYLDSTVGALRAGGFSTDLAHHVMHALGSRVLGFSQELFDTSRQAGR
FT                   SGATSADPPADLPPEAAARFPHLAAIATAASHDDDSVVGPGCDDQFEFEFALDLLLDGI
FT                   ERLHRNGWTSHRTG"
FT   gene            511799..512782
FT                   /locus_tag="Micau_0502"
FT   CDS_pept        511799..512782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0502"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   saq:Sare_0637 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44069"
FT                   /db_xref="GOA:D9T7N7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADL44069.1"
FT                   /translation="MKAIVQERYGPPETLVLADVETPAPGPGDVLVRVEAAALNAYDWH
FT                   VMRGDPRLSRLALGLARPRARIRGRDFAGRVEAVGAQVRQVRPGDTVFGDLGEADGAFA
FT                   EYVCVPEHLVAPRPANLTAAQAAALPLAGVTALQGLRDAGQVRPGHRVLINGASGGVGT
FT                   LAVQLAKALGATVTGVCRTRNVALVRSLGADHVVDYTRDDFTRDGRRHDVVFDLVGNRP
FT                   LTALRRALTPDGTLVLSGGGVYRGGSLLGPIGLLARGRLLAPVVRQRVVVLATSPGRAH
FT                   LDVLREHAEAGRLTPVVDRTHPLREVPEAVRYLETEHARAKVVITI"
FT   gene            complement(512838..513551)
FT                   /locus_tag="Micau_0503"
FT   CDS_pept        complement(512838..513551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0503"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: stp:Strop_0412 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44070"
FT                   /db_xref="GOA:D9T7N8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N8"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADL44070.1"
FT                   /translation="MTGLLVVTAVPAEAEAIRAGLTAPAAPNGTTPPDGTASPDGTAPP
FT                   DVTVLPVGVGPAVAGAATARLLALAEAAGRPYRAVVSAGIAGGFVGRVAVGGTVLADRS
FT                   VAADLGAESPAGFIPVEDLGMPPELLGGGRIVLADPGLLARLRAALPAATVGTVLTVST
FT                   VTGTAASTAALAERHPDAVAEAMEGYGVAVAAAQAGVPFAELRTVSNPIGPRDRSAWRM
FT                   REAFAALTAAAAALQ"
FT   gene            complement(513548..515164)
FT                   /locus_tag="Micau_0504"
FT   CDS_pept        complement(513548..515164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0504"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0413 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44071"
FT                   /db_xref="GOA:D9T7N9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7N9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL44071.1"
FT                   /translation="MALSSRSGRSFLGRTVGTGIRATRLLLRGSLHGGRWMTRRAGTAR
FT                   ARSAGNEVGMVRLFDLHALSCAGDTLIAIGLAGTIFFDVPLGEARNKVALYLLVTMVPF
FT                   AMLAPVVGPLLDHFRHGRRYALATTMLGRAFLAWLISDYIGGFGLYPAAFGVLALSRAY
FT                   GVARSAAVPRLLPEGLGLSQVGARASVYGTVAGALVAPIGLAAFWFGPQWPLRVASVIF
FT                   LIGMVISLRLPPKADSEPPERMPHPLRALRRRDGERPLGRGRPSGRLVIATLIGAAALR
FT                   GLYGFLLLFLAFAIKAGDLTTDFFGRDLGAQGALGLVGGALAVGTFLATALGTRLRIHR
FT                   PTALQSSGTIVVAGVAVLAALKFSLPMVALLCLVAAMMSGIAKLAVDASIQERIPERLR
FT                   ASSFAHSETALMLAFVAGGGLGLVPFTGLIGVTVAAAVAALVAVRGVLVAGKLRGEHLA
FT                   GRPLGDEELAAEQATRAEKPATTSFDDPAPTSPAPQRSGPPPDDDGLAPPGFHIYRPSS
FT                   SVGGPGGVEDTERRDPRGPVA"
FT   gene            515252..516091
FT                   /locus_tag="Micau_0505"
FT   CDS_pept        515252..516091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0505"
FT                   /product="Protein of unknown function DUF3027"
FT                   /note="PFAM: Protein of unknown function DUF3027; KEGG:
FT                   saq:Sare_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44072"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P0"
FT                   /inference="protein motif:PFAM:PF11228"
FT                   /protein_id="ADL44072.1"
FT                   /translation="MGNNGQVTRPASARAPRLDQVCAAAVEVARDAITEVEPTDIGDHL
FT                   QAVAEGDRVVTHYFECRMAGYRGWRWAVTVTRVPRSRHVTICETVLLPGPDALLAPGWL
FT                   PWQERLKPGDLGPGDLLPTPADDERLAPGYLLSDDPAVEETAWELGLGRARVLSREGRA
FT                   EAAQRWYDGDHGPDAAISAAAPAAARCGTCGFYLPLAGSLRLAFGACGNFYAPDDGRVV
FT                   SADHGCGAHSETMIEAAETSVDELPTVYDDSAVEAMTVSRAPGSVEAAEPAEPYGHP"
FT   gene            complement(516096..516359)
FT                   /locus_tag="Micau_0506"
FT   CDS_pept        complement(516096..516359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44073"
FT                   /db_xref="GOA:D9T7P1"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P1"
FT                   /inference="similar to AA sequence:KEGG:Sare_0503"
FT                   /protein_id="ADL44073.1"
FT                   /translation="MSQEQQPRPEPLDPPMVPFAVAGLIAWAVAGLVLLIFFRDWLTES
FT                   GRQNWLWTCLAGFLWGFPGLAVMMRHDANRRRRRAAEAQRAR"
FT   gene            516452..517933
FT                   /locus_tag="Micau_0507"
FT   CDS_pept        516452..517933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0507"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   stp:Strop_0416 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44074"
FT                   /db_xref="GOA:D9T7P2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P2"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADL44074.1"
FT                   /translation="MSIAPPPDHGTPPDPAHPRNAFDRFFLISARGSTLSRELRGGFAT
FT                   FFTMAYIVVLNPLILGSGKDGDGRSLAIPALAAATALVAGLMTILMGVVARFPIALAAG
FT                   LGVNALVAYEIAPQMTWADAMGLVVIEGVLIGILVLTGLRTAVFRSVPTQLKTAIGVGI
FT                   GLFLTIIGLVDAGFVRRVPDAANSTVPVGLGINGKIVSWPMLVFVVGLLITLVLVVRRV
FT                   RGAILIGILASTVLAIVVEAIANVGPSFVDGKPNPKGWALNVPELPKQIVDLPDLSLLG
FT                   QFNVLNSWSRVGWLVPLMFIFTLLITDFFDTMGTMVAIGQEGDMLDETGTPPKAKEILL
FT                   VDSIAAAAGGAASVSSNTSYIESAAGVAEGARTGVANLVTGALFLLAMFLAPLSLIVPF
FT                   EAASTALVVVGFLMMTAVRTIDWTDYEIAIPAFLTIALMPFTYSISNGIGAGVISFVLL
FT                   KVAKGKAREVHPLLYGVAVLFIVYFLRGPVESVLL"
FT   gene            518010..518444
FT                   /locus_tag="Micau_0508"
FT   CDS_pept        518010..518444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0508"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: saq:Sare_0505 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44075"
FT                   /db_xref="GOA:D9T7P3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P3"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL44075.1"
FT                   /translation="MTAKRVPPAQLAPQLRDAITRLNRRVRQARPVGDLTVTQLSALTS
FT                   LNLAGALTPRELADVERVQPPTMTKIVAKLEERGLVQRTPHPTDGRQVILAATEGGRAV
FT                   LDQFERARNEWLATRLAALTEDERETLRRAADILQGIARA"
FT   gene            518513..519799
FT                   /locus_tag="Micau_0509"
FT   CDS_pept        518513..519799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0509"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   saq:Sare_0506 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44076"
FT                   /db_xref="GOA:D9T7P4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL44076.1"
FT                   /translation="MQAKLSTMFQSLRVRNYRLFATGQLIKLIGVWMMFIAQDWLVLEL
FT                   SDNSATALGVVTALQFTPVLLLTLLSGRLADRYDKRMLLFVANAFWTVLSLAMSILVLT
FT                   GLVQLWHVFTFAALLGVANAVETPVRQAFVSELVGMPLLPNALSLNAAVFNSARIVGPA
FT                   VAGLAIAVVDVGPVFLVTALSSIAPLVNVVRMRTDELHRKDLPPVGERDQARVVDGLRY
FT                   VARRPDILLPMVLMSVIGMSLFNFQLTLAALAKTVFNTGAASFGLFSTALAAGALVGAL
FT                   AGTGRRSRPSVWLVLGAAIGCAIFGTLVGLAPAYWMVVTLLLPAGFFMIYFAQAANQRV
FT                   QLGVDASFRGRVMALWVLVFLGTNPVGAPLIGWVAETYGAGASIWAGGLISLTAALLAL
FT                   TWQLRRSGARLRMRVLPMPRFYVVSPGAK"
FT   gene            519875..520384
FT                   /locus_tag="Micau_0510"
FT   CDS_pept        519875..520384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44077"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P5"
FT                   /inference="similar to AA sequence:KEGG:Strop_0419"
FT                   /protein_id="ADL44077.1"
FT                   /translation="MEVGQGLLLALAILAVCCLPALFALLFCADEIIDRVACGWAEWRE
FT                   QRRERRTIARLDRAIEAEALTRDIDLTEFDKDGRRPLEQLATDLRRLGGHRLAAADRSV
FT                   VWHGAVIEAYDERLRAACHALGIAEHLAELDGVDREIERVRVEGLLHAAGLTLPAARAA
FT                   HHQRHR"
FT   gene            520389..520952
FT                   /locus_tag="Micau_0511"
FT   CDS_pept        520389..520952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0511"
FT                   /product="2'-5' RNA ligase"
FT                   /note="KEGG: stp:Strop_0420 2'-5' RNA ligase; TIGRFAM:
FT                   2'-5' RNA ligase; PFAM: Phosphoesterase HXTX"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44078"
FT                   /db_xref="GOA:D9T7P6"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P6"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADL44078.1"
FT                   /translation="MRLFAAIYPPAVVVADLTARMKGLRVAAARHARLADPANLHLTLA
FT                   FLGEVPDDRLPDVKHALASAARTARSPRLCLAGGGCFGEGRSTVLWVDVRGDVEALDAL
FT                   ALSIRDGLREAGLPCDDKPFRAHLTIARPGDRVPEADVRSDVHTLHDYAGPQWTAGEVL
FT                   LIRSHLGRTPRYTPVAAWALAAGA"
FT   gene            complement(521021..522007)
FT                   /locus_tag="Micau_0512"
FT   CDS_pept        complement(521021..522007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0512"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sna:Snas_1656
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44079"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADL44079.1"
FT                   /translation="MEYTNLGRTGLSVSRLCLGTMNFGPQTDEPDSFAIMDRALEHGIN
FT                   FFDTANVYGWKLGEGVTEQIVGRWFAQGGGRRDKVVLATKVYGKMGEWPNEQGLSARHI
FT                   IRACEDSLRRLQTDTIDLYQMHHISRTTPWEEIWQAMETLVAQGKVLYVGSSNFAGWHI
FT                   AQAQAAAGKRNFLGLVSEQCIYNLLTRYVELEVVPAAQHYGLGIIPWSPLHGGLLSGII
FT                   RKMAEGSAARGTTGRSADALAEHRNTIEAYEKLCADLGHDPADVALAWLLSRPGVTAPI
FT                   VGPRTMDQLDRNLGALDVRLDESTLTRLDELFPPVGNGGPGPEAWAW"
FT   gene            complement(522071..523159)
FT                   /locus_tag="Micau_0513"
FT   CDS_pept        complement(522071..523159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0513"
FT                   /product="Protein of unknown function DUF3071"
FT                   /note="PFAM: Protein of unknown function DUF3071; KEGG:
FT                   saq:Sare_0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44080"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P8"
FT                   /inference="protein motif:PFAM:PF11268"
FT                   /protein_id="ADL44080.1"
FT                   /translation="MRPVRFVALSEDGQALVLADEVGRLLALPIDERIASALHAEPGAP
FT                   PLAVVPSATDPTPSLSPRDIQARIRSGESAEDVARIAGVPVDRVLRYAGPVLQERAMLA
FT                   QHARRTRLKGAEKPTPLAEVVNGRLAQHGIDTEKISWDAYRRDDGTWRIIATWPSGKAT
FT                   AQAVWDLDKTRQNVAPHDDMAQYLCAERPTPILGQEPAPERGGHALPGPSRGEPSRGGH
FT                   GLPAASEHARPGRDPIRAGRDALLASLDRPLGGTSGRGLDTRSPAALAGQEAPRQRAVA
FT                   GGAAALLGGGQGSAFDDDSDAPKEIPAVPSLAVLRPRRTGPAAATGGAAAESTDAGGKP
FT                   RKRLPSWDDVLFGTGPAARESS"
FT   gene            complement(523351..524478)
FT                   /locus_tag="Micau_0514"
FT   CDS_pept        complement(523351..524478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0514"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="KEGG: saq:Sare_0510 phosphoserine aminotransferase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44081"
FT                   /db_xref="GOA:D9T7P9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7P9"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ADL44081.1"
FT                   /translation="MADAPTIRIPDEIRPADGRFGCGPSKVRPAAVSALSDVATSYLGT
FT                   SHRQKTVRDQVSRLRRGLAEFFSLPEGYEVVLGNGGTTAFWEVATFGLIRDRAQFASFG
FT                   EFGAKFAKSVKDAPFLGEPTVRKSDAGSAPSLVAEAGVDVYATPHNETSTGVAVPISRV
FT                   AGADEGSLLLVDATSGAGGLDVDVAQTDVYYFAPQKCFGSDGGLWLALMSPAALARATE
FT                   VKESGRYIPAFLDLVTAIDNSRLEQTYNTPALATIFLAAEQTDWMNSQGGLAWAAKRTA
FT                   ESAGIVYGWAERSSFATPFVSDPALRSNVVATIDFADEVDATAIAKALRANGIVDTEPY
FT                   RKLGRNQLRVALFPAVEPADVEALTASIDYVVERL"
FT   gene            complement(524761..525867)
FT                   /locus_tag="Micau_0515"
FT   CDS_pept        complement(524761..525867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0515"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: stp:Strop_0423 citrate synthase 2; PFAM:
FT                   Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44082"
FT                   /db_xref="GOA:D9T7Q0"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q0"
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /protein_id="ADL44082.1"
FT                   /translation="MSDFKPGLEGVVAFETEIAEPDRAGGSLRYRGVDIEDLIGQVSFG
FT                   NVWALLVDGRFGPGLPPAEPFPVPVHSGDIRVDVQSAVAMLAPYWGLNQLLDISDEQAR
FT                   EDLARVSVTALSFVAQSARGLGLPAVPQKEIDKAETIVERFMKRWRGEPDPRHVKAVDA
FT                   YFISAAEHGLNASTFTARIVASTGADAAACISSGIGALSGPLHGGAPSRVLSMLEAVER
FT                   SGDADGYVKGVLDRGERLMGFGHRVYRAEDPRARVLRRTAKELGAPRFEVAEALEKAAL
FT                   AELQARRPDRVLATNVEFWSAVVLDFAEVPAHMFTSMFTCARMGGWSAHILEQKKLQRL
FT                   VRPSATYVGHGPRKPQQVEGWDAIPHGV"
FT   gene            526111..526770
FT                   /locus_tag="Micau_0516"
FT   CDS_pept        526111..526770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0516"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   stp:Strop_0424 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerization-like"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44083"
FT                   /db_xref="GOA:D9T7Q1"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q1"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADL44083.1"
FT                   /translation="MTGDTPAPAGMRNEYAADLGLTETDLAPDWHTQFARWFADAVAHQ
FT                   LPEPNAMVLGTADDRGRPSGRTVLLKGYGPEGFVFYTNHGSRKGAEVIGNPWASLVFPW
FT                   FPMQRQVIVTGRVEQVDRAETEAYFATRPRGSQLGAWASAQSAVVPDRTALDAAYRAAA
FT                   ERFADVDPIPAPPYWGGFRVRPETVEFWQGRASRLHDRLRFRRTGDGFFVVERLAP"
FT   gene            526767..528059
FT                   /locus_tag="Micau_0517"
FT   CDS_pept        526767..528059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0517"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0425 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44084"
FT                   /db_xref="GOA:D9T7Q2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL44084.1"
FT                   /translation="MTDVTQTRRRGARRWAIDLRPLRVPAYRRVWTGNAIAMFGFQFTA
FT                   VAVPVEMFDLTGGSLWVGLLGIAGFVPLLIFGLWGGAVADARDRRRVLLVGGCVLWVST
FT                   LGLLVQSLAGARSPLLLLLLVGLQSTAFAITSPARSAILPRLVPAELVPAATTLNFTTF
FT                   TAAAVFGPLAAGLIFAAWQVGVALPIAYAADALLFTASLWATLRLPAMPPAPDPDGGVR
FT                   KAGFASIVDGFRYLATTRVLLLSFAIDLIAMILAMPRALFPELAQERFGGASAVGWLYS
FT                   SIAIGAMLGGLTSGWIGRVRRQGLALTVAVVGWGVAIALAGLAGQLWVAVVLLGVAGAA
FT                   DLVSATLRQSMLLVYAPDRMRGRLQGVNTVVVAGGPRLGDLRAGAMAAGFGTGFAMVGG
FT                   GLAAAVLAVLLVVAFPALLRYRSTTPAEDRH"
FT   gene            528076..529002
FT                   /locus_tag="Micau_0518"
FT   CDS_pept        528076..529002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0518"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: saq:Sare_0514 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44085"
FT                   /db_xref="GOA:D9T7Q3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q3"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ADL44085.1"
FT                   /translation="MGIDVQPPSGTQWTIAADGHEAVVVEVGGGLRAYRYDGVDHLDGY
FT                   AEDEVCPGSAGQVLAPWPNRVRDGVYTVGERSFQLDLTEPERRNALHGLVNWVRWQPIE
FT                   QSADSVTVGYDLPPSPGYPWALRLRARWSVGPDGLRAEHEATNVSDEPAPFGFSVHPYL
FT                   QLPKVGVDELRLHVPARRRVLVDSRLLPVAAAEVAGSEFDFTSPRPIGDLVLDTAFGDV
FT                   ERDADGGSAVVLSAPDGSSGLRIWADREFGWWQVFTGDTLGGERHRRSVAVEPMTCPPD
FT                   AFRSGKDLIMLEPGQTWRGAWGVRPEV"
FT   gene            529005..529607
FT                   /locus_tag="Micau_0519"
FT   CDS_pept        529005..529607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0519"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: stp:Strop_0427
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44086"
FT                   /db_xref="GOA:D9T7Q4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADL44086.1"
FT                   /translation="MEFADVVRRRRMVRNYDPDRPVPPEVVDRLLDHAVRAPSAGFSQG
FT                   WGFLVLEEPEDRERFWAATTPGGGGRERWLAGMRRAPLIVVPHANRDAYLDRYAEADKG
FT                   WSDRAEDRWPVPYWYVDTGFAALLMLLTAVDEGLGACFFGIPPQRIGAYREAFGVPPEL
FT                   HPIGAITVGYRAVDHRSPSLRRGRRPVQDVVRRGRWT"
FT   gene            529661..529966
FT                   /locus_tag="Micau_0520"
FT   CDS_pept        529661..529966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44087"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q5"
FT                   /inference="similar to AA sequence:KEGG:Sare_0516"
FT                   /protein_id="ADL44087.1"
FT                   /translation="MIFRAVRDGRPYPEHNLTLKQWAEIPPRPLRLDQLITTKRELALD
FT                   KLLAEDSTFYGDLFPHVVQWNGGLYLEDGLHRALRAALQQRNQIHARVLVLGDQGE"
FT   gene            529998..531158
FT                   /locus_tag="Micau_0521"
FT   CDS_pept        529998..531158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0521"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: saq:Sare_0517 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44088"
FT                   /db_xref="GOA:D9T7Q6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q6"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADL44088.1"
FT                   /translation="MTPLDLLDIDASLSDEERQIRTVVRRLVTDRVRPHIAGWYEDGQV
FT                   PARELAREFGKLGLLGMHLTGYGCAGASAVAYGLACLELEAGDSGVRSLVSVQGSLAMY
FT                   AIWRYGSEEQKQRWLPAMAAGEAIGCFGLTEPDHGSDPASMATRARRDGDDWILNGSKL
FT                   WITNAPIADVGVIWARTDDGVRGFAVPMDTPGVTAREIRHKMSLRASLTGEIALDDVRL
FT                   PADARLPEAIGLKAPLGCLTEARHGIVWGALGAARDCLETALEYATTRTQFGRPLAGFQ
FT                   LTQAKLADMAVEWNKGMLLALHLGRLADAGTLRPDQVSVGKLNNVREALAIARQCRTIL
FT                   GANGVSGEYPVMRHANNLESVLTYEGTSEIHQLVIGQRLTGLSAFA"
FT   gene            531292..532068
FT                   /locus_tag="Micau_0522"
FT   CDS_pept        531292..532068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6854 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44089"
FT                   /db_xref="GOA:D9T7Q7"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q7"
FT                   /inference="similar to AA sequence:KEGG:SGR_6854"
FT                   /protein_id="ADL44089.1"
FT                   /translation="MARDGDINEPTREFPDYPTSESLRDRAEGSPDHDREYAPGAPASG
FT                   GGPARGLLWVLGAAALAVVVLLGVQATGLLPDFRNPFAKEQTDRSQPPLLKSIRDLSRY
FT                   VAAEGNFQVVVDVQNDRRNVPDFLLNERTLFVGAGRVEAYVDFGKIADGAVVVSEDGKS
FT                   AEIKLPAPQLGETDLDMDKSYVFAEQRGLINRLNDLVAGDPNRQQQVYKLAEDRITAAA
FT                   RDSGLTARAQENTRKMLEGLLRSLGYEKVTVTYTAP"
FT   gene            complement(532150..532353)
FT                   /locus_tag="Micau_0523"
FT   CDS_pept        complement(532150..532353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0523"
FT                   /product="PspC domain protein"
FT                   /note="PFAM: PspC domain protein; KEGG: sen:SACE_7288
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44090"
FT                   /db_xref="GOA:D9T7Q8"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q8"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ADL44090.1"
FT                   /translation="MSRKLVRPRQGRMIAGVCAGLGQRFGMSAGMVRLLFLLSLLLPGT
FT                   QVIVYLILWILMPNEDRYLATR"
FT   gene            533184..534554
FT                   /locus_tag="Micau_0524"
FT   CDS_pept        533184..534554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0524"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG: saq:Sare_0518
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44091"
FT                   /db_xref="GOA:D9T7Q9"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7Q9"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ADL44091.1"
FT                   /translation="MISVFDLFSVGIGPSSSHTVGPMRAARTFVAGLKADGMLADVARV
FT                   RAELFGSLGATGHGHGSDRAVLLGLEGEVPETVDTDSVGPRVERIRTQRRLDLFGSQGV
FT                   DFDPDTDLVLHRRRSLPYHPNGMTFAAYDAAGGEVRTRTYYSVGGGFVVDEAAAGADRI
FT                   KADSTRVRHPFLTGAELLTVTSETGLSISEVMLANEVSWRSEADVRAGLLEIWRVMREC
FT                   VENGCTRDGVLPGGLKVRRRAAEMRRSLEAETGSQDPLRAMDWVTLFALAVNEENAAGG
FT                   RVVTAPTNGAAGIIPAVLHYYTRFVPGASEEGVVRFLLAAGAIGVLFKENASISGAEVG
FT                   CQGEVGSACSMAAAGLAEALGGTPEQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNA
FT                   VASIKAITAARLALRGDGVHHVSLDKVIKTMRETGADMKVKYKETARGGLAVNVIEC"
FT   gene            534621..535448
FT                   /locus_tag="Micau_0525"
FT   CDS_pept        534621..535448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0525"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: stp:Strop_0431
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44092"
FT                   /db_xref="GOA:D9T7R0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL44092.1"
FT                   /translation="MTSGVAALWSARTSLRILVRRDLAVKYQQSVLGYFWSLIEPLGMG
FT                   LIYWFVFGVLYSGATRRHLGEAAGSYPLFLITGIFAWMWASSALTEAANALTGQSRLIT
FT                   TMNLPRPIFPIGRVAGRFAEYLAGLPILAAVAAIYASQGKIRPGWSLLALPLAVAVQFV
FT                   LLVGLALLLSAGNVLMRDIERTMRLVIRLLFYATPIIYPLDLVRESGMPAWLKIGYELN
FT                   PLVGIFQLHHAVWYPDEFPDARLLTITVTGSVLVLALGWWAFHRLEPAVLKEL"
FT   gene            535449..536192
FT                   /locus_tag="Micau_0526"
FT   CDS_pept        535449..536192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0526"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: stp:Strop_0432 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44093"
FT                   /db_xref="GOA:D9T7R1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL44093.1"
FT                   /translation="MAPIIEADGLGIRFVRNRRRQLRLRELIVHRGARDPDAGRFWPLR
FT                   DLSFRVEPGETVGVVGRNGTGKSTLLRLIAGVLIPDEGSIRVHGRVAPLLELSAGFSGD
FT                   LTGRENLYLVGGLHGLSSAYLREHFDEIVSFAGEQVERAIDTSVRHYSSGMKVRLGFAV
FT                   IAHLPHPVLLVDEVTAVGDAEFRAKCYATIERLLAEGRTLVLVSHNDKDLTRFCRRGLY
FT                   LDAGRLIVDGTIDEALAAYADAAKR"
FT   gene            536189..538090
FT                   /locus_tag="Micau_0527"
FT   CDS_pept        536189..538090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0527"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   stp:Strop_0433 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44094"
FT                   /db_xref="GOA:D9T7R2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R2"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADL44094.1"
FT                   /translation="MTLAIVLAADPAAGHLTERLAAQWRRAGADDVRIAADLTELADLV
FT                   AAASGPVLVSGADLVAHTAVLKHLATSPVGPTVALVLTDPPAPGQATVREERGQVVEVG
FT                   AAEASGVFGGALRVGAADLPALAEAARRAAGGGPLGAVDRLVADLAAGGTLIFAHRVRL
FT                   LVAHRVGDEAQRVAAESAVAAVDEDRAELKLSVKERDDFFTTFFVSTWSPYVTKAAARI
FT                   GIGPTGVTMVSVAFAVAAAVLFGAGGRPALVAGAVLLYLGFVLDCVDGQLARYTRHFSA
FT                   WGGWLDTMADRFKEYVVYAGLGFGATHAGFRYGWALALAAMTLQTVRHMTDTWYGALHD
FT                   EAARRPKVVSADAGGIGGKLNAASTRVQADTGSVSYWLKRTVVFPIGERWALIAIAAAL
FT                   FGPLVALVAVLVWGTLAFAYTGGLRTLRARWMRVPVLTTVDAGLHRDDGLLVRTLPTAR
FT                   RPLLLAVLGALGAAGTLVWALLAVHGGGDLPVFVPVLALVLLLGAAQASRAPHDGSLDW
FT                   LVPAALRAAEYLFAIAVGVAGRAPAWLIFGYVLVLTLLHYDLTARLEKRQSAPPLHAAT
FT                   LGWPGRSLLLAIGLIAGYASIALATIGAYLLVVFVASVVLAWVVLPARARGGVRSPG"
FT   gene            538107..540290
FT                   /locus_tag="Micau_0528"
FT   CDS_pept        538107..540290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0528"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; glycosyl transferase family 2;
FT                   KEGG: stp:Strop_0434 CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44095"
FT                   /db_xref="GOA:D9T7R3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R3"
FT                   /inference="protein motif:PFAM:PF04464"
FT                   /protein_id="ADL44095.1"
FT                   /translation="MTLISFVVPAFKVQGYLRECLDSILGQPFGDIEVIGVDDASPDDS
FT                   GEILAEYALRDPRVRPVRLAENVGLGPARNIGLDRAVGEYVWFVDGDDWLVPGCLPHVA
FT                   DRLRDTAPDVLIVDHVRAHWNNIGTRSAMRDVFPDPPGATTFTLRDRPETLKLLHTAWN
FT                   RVVRREFLLERGLRFEPGWYEDVSFSYPALMAAGRIGVLDRICLNYRQRRTGAITKTRG
FT                   DRHFEVFAQWHRVFGLMDRWHVTGLRPAVFERMIWHYLTVLGNGARIAPELRAPFFAQM
FT                   HADYVRFLPPEGYPVPPGPEGLKHRLVAAGRWRTFSALREAHQAGETARRTARRARRRV
FT                   TPVVRRTARRARDLALGEYYRAELHRPIDPTLAVYAAYWYRGYSCNPAAIYEAARRLAP
FT                   QVRGVWIVRRDRVATLPPGVEYVVAGSREYHRVLARARWLVNNVNFPDFVRKRPGSVHV
FT                   QTHHGTPVKVMGLDQQRYPVGAMGMNFAGLLRRVDRWDYSITSNSFSTQMWERAYPADY
FT                   TTLEVGYPRNDRLALATAEDRGQVRAALGIAPDEYVVLYAPTHREHLPGWRPPFDPDRM
FT                   LDVLGPRGRLLMRSHYFHDRERHPRGPAADGVLDVSAYDRVEDLYLAADVLVTDYSSAM
FT                   FDYAVLDRPIVVYAPDWDAYRVARGVYFDLLAEPPGPVALDFPGLLDVFRSGAVDDEAA
FT                   ERARTAFRSRFCALDDGHAAERVVRRVFLGETP"
FT   gene            540448..541761
FT                   /locus_tag="Micau_0529"
FT   CDS_pept        540448..541761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0529"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: stp:Strop_0435 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44096"
FT                   /db_xref="GOA:D9T7R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL44096.1"
FT                   /translation="MATVALKDVTKVFPDGTVAVDTINLDVNDGEFMVLLGPSGCGKST
FT                   VLRMVAGLEDPSSGAIMLGGELANDLPPRDRKIAMVFQDFALYPHMTVGDNIGFPLRLS
FT                   GVEPGPRGERIQDVASALGIGDVLGRKPSQLSGGQRQRVAMGRAIVRRPGLFLMDEPLS
FT                   NLDSGLRAELRAEISGLTRELGVTTIYVTHDQAEALTMADRVAIMRKGVLQDVGTPTQV
FT                   YGRPATLYVAAFLGSPRMNLLEASVYVHLDRYVALNLGEQSLYLPWDDIRSRAVAHYHG
FT                   ERIVVGMRAEALTPVAPDTAGDVLHGRIRYLEHHGHESLAFLDIGATAIVVDEMGTPVE
FT                   QAAPGQRGLRRFNQVMQRLTGRAAESSAPAPEAGGGAGNRTSVLPDPGRHHRRPAELAV
FT                   RLAPYPQVSPGHPLAVQVRMDALHFFDERGDRIDVGWR"
FT   gene            complement(541809..542156)
FT                   /locus_tag="Micau_0530"
FT   CDS_pept        complement(541809..542156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44097"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R5"
FT                   /inference="similar to AA sequence:KEGG:Strop_0101"
FT                   /protein_id="ADL44097.1"
FT                   /translation="MISHQLGQPPDGPRPDRPRPYPLHATPHTPLRPMWCCRACGQPWP
FT                   CPMARLLLRSEYEDNRIGLSIYLCGLLYEATRDLYRLNPNDAPAPADMFARFVGWGPYR
FT                   RHRPVPPGGDC"
FT   gene            complement(542153..542422)
FT                   /locus_tag="Micau_0531"
FT   CDS_pept        complement(542153..542422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44098"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R6"
FT                   /inference="similar to AA sequence:KEGG:Sare_4867"
FT                   /protein_id="ADL44098.1"
FT                   /translation="MRLRWFRCRGASAPTLPHRVRGDNLPEWMRQPTRPLPTMGPGRVG
FT                   NLTPAQQWRANGGRWSVPEQRGNGGGHRSAPERRPGDGHHEERR"
FT   gene            542580..543380
FT                   /locus_tag="Micau_0532"
FT   CDS_pept        542580..543380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0532"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   sro:Sros_3358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44099"
FT                   /db_xref="GOA:D9T7R7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R7"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADL44099.1"
FT                   /translation="MIRVPLWELFAGELRRLRTDAGLTQEALGERVSYSASLVAAVEQC
FT                   RRAPRAEFTERCDEVLNGGGLLVRIRDALMQEALMPWFREWVSIEQEATALRSYEPLVV
FT                   PGLLQTEGYARALYEGAAQFVGEAVEQQVAARLARQAVLDGPTPPQFVVVLDHAALARP
FT                   VGGPKVMREQLEHLIEMARRPRVHLHLVPETVGAYPGLNGAFVLATPADGDDLGYLDNP
FT                   LHGTIVERTVDVNSLRQTWESIRAEAMPHGATLAAITEAAKRWS"
FT   gene            543371..543559
FT                   /locus_tag="Micau_0533"
FT   CDS_pept        543371..543559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0533"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   saq:Sare_1432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44100"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R8"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ADL44100.1"
FT                   /translation="MELTGATWRKSTRSSGNGGNCVEVADNLPGVVGVRDSKDRQGPAL
FT                   TFTPSSWAAFVAYAKRA"
FT   gene            543607..544467
FT                   /locus_tag="Micau_0534"
FT   CDS_pept        543607..544467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0534"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   kfl:Kfla_6799 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44101"
FT                   /db_xref="GOA:D9T7R9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7R9"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADL44101.1"
FT                   /translation="MEQVRRLVADQFPHLAALRIEPVAKGGWDNWTFHLGPELLVRLPS
FT                   AAEYALAVDKEHLWLPALADRLPLPIPAPLAKGEPGAGYPYPWSIYRWLDGETAAVDRI
FT                   ADPVRFALDLAGFLSALQDVDAAGGPQPGVHNWFRGGTLRTYDKKVEHALVALDGRVDA
FT                   ALVREIWARAVGARWDGVDRWFHGDIASGNLLLAHGRLAAVIDFGTCGVGDPACDLAIA
FT                   WTLLSVEGRAAFRERLSVDDATWARGRGWALWKTLSTYSRTVDDPEDAEESAEAQRVLG
FT                   EISAD"
FT   gene            complement(544480..545664)
FT                   /locus_tag="Micau_0535"
FT   CDS_pept        complement(544480..545664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_6545 uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44102"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S0"
FT                   /inference="similar to AA sequence:KEGG:Caci_6545"
FT                   /protein_id="ADL44102.1"
FT                   /translation="MTSAIRDVPERPVPATKTGEGDGMDGSQTPGPAQGQSNYPRRDQL
FT                   IALLADAVGSVTVAHPTRVAVDGPPAAGKTTLADELAAVLRARGRYVIRATVDDFLFPR
FT                   ERRYRRGEFSAQGCYVDTHDHGTLKRVLLDPLGPGGDRRFRRTAYDHATDAVLSPPLTT
FT                   APANAVLVFDGVFLLRPELLDRWELRVLVSAALDRTVERAVVRESPVSSRADVERRWRE
FT                   RYLPAQRLYFATARPAEHAHVVVHNDDPRQPIWETRTHPDGRLATMDRNRVAAWIAAYE
FT                   QAWRTPGTAALGTMFTADASYRQGPYRDPVVGLPAITRMWDSERDGPDEVFEMTSEIVA
FT                   VDGDTAVARVQVRYGDPVHQEWRDLWIMRFAEDGKCLSFEEWPFAPEKRAAAAG"
FT   gene            545696..546550
FT                   /locus_tag="Micau_0536"
FT   CDS_pept        545696..546550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbt:JTY_2278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S1"
FT                   /inference="similar to AA sequence:KEGG:JTY_2278"
FT                   /protein_id="ADL44103.1"
FT                   /translation="METKFLVEPGGLRDLADALTDRYDPIVGEDALHRLSDFLTVRAPG
FT                   RRDDRGKTVPELVGERRYRDAVHRLWPQVIAHAFEEPAPAEGFGDGDRPAGPFGPASRR
FT                   RVVPRYFRDRSELIGVLRGLVDTLFGGAAADAGKPTWCEKTPFNLFYLDFLWELVPEAT
FT                   IVHIKRHPISVLASHLAQPWAPSTVDGALAYLLPVYDRWLAWRNAADLTSRRYVEVKAE
FT                   DLAADWPGQRRALFERLGVEDAVTASTFQADKLAHRDDQFDADTRAYVERELGEIIPAM
FT                   GYE"
FT   gene            complement(546635..547159)
FT                   /locus_tag="Micau_0537"
FT   CDS_pept        complement(546635..547159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syp:SYNPCC7002_A0445 extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44104"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S2"
FT                   /inference="similar to AA sequence:KEGG:SYNPCC7002_A0445"
FT                   /protein_id="ADL44104.1"
FT                   /translation="MNRDLARGLTVAWALPEFRDGLRHLVDLDEVTVLLAALSLPDRDR
FT                   EVERSALGLLRSGLDSTEVREAVLLLLERDTVRRPLVAAAVEPLANRPGLVTAVTSATE
FT                   DPGVRHEVRAMLDSAGVRELIWRAVDDQVGDNRFGLIRRAAVLFVRHPSARRLGWALRR
FT                   HGVLRELRHRA"
FT   gene            547269..547682
FT                   /locus_tag="Micau_0538"
FT   CDS_pept        547269..547682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0538"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="KEGG: cai:Caci_8884 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44105"
FT                   /db_xref="GOA:D9T7S3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL44105.1"
FT                   /translation="MINFHVDRSSSVPAYAQLVRQVREALRIGTLRPGDQLPTVRSVVT
FT                   ACTVNPTTVLKAYRELELSGLVEARQGAGTFVSGTLGHADPHVMARLRGSLARWLGQAR
FT                   EAGLEDEDVQALLASVIAANAAPARRDNAEGAA"
FT   gene            547679..548587
FT                   /locus_tag="Micau_0539"
FT   CDS_pept        547679..548587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0539"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cai:Caci_8885 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44106"
FT                   /db_xref="GOA:D9T7S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL44106.1"
FT                   /translation="MSGEPVAVEARDLSRRYGAVWALRECSFALPANRVVALVGANGAG
FT                   KSTLLSIIAGTLAATGGTVSVHGRQVVRGGSADGGSRVAILAQDKPLYRDFTVSDMLRF
FT                   GRSTNRVWDQRRALSWLDRFAVPLDRRCGKLSGGQRAQVALAVALGSRPAVLLLDEPLA
FT                   NLDPLARVEVTGELLAEVADDDMTVMLSTHIVAELSGVGDHLLLLDAGRPVLAGDVEEL
FT                   LDSHVRLTGPRADQPPGPGTVVQAQHTGRQSTFVLRRPATPAAHAVVAPGWTAQPITLD
FT                   ELILTHLRASAAAPHEREAAA"
FT   gene            548584..549648
FT                   /locus_tag="Micau_0540"
FT   CDS_pept        548584..549648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_8886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44107"
FT                   /db_xref="GOA:D9T7S5"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S5"
FT                   /inference="similar to AA sequence:KEGG:Caci_8886"
FT                   /protein_id="ADL44107.1"
FT                   /translation="MSPVGQLSAPPNRRSDPGYAGGVRGLLWLTWRQHRWTVIGTLVLA
FT                   AVLVGWMTYLSVELTSLWHQCHETFCAEESPQGRRLGGSSGLVLTLAVLSQVVQWMPLL
FT                   IGVFVGVPVLTREHEQRTLLLAWSQDVSPQRWLWTRLALLGLFVAAVTSAVAGVSDHLE
FT                   RLQARVAPVSLFEYGPFLNTAMLPAVISLCWFAVGVALGAAIKRTLPAVFGVIVGFVGL
FT                   TYLVRWRYPTLMEPLTAHRVIGGPGVGVLRDNALVVKGGMIDYGIDGPSGAFDASGREL
FT                   TGVELQRLCPPDNGTGRTLACFVEHNLQQHLQYQPGSRIPEFHLIVAGGYLGLTALALL
FT                   VVWWIVRRTDLSAG"
FT   gene            549697..550164
FT                   /locus_tag="Micau_0541"
FT   CDS_pept        549697..550164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44108"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S6"
FT                   /inference="similar to AA sequence:KEGG:Sare_0523"
FT                   /protein_id="ADL44108.1"
FT                   /translation="MSIDSRQVAAGLLDAVPFARTLGIEFVEVAPEAEGGVRAVVRLPD
FT                   DPAHHNHVGGPHAGAMFTLGETASGAVVLAAFGQALDRAVPLAVTATIRYRKVAVGPVL
FT                   ATARLGGVPAEVLAELDAGRRPEFPVEVEVHTEDGTLTSSLTVIWTLRPNR"
FT   gene            550212..550964
FT                   /locus_tag="Micau_0542"
FT   CDS_pept        550212..550964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0542"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="KEGG: saq:Sare_0524 beta-phosphoglucomutase family
FT                   hydrolase; TIGRFAM: beta-phosphoglucomutase family
FT                   hydrolase; HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44109"
FT                   /db_xref="GOA:D9T7S7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S7"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ADL44109.1"
FT                   /translation="MLGLPAHVNACLFDLDGVLTQTAKVHNAAWAETFDAYLRRRSAET
FT                   GEPFHPFDSGPDYNRYVDGRPRADGVRTFLASRGITLPEGSPDDPPEADTVNGLGNRKN
FT                   VVLLQRIEHDGVEVYEGSVRYLEAATTAGLRRAVVSASANCAAVVHAAGLDRWLEARVD
FT                   GVVARAHGLRGKPHPDTFLEGARLLGVGPSQAAVFEDALAGVAAGRAGGFGYVVGVDRV
FT                   GQADELLAHGADVVVTDLADLLAPEPAA"
FT   gene            550961..553333
FT                   /locus_tag="Micau_0543"
FT   CDS_pept        550961..553333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0543"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="KEGG: saq:Sare_0525 kojibiose phosphorylase; PFAM:
FT                   glycoside hydrolase family 65 central catalytic; glycoside
FT                   hydrolase family 65 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44110"
FT                   /db_xref="GOA:D9T7S8"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S8"
FT                   /inference="protein motif:PRIAM:2.4.1.230"
FT                   /protein_id="ADL44110.1"
FT                   /translation="MIRERAYPVEPWHVREMQLDMDVLAQSESVFALSNGHIGLRGNLD
FT                   EGEPHGLPGTYLNSFYELRPLPYAEAGFGFPESGQTIVNVTNGKLIRLLVDDEPLDVRY
FT                   GELLAHERVLDMRAGTLQRELHWRSPAGREVKVRTTRLVSFTQRSVAAIHYEVEPVDGP
FT                   LRLILQSELVANESLPPQSRDPRVAAVLESPLQAEEELTTDDGGQLIHRTKVSGLRVAA
FT                   AMGHDVDGPERTTIESEGYEDWVRTTIGCVLKPGQTLRVVKYLTYGWSSRRSLPALRDQ
FT                   VGAALAAARLDGWDGLRRAQREYLDAFWDAADVRVEGDPEVQQAVRFGLFHVLQAGARA
FT                   ERRPISAKGLTGPGYDGHAFWDTEMFVLPVLTYTQPGAVRDALQWRYDTLAQAQERART
FT                   LNLEGAAFPWRTIEGPESSAYWPAGTAAFHIAADVADALRRYVLVTGDDALEREIGLEL
FT                   LIETARLWRSLGHHDRAGRFHIDGVTGPDEYTAVKNDNVYTNLMAQRNLRTAADCAMRY
FT                   RDQALDLGVTEEEAAAWRDAANDMHVPYDAETEVHEQVEGFTRFQEWDFEHTPPEKYPL
FT                   LLHYPYFDLYRKQVVKQADLVLAMHWRGDAFSAAEKLRNFVYYERRTVRDSSLSACTQA
FT                   VLAAEVGYLELAHRYLREAALMDLHDLNENTRDGVHMASLAGAWIALVAGFGGLRDHDG
FT                   MLSFAPRLSSRLSRLEFSLQWHGMRLRVDVRPHQTTYSLRNGGPDTVVELRHHGEPLQV
FT                   TSAQPVTVAVPPTHPRGPQPEQPQGRAPLMHLPERME"
FT   gene            complement(553376..553555)
FT                   /locus_tag="Micau_0544"
FT   CDS_pept        complement(553376..553555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44111"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7S9"
FT                   /inference="similar to AA sequence:KEGG:Sare_0526"
FT                   /protein_id="ADL44111.1"
FT                   /translation="MAKQDRSREQELTDQERRKQELKRSPDWADRASTARTSDDPRATA
FT                   PRDAGGRPSNGRQF"
FT   gene            complement(553657..554004)
FT                   /locus_tag="Micau_0545"
FT   CDS_pept        complement(553657..554004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0545"
FT                   /product="thioredoxin"
FT                   /note="KEGG: sna:Snas_6430 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44112"
FT                   /db_xref="GOA:D9T7T0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T0"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADL44112.1"
FT                   /translation="MPQDTGTGRLNPVTDDTFAATVLAADRPVVVDFWAEWCPPCRVVS
FT                   KHLAELAEEFGDALRFVTLNTDENPATARAHRIMSAPTMLVFRGGEVVGSIVGSRPKDH
FT                   LRRSFAQHVDG"
FT   gene            complement(553974..554366)
FT                   /locus_tag="Micau_0546"
FT   CDS_pept        complement(553974..554366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0546"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: fra:Francci3_0162 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44113"
FT                   /db_xref="GOA:D9T7T1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T1"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADL44113.1"
FT                   /translation="MRIGELAQRAGTSTRTLRYYEAHGLVRPNRSANGYRVYDEAELRV
FT                   VREIRSLLAIGFGLDDIRPFVACLRAGNDSGDVCPDSVAVLRRKLAEVDDYLDRLGDVR
FT                   RRLHDQLAHAIAQREETCLRTRGPAG"
FT   gene            554666..554770
FT                   /locus_tag="Micau_0547"
FT   CDS_pept        554666..554770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44114"
FT                   /db_xref="GOA:D9T7T2"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL44114.1"
FT                   /translation="MKLAGWGSAFWAVNFMIVGVGGMREGRGREREGR"
FT   gene            554767..555429
FT                   /locus_tag="Micau_0548"
FT   CDS_pept        554767..555429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0548"
FT                   /product="dienelactone hydrolase"
FT                   /note="KEGG: stp:Strop_0439 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44115"
FT                   /db_xref="GOA:D9T7T3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T3"
FT                   /inference="similar to AA sequence:KEGG:Strop_0439"
FT                   /protein_id="ADL44115.1"
FT                   /translation="MRGMREVSVPVVDGGLVGDVVVPAGAGGVVLFAHGSGSSRHSPRN
FT                   MAVGRALNERGLGTMLVDLLTADEEARDEITAELRFDIGMLAERLAGIVDWMGSDPELG
FT                   RLSIGLFGASTGAAAALVAAAARPDRAGAVVSRGGRPDLAGSSLTAVRAPTLLLVGGLD
FT                   EQVIALNEQARDALGEVAELRIVPGATHLFEEPGTLEQVADQAGTWFTTHLRQPHPA"
FT   gene            complement(555442..556593)
FT                   /locus_tag="Micau_0549"
FT   CDS_pept        complement(555442..556593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0549"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   tcu:Tcur_4624 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44116"
FT                   /db_xref="GOA:D9T7T4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T4"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADL44116.1"
FT                   /translation="MDDDAGIPGRAPTAGPRQTWAGLPWPVRTAVTWSACLLVVTAGLW
FT                   LLGQIAVLLAPLAVALAGTLFLAALLDPVLVRLRRLRVPAGLAALLSILLLLGILGGAG
FT                   VLVWNLTASQFGELSQQLDEGLQRTRDFVTSSLPVTDQQLDRLVEQIRQGLSSGAPDPV
FT                   AGARKVAEVAGAVLLALVLLFFLLKDGRSMWRWVLRRLTGPRRALTAEAGRAGWRTLGA
FT                   YSRGTMIIAAIDAIGIGLALVVLRVPLALPLALITFLGGFVPIIGATVAGAVAVLVALA
FT                   ANGPTTALLTLAAVIAVQQIEGNLLEPLVMRRQVQLHPAVILVVVTAGTLVAGVAGAFV
FT                   SVPIAAVLWRVLDTVQRHRAAERSGSDVPAPTADPGRAAEAAG"
FT   gene            556724..556906
FT                   /locus_tag="Micau_0550"
FT   CDS_pept        556724..556906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44117"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T5"
FT                   /inference="similar to AA sequence:KEGG:Sare_0528"
FT                   /protein_id="ADL44117.1"
FT                   /translation="MSDFMDKAKDFADKHDKQVDQGIEKAGDAADKRTGGKYDNQIDKG
FT                   VDMAQQRTGEGDTGR"
FT   gene            complement(557006..557617)
FT                   /locus_tag="Micau_0551"
FT   CDS_pept        complement(557006..557617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0551"
FT                   /product="Phytochelatin synthase"
FT                   /note="PFAM: Phytochelatin synthase; KEGG: saq:Sare_0529
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44118"
FT                   /db_xref="GOA:D9T7T6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007719"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T6"
FT                   /inference="protein motif:PFAM:PF05023"
FT                   /protein_id="ADL44118.1"
FT                   /translation="MNPIIRKCVLSVAGLAAAGGAVAGPAAAAHAAPVKGKGDRAADYE
FT                   YQAQPNFFYCGPASTRIALSAEGKDVSQDELAAKLGTTENGTDSAIDITRVLNEYTGGK
FT                   YRTTEIRDDVATREQVDRLRTDIRTAVDDDRPVVANILGGARDVDGVEHSYPGHYVTVV
FT                   RYEGDGDRVLIADPARPDVPTYWMDVTELANWIAGRGYSS"
FT   sig_peptide     complement(557522..557617)
FT                   /locus_tag="Micau_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.775 at
FT                   residue 32"
FT   gene            complement(557764..558177)
FT                   /locus_tag="Micau_0552"
FT   CDS_pept        complement(557764..558177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0552"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: sen:SACE_5943 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; TIGRFAM: putative
FT                   F420-dependent enzyme; PFAM: pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44119"
FT                   /db_xref="GOA:D9T7T7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T7"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADL44119.1"
FT                   /translation="MAARHRLDPSDERVARFFADRHLATLTTPRADGTPHVVPVGVTFD
FT                   PAAGLARVITSAGSAKARHVAAGGPDGVPVAVCQVDGRWWLTVEGRAVLRRDPESVAEA
FT                   ERRYAERYRTPRPNPERVVIEIAVTGLLGSLPD"
FT   gene            complement(558207..558542)
FT                   /locus_tag="Micau_0553"
FT   CDS_pept        complement(558207..558542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0553"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   sco:SCO0693 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44120"
FT                   /db_xref="GOA:D9T7T8"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T8"
FT                   /inference="protein motif:PFAM:PF06803"
FT                   /protein_id="ADL44120.1"
FT                   /translation="MSREAWVLVVLAAVLAAAMLAGAVLLAIRVVRTRRMLGALGAGGK
FT                   VAFYGALIYTILPVDLLPDPIYLDDMGVLAGALFYLGRLVAKHRAEQRAAGESPVATLP
FT                   PGAAPRR"
FT   sig_peptide     complement(558471..558542)
FT                   /locus_tag="Micau_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.623 at
FT                   residue 24"
FT   gene            complement(558662..559495)
FT                   /locus_tag="Micau_0554"
FT   CDS_pept        complement(558662..559495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_2390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44121"
FT                   /db_xref="GOA:D9T7T9"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7T9"
FT                   /inference="similar to AA sequence:KEGG:Tcur_2390"
FT                   /protein_id="ADL44121.1"
FT                   /translation="MQTVFSSVLPDMPAAAVIWLVLLAVAATVVAALIVRPSRFRSELV
FT                   DRISDAARPSSIERAERARVRDQERIRYADEVAVAASRATATAERSRAEWLTAQEEAEA
FT                   AWQAYQAAEEDVRRLTAAAALPLPRTARTPAEYADRERWLHRAAMDAQWRDEITVRQLS
FT                   DILGGNGWDPSRHPVEQELLLRRLVRDNMAARHRAAAQREQAAWQTAELAAAAAQSLRD
FT                   EAFAALHPVAEPQTELSIVGFAGPEATRELPTGTASPEVTRELPPVARGRAAVAA"
FT   sig_peptide     complement(559400..559495)
FT                   /locus_tag="Micau_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.655 at
FT                   residue 32"
FT   gene            complement(559654..560061)
FT                   /locus_tag="Micau_0555"
FT   CDS_pept        complement(559654..560061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK10816 GK10816 gene product from
FT                   transcript GK10816-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44122"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U0"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK10816"
FT                   /protein_id="ADL44122.1"
FT                   /translation="MLPVAFAPSTWTATLRRIARTAVAGLVLIAGLQGITAAPAHAAAA
FT                   SHATVASHAVASHVAAIEHVATRQAVTAGAAELTAADATTAALRTTGPGTRPAGTEGLS
FT                   ADSAGRVPGVEVVAAADPGRAHIARRGPPRA"
FT   sig_peptide     complement(559933..560061)
FT                   /locus_tag="Micau_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 43"
FT   gene            complement(560221..561507)
FT                   /locus_tag="Micau_0556"
FT   CDS_pept        complement(560221..561507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1087 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44123"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U1"
FT                   /inference="similar to AA sequence:KEGG:SACE_1087"
FT                   /protein_id="ADL44123.1"
FT                   /translation="MSEYTRRYEHVSHEELYQGVNAGDPKQIEALSAQWTSLKGTLDDL
FT                   GRDLTADLEALAKTWTGDAAREFHRRLDMVVRYSGNLAEGMTGIRQGLDMMSSELRAAQ
FT                   SKAESPEKTDDNDKLLSGAGKGFLIGGAPGAVIGGIVGHQQDKAEQEKAHQRMVQVVAK
FT                   LAEGYDFSAYGRIVVPDPPETELPGHTGNGDPTLQNGPSVKTPSSGPSLGSFGPGANAT
FT                   ATTSGVHHTAPTGGTPGEGTPGAGTPGGQPGAGAPGSVPTGGTVDPTGTSLAGAAPLTS
FT                   TAGGPTIGGGPGFGPGGAGPTTMSAGGPGGGLYGAPGVLSTGSLAGTGANSASSARFGG
FT                   MSGAENRSAAGTGRLTSGRGLVVDAGSKSAERTGGATGRPAMAGRSGVLGGRGGHGDDE
FT                   SDGRLTWLTEDEMVWGDGDAAPPPVLGGN"
FT   gene            complement(561500..561871)
FT                   /locus_tag="Micau_0557"
FT   CDS_pept        complement(561500..561871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_0395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44124"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U2"
FT                   /inference="similar to AA sequence:KEGG:Snas_0395"
FT                   /protein_id="ADL44124.1"
FT                   /translation="MTGRTTVDVLSLEDFHQRLERRLHEAESVLRKLNTQMQCRPPALG
FT                   TFTDATDNARRYSETHQSYVNHVDRLRRAILAAREATHKIMTNYKTAEARNAAAAADIA
FT                   AALSGLNEAMKQPKEDPRV"
FT   gene            complement(561988..563457)
FT                   /locus_tag="Micau_0558"
FT   CDS_pept        complement(561988..563457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0558"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   sna:Snas_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44125"
FT                   /db_xref="GOA:D9T7U3"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U3"
FT                   /inference="protein motif:PFAM:PF05108"
FT                   /protein_id="ADL44125.1"
FT                   /translation="MRTRRDQVQAYRFVTRRIVSALLSGDPETNDLPMRRLGMAVFGSV
FT                   IAAAVVLGGVGAYGQLTSNSAPLEPNTLVIERETGATYYFGEDKVLRPTLNYASARLIV
FT                   NDAAAQPRTMSQASIKDRPRGRLVGIVGAPDDLPDRKSLVGLPWSVCDVPDPNDPQRST
FT                   THLVIDRALPGGTALTDRAVVVRTGDARYLLTGGSRLRVAGDEQALVALKMAGATNLTV
FT                   GQQLLNAVPAGPVLRKPAIAGDGGASGLTVADRPARIGQVYQAAGQYYVLTRQGLATVR
FT                   EVTALLLLGGGGEVTQITPDEAGRLLTDQRLDADGLPARLPTLHEVRPGRTVLCATYRP
FT                   GPAGQPPTTTLEVFDSPPAELTSATAMPARQGARDAVRTAESVLLPGGKGVLVQATAGE
FT                   SGKAAAGSTVYLITAQGIRYPLGTAGGDAKSALGYGDVTPLAVPASLLALVPTGPTLSR
FT                   EDAMTYFDASTPPGATATPSAGGAEAQVQGG"
FT   gene            563620..564792
FT                   /locus_tag="Micau_0559"
FT   CDS_pept        563620..564792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0559"
FT                   /product="Protein of unknown function DUF2984"
FT                   /note="PFAM: Protein of unknown function DUF2984; KEGG:
FT                   sna:Snas_5490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44126"
FT                   /db_xref="GOA:D9T7U4"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U4"
FT                   /inference="protein motif:PFAM:PF11203"
FT                   /protein_id="ADL44126.1"
FT                   /translation="MTQLQAPPGRTATTPAVPPDRPVTPADKRRRGRLGPVVVGQLVVV
FT                   ECAALAVWFATAGPAWLLAVVAVLALLAVAAAFARRGGRWWYEDLMLRRRLRRRRDRAR
FT                   GAAPGGDPRLAALAPELTVVELTERGTRLGIGQDDRGWFAALALTGRPGAPAGSIEAAV
FT                   VDRVLAVLADFSGPVTQTQVVSHTLVWYPAPGAPPSAYRTVWVALRLSVSDARAEAVSR
FT                   GGGLRGVHRTVAAGVGRLGKALNAAGLGHRVLDRNELHAAVVSGAGLDLAPESPVETWT
FT                   SLRGGGWTQRCLALRVRPNGSLGALVDAVTATSAPSHTVAAVVLPGGRRVPPLLRVAAM
FT                   DGHAEALVKAVREMARRAGVPARPLDGQHGPGVYATAPVGTAMGTVTVEG"
FT   gene            complement(564776..566173)
FT                   /locus_tag="Micau_0560"
FT   CDS_pept        complement(564776..566173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0560"
FT                   /product="secretion protein snm4"
FT                   /note="KEGG: sna:Snas_0678 secretion protein snm4; TIGRFAM:
FT                   secretion protein snm4; PFAM: protein of unknown function
FT                   DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44127"
FT                   /db_xref="GOA:D9T7U5"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U5"
FT                   /inference="protein motif:TFAM:TIGR02958"
FT                   /protein_id="ADL44127.1"
FT                   /translation="MATKTATGGLSRITIVAPRTRMDLALPSDVPLADLLPTLLRYAGE
FT                   DLADEGVRHGGWALSRLGGQPFDGGRTAAQLGVRDGEVLYFNPRAATAPEIVFDDVVDA
FT                   VATSTTQRAGAWQVGTTRVFAVLLAASALAAGAVATLLTGPPQLPGAAAAFVVAVALLV
FT                   GAAVLSRAAGDSRTGAVLALVGIGYAGAGGLLVLAGERTLGELAGPHVLLAGTAVVVFG
FT                   AIAALAVGDRLPLFLGAVGVGAAVGLGAVLSLAFDIGAAAAAAVVSTVAFGALPALPML
FT                   AYRLARLPVPSIPTGPDDLKTDTESVDGPSVLRNSERADAFLTGLLWTVSLLVLGGEVV
FT                   LAENGRLPAVLLCLVLALLSLLRARPFLSRAQRTPVLLSGTVGLGLVAAATFAAGSLAV
FT                   RLGLILGGLAVLAVISLVYGLTVAGKRISPVWGRTLDIVEILLIIALVPLAVWVCGAYG
FT                   WIVNLRP"
FT   gene            566343..570308
FT                   /locus_tag="Micau_0561"
FT   CDS_pept        566343..570308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0561"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="KEGG: sna:Snas_0407 cell division FtsK/SpoIIIE;
FT                   PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44128"
FT                   /db_xref="GOA:D9T7U6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U6"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADL44128.1"
FT                   /translation="MSTVVFRRLPRQPGPALPRGEVLLESPPELPEPQAKGMGQVLMIL
FT                   PMLCGVGAMAFLYAGRGGGMMTYVAGGLFGVSMLGMAIGTLGNGGNDKAELNAQRRDYM
FT                   RYLAQMRKRTRRAAEQQRAAMTWRHPEPDALWSIAASRRLWERRITEDDFGEVRIALGP
FT                   QRLAVEIVPPETKPVEDLEPMSAIALRRFVRAHSSVPDLPTALSLRAFSRIALRGDREP
FT                   VLDLTRAALGQLVTFHAPEDLLVVVVAAPDRQAAWDWVKWLPHAQHPGRTDAAGARRMV
FT                   FAALDEAETALAQDLGGRPRFSPEAKPLTTAPHVVVVLDGGEVSATCALTGPGLLGTTV
FT                   FDLSGAVPRDAGRWLLCLDAGDGTGLDLVRGTATSRLGRPDRLSLSAAEGLARQIAPFR
FT                   LSQQQGASTEEPLARSMELPDLLGVGDAATVDTRQTWRPRSHRDRLRIPLGLGPDGNVV
FT                   ELDFKESAHEGMGPHGLVIGATGSGKSELLRTVVAALAVTHSSEELNFVLVDFKGGATF
FT                   ASLDALPHTSAVITNLSDELPLVDRMRDALAGEMNRRQEVLRAAGNYVSRYDYEKARAA
FT                   GEPLEPMPSLLIICDEFSELLAAKPDFIDLFVMIGRLGRSLGVHLLLASQRLEEGKLRG
FT                   LDTHLSYRIGLRTFSAVESRIVLGVPDAYELPSAPGHGYLKTDTATMLRFRAAYVSGPY
FT                   RAPGQVQRSTRAQVQRRIVPYGIDYVPVPAAPSPAEAAPEPEQSGDGKAVAMLDVLIDQ
FT                   LKGRGKPAHQVWLPPLAEPSGLAELLPKLSVHPTYGLTTADWPGRGRLAVPVGIVDRPY
FT                   EQRRDPMMVDLAGAGGNVVIVGASLSGKSTMLRSMLASLALTHTPREVQFFCLDFGGGA
FT                   LRSLDGLPHTSGVAGRRDVEAVRRTVAEVVAVIDERENRFTQHGIDSVASYRRRRAAGE
FT                   FADDPFGDVFLVVDGWNTLRQEYEELEQTITNLANRGLGFGVHVVITAVRWAEIRINMR
FT                   DLLGTKLELRLGDPSESEIDRRAAQNVPVGAPGRGLTRDKLHFLTAISRIDGKRDIEDL
FT                   TEASVALAGHVAANWPGQPAPKVRLLPRKLAVTELAKVVDRSAPGIPIGVNESALAPVY
FT                   LDLAGEPHLTVFGDAECGKTNLLRLIARGIAERYTPAQARLVIADYRRGLLGAVEGDHL
FT                   LDYAPSNQVFSQGLGSIRSALQNRLPGPDVTTAQLRDRSWWKGPDLYILVDDYDLVASG
FT                   GSNPLSALHELLPQARDIGLHLIITRRVGGVARALYEPVLQRLRELDSPGLLMSGSREE
FT                   GAVFGNLRPTPQPPGRGTLVRRRDGQQLIQTAWTEPA"
FT   gene            570383..570793
FT                   /locus_tag="Micau_0562"
FT   CDS_pept        570383..570793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0562"
FT                   /product="uncharacterized protein family UPF0133"
FT                   /note="PFAM: uncharacterized protein family UPF0133; KEGG:
FT                   sro:Sros_8082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44129"
FT                   /db_xref="GOA:D9T7U7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U7"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADL44129.1"
FT                   /translation="MSSPSGFGAAMEGLLRQAQEQQRRLADLQRQRAELRVTGESPDGL
FT                   VRVTVDGGMKVGDIELNARAMRLDSFSLSEAMQAAIDAAYAAFEERQREMLSEMLGDSE
FT                   MVRRAQDGTLTPEDWFRQFGVDVSDPTRNLRR"
FT   gene            570812..571105
FT                   /locus_tag="Micau_0563"
FT   CDS_pept        570812..571105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cag:Cagg_1993 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44130"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U8"
FT                   /inference="similar to AA sequence:KEGG:Cagg_1993"
FT                   /protein_id="ADL44130.1"
FT                   /translation="MPNTVDVDAIRKAGRMLDAPDGPIQYLRNVETLLGEVKLPSGALS
FT                   WFGTGAVERHNAAVDGHLDNVRTGVEHLRKAAAQLEQSAKNWERSDQPWVVK"
FT   gene            571137..571865
FT                   /locus_tag="Micau_0564"
FT   CDS_pept        571137..571865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44131"
FT                   /db_xref="GOA:D9T7U9"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7U9"
FT                   /inference="similar to AA sequence:KEGG:Sros_8084"
FT                   /protein_id="ADL44131.1"
FT                   /translation="MPPEILIANASGTVTGTVTVAETTAPVRSAAAVAKGNLVWIVASA
FT                   ALIGAILYLESFDNQQVNESIKKWDEAARLLGADQFGAAMAAVPPDAAEWDFDDRDAFD
FT                   LFLRKLGAEINSLAEAFAANRDTLTAARDAYNDAISGLAQALMPILVAVIASIALQFFP
FT                   ATTALAQAIGIVGLTATAAVLVLVFGEISALLHALLAAFHTDNRFTFTADSRPGWAPTG
FT                   SDPDIKDIKIDWVRDAKFYG"
FT   gene            571878..572147
FT                   /locus_tag="Micau_0565"
FT   CDS_pept        571878..572147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pas:Pars_1580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44132"
FT                   /db_xref="GOA:D9T7V0"
FT                   /db_xref="UniProtKB/TrEMBL:D9T7V0"
FT                   /inference="similar to AA sequence:KEGG:Pars_1580"
FT                   /protein_id="ADL44132.1"
FT                   /translation="METLLFSLLLYVLLTIPVFVVLMLFAALTRSARLRRAAEVVSLST
FT                   CAALLVLSFQRAFEKPMLWAVVVLLVAVLVFGVSTIVKSSRERS"
FT   sig_peptide     571878..571958
FT                   /locus_tag="Micau_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.833 at
FT                   residue 27"
FT   gene            572362..572670
FT                   /locus_tag="Micau_0566"
FT   CDS_pept        572362..572670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjk:jk1748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44133"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8K6"
FT                   /inference="similar to AA sequence:KEGG:jk1748"
FT                   /protein_id="ADL44133.1"
FT                   /translation="MAFEVSAATLHTAASDVRSTRSDVDGELKKLWNVVDDLAMAWKGQ
FT                   ASTGFQSLMTRWNEDTTKLLTAMDNIADLLDKSGTTHQVNDEEQQQMLDKFHAALNP"
FT   gene            572699..572980
FT                   /locus_tag="Micau_0567"
FT   CDS_pept        572699..572980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44134"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8K7"
FT                   /inference="similar to AA sequence:KEGG:Snas_0408"
FT                   /protein_id="ADL44134.1"
FT                   /translation="MSIKVDYAVLESSNQQMQAISRTIDEKLDTLRAMLTKLEWEGQDR
FT                   AAYQQHQAQWDAAVRDINKVLNEIGGAVGIARENYMTTEMSNSKVWGN"
FT   gene            complement(573042..574196)
FT                   /locus_tag="Micau_0568"
FT   CDS_pept        complement(573042..574196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0568"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: sna:Snas_0411 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44135"
FT                   /db_xref="GOA:D9T8K8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8K8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADL44135.1"
FT                   /translation="MTALLGGALAVPAPAQAAPKCGPAGGPAPTEVPWALSRLDPAAAW
FT                   RIGKGAGVTVAVIDSGVSPAHPLLRGRVLPGEDFNQLVRLKGQCDLVGHGTMVAGIIAG
FT                   REGTGSPYTGIAPEAKILPLRVLAENKENFDPDVPAEIGKAIRWAVDHDADVINLSLVT
FT                   LDDPALKSAVQYALSKDVVVVASAGNRQENREDRPAYPAAYDGVVAVAGIDEQGGHVGS
FT                   SVSGDYVDIAGPGLNIVGPAPQGSGYRAEPQGGTSFATAYVSGVAALVRAAHPDISADE
FT                   VAYRLTRTADNPPDGHNAEVGFGMVNPYRAVTSLLGTREDPPLGAMPPPAPPADPLAWQ
FT                   RTVAIWVAVVGALLAGVLLTLRPILVRGRRRGWRPGRRDVPQDA"
FT   sig_peptide     complement(574143..574196)
FT                   /locus_tag="Micau_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.876 at
FT                   residue 18"
FT   gene            complement(574337..574678)
FT                   /locus_tag="Micau_0569"
FT   CDS_pept        complement(574337..574678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_2947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44136"
FT                   /db_xref="GOA:D9T8K9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8K9"
FT                   /inference="similar to AA sequence:KEGG:Strop_2947"
FT                   /protein_id="ADL44136.1"
FT                   /translation="MTTMATTPVEDGSRRNWTFLTNHGHVLLAIARNPTARLRDVADEV
FT                   GVTERAAQAIVADLEAGGYLRRTRVGRRNEYTINPKGRFRHPAEADQQVGALLALFAAE
FT                   SAGDAAADG"
FT   gene            574846..575499
FT                   /locus_tag="Micau_0570"
FT   CDS_pept        574846..575499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0570"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: saq:Sare_0530
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44137"
FT                   /db_xref="GOA:D9T8L0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L0"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ADL44137.1"
FT                   /translation="MTPSTPEQALTELRAGNHRFVTGVPQHPNQDAGHRAAVADGQHPF
FT                   AVIVGCSDSRLAAEIIFDRGLGDLFVVRTAGHTAGPEVLGSVEYAVTVLGTPLVVVLGH
FT                   DSCGAVQAAREGVRTGAAPAGHLGAVVDAVSPSLLRAARQGVEDLDGIVDVHIAQTVET
FT                   LLARSAVLAERVAAGRCTVVGMSYRLAGGEVRTVAQAPAPLPAPAAPADPALAG"
FT   gene            complement(575559..576587)
FT                   /locus_tag="Micau_0571"
FT   CDS_pept        complement(575559..576587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44138"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L1"
FT                   /inference="similar to AA sequence:KEGG:Sare_0531"
FT                   /protein_id="ADL44138.1"
FT                   /translation="MTAPLRRWLTPVVAVLASLAVLAGPTPATAAPTAAAPGNPSGHEE
FT                   DGEPPLITEAIDAANRAFLQAKAKLAKSQDRQRRLAAEVKTAQAELEALSPQVNQLAAQ
FT                   SYRTGRMGAMAMLLESNSPDSFVRRVNALDELNLLNAQRLAAINAVKTRAEQAKIALDA
FT                   EVREQEKQKNAMEREKVQAERALKLVGGLGFTGGLVSATSPVAKIGPGRTADGGWKAES
FT                   CSEDDPTTSGCVTPRTLHAYKEVRRAGFKRFVGCYRPGGPWEHPKGKACDWSLQNSGFA
FT                   PWHNNDTRRYGNEVAAFLIRNADRLGIYYVIWNRQIWFPATGWSSYSGPSNHTDHVHMS
FT                   ML"
FT   sig_peptide     complement(576495..576587)
FT                   /locus_tag="Micau_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 31"
FT   gene            complement(576877..578151)
FT                   /locus_tag="Micau_0572"
FT   CDS_pept        complement(576877..578151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0572"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: saq:Sare_0532
FT                   YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44139"
FT                   /db_xref="GOA:D9T8L2"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L2"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADL44139.1"
FT                   /translation="MGADHTRPAPAAPPGVRRLLVAVVVPLFALTVIAALVLWPGQDRE
FT                   PVGGADVPRYHGTVTRVVTEPCPPTPEAPEGGGGPCGTVTVTAEQGPDAGRQVETPIPA
FT                   GPGAPRVAVGDEVVLVELTDPADPAVKSYNIAEHQRGTPLIWLMVLFAAAIVAFGRWRG
FT                   LAALGGLVASFAILLGFVLPGIGAGQPPLLVAIVGAALIMFVVLYLTHGITAQTSVAVL
FT                   GTLGSLVVTGVLGLLATSATHLTGFGSEDATTLSMFQGDVDLHGLLLAGIIIGSLGVLD
FT                   DVTVTQAATVTELAHANPGLSRRQLYRAATRVGRAHIASTVNTIVLAYAGASLPLLLLL
FT                   VADSRPVSEILTSEFLAQEIVRSAVATLGLIAAVPLTTGLAAIVTTAGRRSRGAEPAPP
FT                   AARPPAGRDDALEALGGGKSTEAAW"
FT   gene            complement(578314..578523)
FT                   /locus_tag="Micau_0573"
FT   CDS_pept        complement(578314..578523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0573"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: nml:Namu_1752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44140"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L3"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADL44140.1"
FT                   /translation="MMWQSPMMGWMWIWSLLVLGVLAGLVWAAVRWTGPQYLGPTTARR
FT                   ILDERYARGEIDEDEYRRRRAGLA"
FT   sig_peptide     complement(578437..578523)
FT                   /locus_tag="Micau_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.985 at
FT                   residue 29"
FT   gene            complement(578650..578949)
FT                   /locus_tag="Micau_0574"
FT   CDS_pept        complement(578650..578949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0574"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   saq:Sare_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44141"
FT                   /db_xref="GOA:D9T8L4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L4"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADL44141.1"
FT                   /translation="MTAPSSPTRGYTASKDQLLARLRRIEGQVRGIEKMVEDDRYCIDV
FT                   LTQISAIQAALDKVGLGLLDGHARHCMHEGAAEGRADEMATEMMAAVGRLMKRG"
FT   gene            579030..579236
FT                   /locus_tag="Micau_0575"
FT   CDS_pept        579030..579236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0575"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: saq:Sare_0534 copper ion binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44142"
FT                   /db_xref="GOA:D9T8L5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L5"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ADL44142.1"
FT                   /translation="METTYQVNGMTCGHCVNSVSTELSALPGVTDVQVDLAGGRVTVTS
FT                   QNPLDVDTVRAAVDEAGYDLVGV"
FT   gene            579273..580253
FT                   /locus_tag="Micau_0576"
FT   CDS_pept        579273..580253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44143"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L6"
FT                   /inference="similar to AA sequence:KEGG:Sros_3700"
FT                   /protein_id="ADL44143.1"
FT                   /translation="MNTATKLSGFALGLVAVFGAAYGIGNLTDPVAPAAETRHDDTDSD
FT                   HGAGDTGHGDESQAGGASAHLPGGLLVSERGYTFQPAGAPAGQFAFRITGPDGAPVTRF
FT                   EVAHDKRMHLIVARRDLSGFRHVHPEMTGDGTWRVASPLGGPGVWRAFADFTPEGGEPL
FT                   TLGLDVTVPGELTARPLPAPATSTTVDGYTVTLTGTPEPGRTSRLTLSVSRDGRPVTDL
FT                   APYLGAYGHLVALRQGDLAYLHVHPEGTPGDGRTPAGPAITFAAEVPSAGAYRLYLDFR
FT                   HGDAVHTAEFTVLAGDQTAPVPTAPAPTTAPTPDAGHGTPGHGHS"
FT   sig_peptide     579273..579344
FT                   /locus_tag="Micau_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.597 at
FT                   residue 24"
FT   gene            580271..582526
FT                   /locus_tag="Micau_0577"
FT   CDS_pept        580271..582526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0577"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: stp:Strop_0448 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: copper-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; heavy metal translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44144"
FT                   /db_xref="GOA:D9T8L7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L7"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADL44144.1"
FT                   /translation="MTATGKALPTAPNLIELAIGGMTCASCAARIEKKLNRMDGVEATV
FT                   NYATEKATVRYADDIAPADLIATVEKTGYTAVVPPPPEQAEAAAAGEPVDELRTARTRL
FT                   WVSAVLTLPVIVLAMVPAWQFDYWQWASLTLAAPVVVWGGLPFHRAALINLRHGAATMD
FT                   TLVSLGTLAAFGWSLWALFLGDAGMPGMKHPFSLDITRGDGAGNIYLEAAAGVTVFILA
FT                   GRYFEARSKRTAGSALRALLELGAKDVAVLRDGQETRIPVGRLAVGDRFVVRPGEKIAT
FT                   DGVVEEGTSAVDASMLTGESVPVEVGQGDAVVGATVNAGGRLVVRATRVGGDTQLAQMA
FT                   RLVEQAQTGKAAVQRLADRISGVFVPIVIALAAGTLGWWLGTGSGPTAAFTAAVAVLII
FT                   ACPCALGLATPTALLVGTGRGAQLGVLIKGPEVLESTRRVDTVVLDKTGTVTTGRMALA
FT                   EVLPADGEDADELLRVAGALEAASEHPIARAVAEAAAEAGPLPPVGEFANAEGLGVTGT
FT                   VDGRTVVVGRARLLRERGLDVPEEVERAATGAEAAGRTAILAGWDGRARGVLAVADAVK
FT                   PTSRAAVARLRELGLKPVLLTGDNTTVAKAVAAEVGIDEVIAEVLPADKVDVVERLQRE
FT                   GRVVAMVGDGVNDAAALARADLGLAMGTGTDAAIEAADLTLVRGDLMAAADAIRLSRRT
FT                   LAIIKGNLFWAFAYNVAALPLAAAGLLNPMLAGAAMAFSSVFVVGNSLRLRSFRPIG"
FT   gene            582594..582767
FT                   /locus_tag="Micau_0578"
FT   CDS_pept        582594..582767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0578"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: nml:Namu_0307 CsbD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44145"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L8"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ADL44145.1"
FT                   /translation="MGLDDKIDNASQDTAGKVKEGVGRATDNERLEAEGRNDQAGAKLK
FT                   QAGEKIKDAFKS"
FT   gene            582943..583359
FT                   /locus_tag="Micau_0579"
FT   CDS_pept        582943..583359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0579"
FT                   /product="uncharacterized protein family UPF0133"
FT                   /note="PFAM: uncharacterized protein family UPF0133; KEGG:
FT                   tcu:Tcur_0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44146"
FT                   /db_xref="GOA:D9T8L9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8L9"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADL44146.1"
FT                   /translation="MADPADPSGFGRVLSETMAALQRQTDAGEQVAPPEGVGEAADGLI
FT                   RVTAGPPGQVTGLTLDPRVMRMASEALAEEIEAAVNAALADLREQAATAPGEVDLGSLG
FT                   EQLRRIQADAGRQFSMFTDALMQAQDRLARQDGR"
FT   gene            583359..583682
FT                   /locus_tag="Micau_0580"
FT   CDS_pept        583359..583682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44147"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M0"
FT                   /inference="similar to AA sequence:KEGG:Tcur_0482"
FT                   /protein_id="ADL44147.1"
FT                   /translation="MPVEVDPERLGASGAALDGVATRFGAALTAFRAELAGFGRPWGAD
FT                   DIGSLIGAAHDEVSAFAFECFDSALDEIAAAGADLGRMAVRYAETEAAITRNLDGLRRK
FT                   LGG"
FT   gene            583685..584179
FT                   /locus_tag="Micau_0581"
FT   CDS_pept        583685..584179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_0738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44148"
FT                   /db_xref="GOA:D9T8M1"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M1"
FT                   /inference="similar to AA sequence:KEGG:Tcur_0738"
FT                   /protein_id="ADL44148.1"
FT                   /translation="MGMELPGELRSLLGVLGYTWPEADETKLFEMGNAWIGFSGTLSGV
FT                   VTEANTGAATVWTQHTGQDITAFQSWWNKEDSPADSLRDGVTAAVLTGTGLIICGAIVL
FT                   ALKVAVIVQLVVLAIQIAQAIATAAVTFGASLLEIPIFHALARTIVGNLVQEALWKLVD
FT                   G"
FT   gene            584216..584695
FT                   /locus_tag="Micau_0582"
FT   CDS_pept        584216..584695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctu:Ctu_1p01260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44149"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M2"
FT                   /inference="similar to AA sequence:KEGG:Ctu_1p01260"
FT                   /protein_id="ADL44149.1"
FT                   /translation="MRAALRFLKRTKTRNRPDRMNPHFTEHVMGGHVKPGMPKGSGYHY
FT                   RPGGEDFPGRRLQPGSVVKDPKTGAYTAKPEFFDPTLNPPHGAWKPKKGNGGESSFFPD
FT                   DWTPAQVDNAITGAFQNAKPVPGTSMWRGTHKGLVIEGFYNGSGGFTHGWPVVIP"
FT   gene            584711..585154
FT                   /locus_tag="Micau_0583"
FT   CDS_pept        584711..585154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0583"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_4790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44150"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M3"
FT                   /inference="similar to AA sequence:KEGG:Tcur_4790"
FT                   /protein_id="ADL44150.1"
FT                   /translation="MAFISFSVDEYRLPLFNVTDQRYRALGAWLITDVSVSYSACLDAL
FT                   QMIDDVANGRPLDEGWDSDKYEVSFAPTGVEFVNEWVADERGRYSLDETREAVESYWRF
FT                   LAGRPENRELIREYRPDLPRWQAELLQWEERWGRPHPYRGRLF"
FT   gene            complement(585165..586424)
FT                   /locus_tag="Micau_0584"
FT   CDS_pept        complement(585165..586424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0584"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="KEGG: cwo:Cwoe_3324 putative RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44151"
FT                   /db_xref="GOA:D9T8M4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADL44151.1"
FT                   /translation="MTATVVEDLLRTLAPQVLGVLVRRHGQFYACEDAVQEALLAAAVQ
FT                   WPEQGLPDRPRSWLVTVATRRLTDEWRSEHARREREVAVAVRQPAYATVAPPADEDPPS
FT                   GDDTLRLLLLCCHPALPVSGQVALTLRAVGGLSTAEIARAYLVPEATMSQRIRRAKQRI
FT                   EASGARFTLPSPADRDERLAAVLRVLYLVFNEGYTASSGEALHRAELTGEAIRLTRELR
FT                   RLLPDDGEVAGLLALMLLTDAHRAARTGPDGELVPLAEQDRSRWDRDAVAEGVALVTEA
FT                   LTWSAPGPYQVQAAIAAVHAEAPAAEDTDWRQIVALYRVLARVAPNPMVTLNQAVAVAM
FT                   VDGPRAGLSLLATLDADDRTAGHHRLAAVRAHLLDMAGDRTEARAAYLAAARATTSLPE
FT                   RRYLEVRAARLAGDSGDRPG"
FT   gene            complement(586421..586792)
FT                   /locus_tag="Micau_0585"
FT   CDS_pept        complement(586421..586792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0585"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: cwo:Cwoe_3323 YCII-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44152"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M5"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADL44152.1"
FT                   /translation="MKYMLLIWNRPGFVEELSEAERTAVFGEVDEIMKELTESGELVGG
FT                   EALAHPSQTRTARPAAGGGVEVTDGPFMESKEQFAGYLTVDCETPERAAEIAARWPDVR
FT                   HGFGVLEVRAVMEQAGTEM"
FT   gene            complement(586885..588075)
FT                   /locus_tag="Micau_0586"
FT   CDS_pept        complement(586885..588075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44153"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M6"
FT                   /inference="similar to AA sequence:KEGG:Francci3_2023"
FT                   /protein_id="ADL44153.1"
FT                   /translation="MSPAERLLDAAVATTRGTDVREAERALDGLVVADGAAVDAALLAR
FT                   LTRDVGRLWPRGWQPADLDRLATRRLTPRGARLLRDVMAAQRRTLPAPVPAWFDDQLTG
FT                   TGARWDDDAGWLDRRADGDRITALRDAVDAAVLVAGLPPVAALRPPPGSAGTALAAATP
FT                   SGSRMLDRVRALLAKAESTGYPAEAEAFTAKAQELMARHSIDAALLDAGAERSGGPGGV
FT                   RIGVDAPYAAAKALLIQEVAAANRCESVWSDDLGFATVLGFPADLAAVELLHTSLLVQA
FT                   TAAMLRGRGERGRAGGRRTKGYDESFLNAFALRIGDRLREASAAAAEELDDDRLLPVLA
FT                   ARSDAVRERVDQLFPGTTRHRLQVRDEQGWVSGTSAADRASLDPGRPARRPLRGGR"
FT   gene            588278..589048
FT                   /locus_tag="Micau_0587"
FT   CDS_pept        588278..589048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_6950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44154"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M7"
FT                   /inference="similar to AA sequence:KEGG:Kfla_6950"
FT                   /protein_id="ADL44154.1"
FT                   /translation="MVLVGAVLAAGGYAARHPDLLDRIEVRRTVPAAAPSAPPAGARAA
FT                   PTPVPAAGRVAPGIGYPARGDGTFRTADTVGAVAGRSGELLRYRVAVEDGIRNVDVERF
FT                   ARDVAATLADRRGWTGDGRWRLQRVGRDDPADFTVLLTTPVTRGRLCGDPSDRYTSCRN
FT                   GDQVVINVARWVYGVPHVTDLSRYRQYLLNHEVGHRLGRGHERCPRAGGPAPVMVQQTL
FT                   GLHGCTPNPWPLVGGEPLAGPSGQYDDPIPAGDR"
FT   gene            complement(589069..589494)
FT                   /locus_tag="Micau_0588"
FT   CDS_pept        complement(589069..589494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0588"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44155"
FT                   /db_xref="GOA:D9T8M8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M8"
FT                   /inference="similar to AA sequence:KEGG:Cfla_3554"
FT                   /protein_id="ADL44155.1"
FT                   /translation="MGQLRTSPPPPQASELERWVLDSPEDLRGLRASLRDALNRHGLVQ
FT                   GADLDEVPHLVVLVATELASNALRHGRPPTIITLLATDDRFLLDVADHDVSSVPELTDI
FT                   HPMDSGGRGLFLAQSVSLDVGWYGTEKTKNIWASFSR"
FT   gene            complement(589533..590288)
FT                   /locus_tag="Micau_0589"
FT   CDS_pept        complement(589533..590288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0589"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: mva:Mvan_2937
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44156"
FT                   /db_xref="GOA:D9T8M9"
FT                   /db_xref="InterPro:IPR017031"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8M9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL44156.1"
FT                   /translation="MTPPDLPRQFTIREGELRILNPFDDVKLATLGRAIRLRPGDELLD
FT                   LCSGKGELLCTWARDHGITGTGVDISTAFTAAARQRAAELGVAGRVRFVHDDAAAYTPE
FT                   RPVDVAACVGATWIGGGVPGTLELLDRALRPGGMAIVGEPYWRRDPPDDEAVTGSHARS
FT                   RDEFKDLPGLVESFGECGWDLVEMVLADQDSWDRYAASHWLNLRRWLDANPDDELAPEL
FT                   RRELTEDPVRYVRFQREYLGWGVFALLRR"
FT   gene            590373..590591
FT                   /locus_tag="Micau_0590"
FT   CDS_pept        590373..590591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44157"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N0"
FT                   /inference="similar to AA sequence:KEGG:Sare_4530"
FT                   /protein_id="ADL44157.1"
FT                   /translation="MVVEEHWWNGVSNPRGRRDVYIRTDGSQWQVQAQIGGASGRSRIQ
FT                   QCPSRGSATILAGAWRASGSGWREMPR"
FT   gene            complement(590600..591310)
FT                   /locus_tag="Micau_0591"
FT   CDS_pept        complement(590600..591310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0591"
FT                   /product="ANTAR domain protein"
FT                   /note="KEGG: kra:Krad_4213 putative GAF sensor protein;
FT                   PFAM: ANTAR domain protein; GAF domain protein; SMART: GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44158"
FT                   /db_xref="GOA:D9T8N1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N1"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADL44158.1"
FT                   /translation="MPQAHPDLAAALIRLGRIKYDEVDLDVVLSTIAQVAKDTLPGTAE
FT                   VSVTLVQGTEAHTAAYTGELALTLDEWQYAQGRGPCLDAATTGTAMLVPDMAAESRWPE
FT                   WAARAHAAGAASSLSIGLPIQEAMVGALNIYGASPGVLDRQVELAQTLAGYAAIALANV
FT                   HLYESTATLAQQMQEAMQSRAVIEQAKGIIMGQRRCSADEAFAILARVSQDSNRKLREV
FT                   AESLVDRAVHGPRD"
FT   gene            complement(591490..591939)
FT                   /locus_tag="Micau_0592"
FT   CDS_pept        complement(591490..591939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0592"
FT                   /product="anti-anti-sigma factor"
FT                   /note="KEGG: anti-sigma-factor antagonist; TIGRFAM:
FT                   anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44159"
FT                   /db_xref="GOA:D9T8N2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N2"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADL44159.1"
FT                   /translation="MSDERPVFGCHDVPTASGAFRRDEPIMWLSCDAGVDMTWISVAGE
FT                   VDLSNAHLLTELVESAVAAPAPLVVIDLAEVSFFGAYGTSALVLAQRMLTRHGRRLVLH
FT                   RPSPVVRRVLGVTGTLTAFEVVDRPALPAAGDGSARPVVPTRSGS"
FT   gene            592137..592841
FT                   /locus_tag="Micau_0593"
FT   CDS_pept        592137..592841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0593"
FT                   /product="ANTAR domain protein"
FT                   /note="KEGG: kra:Krad_4213 putative GAF sensor protein;
FT                   PFAM: ANTAR domain protein; GAF domain protein; SMART: GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44160"
FT                   /db_xref="GOA:D9T8N3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N3"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADL44160.1"
FT                   /translation="MESASMEPADALAELSRIRLDEVALDDVLARVAELANRAVPGSAH
FT                   VSVSLVQAGANRAIAYTSDLARSLDEWQYAHDDGPCLDASMSAVSICLPDLADEPRWPG
FT                   WAARARAAGVQSSLSIGLPIQEAVTGALNIHGGAPRAFDKSSIELAEEFAAYAAVALAN
FT                   AHLYESTATLARQMQEAMRSRAVIEQAKGIIMGQRRCSAEEAFTLLAKLSQDSNRKLRE
FT                   VAEALVSRAAAR"
FT   gene            592864..593121
FT                   /locus_tag="Micau_0594"
FT   CDS_pept        592864..593121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0594"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyt:cce_1979 RfrA pentapeptide
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44161"
FT                   /db_xref="GOA:D9T8N4"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N4"
FT                   /inference="similar to AA sequence:KEGG:cce_1979"
FT                   /protein_id="ADL44161.1"
FT                   /translation="MADLRAVAAVAALGAAVFVGFLAHRYGELTGPGDAWSRAVPIGFA
FT                   AVLGAGYRHLRSIGVEARPVTRITGRGGGVKSASRNRGRA"
FT   gene            593395..595050
FT                   /locus_tag="Micau_0595"
FT   CDS_pept        593395..595050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0595"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   KEGG: sro:Sros_0433 potassium-transporting ATPase; PFAM: K
FT                   transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44162"
FT                   /db_xref="GOA:D9T8N5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N5"
FT                   /inference="protein motif:TFAM:TIGR00680"
FT                   /protein_id="ADL44162.1"
FT                   /translation="MSMTTAGVLFVLSLVAALVAVHRLFGDYMHRVVAGTRSSRVERGI
FT                   YRLVGVNPVAEQTWGVYARSVLAFSAVSLLFLYAFQRLQNHLWLSLGLDPVVPHGAWNT
FT                   AVSFVTNTNWQWYSGESTMGHLVQMAGLAVQNFVSAAVGIAVAVALVRGFARSRTGELG
FT                   NFWVDLTRVTLRILLPIAVLGALALMLGGVVQNLSGGTEVTTLTGGTQTVTGGPVASQE
FT                   VIKELGTNGGGFYNVNSAHPFENPTAWTNWLEIFLILVIPFSLPRVFGRMVGQKRQGYA
FT                   IVAVMAILALAGITLTNVFELTGDGTVPQAVGAALEGKEVRFDVSNSATFAAATTLTST
FT                   GAVNSFHDSYTALGGMMTLGNMMLGEVAPGGVGAGLYGLLILAVITVFVAGLMVGRTPE
FT                   YLGKKIGSREIKFASMYFLITPALVLTGTAAAFATGNASTALNVGPHGLSEVLYAFTSA
FT                   SNNNGSAFAGITVNTQWWNTALGLCMLLGRFLPIIFVLALAGSLARQQPTPASEGTLPT
FT                   HRPLFVGMVVGVTVVLVALTFLPALALGPLAEGL"
FT   gene            595071..597245
FT                   /locus_tag="Micau_0596"
FT   CDS_pept        595071..597245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0596"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="KEGG: nml:Namu_5032 K+-transporting ATPase, B
FT                   subunit; TIGRFAM: K+-transporting ATPase, B subunit;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44163"
FT                   /db_xref="GOA:D9T8N6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N6"
FT                   /inference="protein motif:TFAM:TIGR01497"
FT                   /protein_id="ADL44163.1"
FT                   /translation="MTAPVQTADAPAPGTPGRREDRVGGGLLDPRQLLRSLPEALRKLD
FT                   PRTLWRNPVMLIVEIGALFTTVLAVADPSVFAVAITVWLWLTVIFANLAEAVAEGRGKA
FT                   QADTLRRAKQDTIATRLVGWTPGAAANAYRDEAVPAPQLRQGDVVLVEAGQVIPGDGDV
FT                   VEGIASVDESAITGESAPVIRESGGDRSAVTGGTRVLSDRIVVRITQKPGESFIDRMIA
FT                   LVEGANRQKTPNEIALNILLAALTIIFLLAVVTLQPMAIFAKGYQAAAPDTAAITDSGV
FT                   TGVVLVSLLVCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVNTLLLDKT
FT                   GTITLGNRQAAEFLPVTGVDAATLADAAQLSSLADETPEGRSVVVLAKNEYGLREREPG
FT                   LIPHATFVPFTAQTRMSGVDLDADGGVRHVRKGAAAAVMKWVRDNGGHPTEQVGELVDG
FT                   ISGTGGTPLVVAEHVAGEPARALGVIHLKDVVKAGMRERFDEMRRMGIRTVMITGDNPR
FT                   TAKAIADEAGVDDFLAEATPEDKLALIKKEQEGGRLVAMTGDGTNDAPALAQADVGVAM
FT                   NTGTSAAKEAGNMVDLDSDPTKLIEIVEIGKQLLITRGALTTFSIANDIAKYFAIIPAM
FT                   FAGIYPSLDRLNIMRLASPESAILSAVVFNAMVIVALIPLALRGVRYRPASASTLLRRN
FT                   LWLYGLGGIVVPFVGIKLIDLLVQFVPGIS"
FT   gene            597245..598126
FT                   /locus_tag="Micau_0597"
FT   CDS_pept        597245..598126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0597"
FT                   /product="K transporting ATPase KdpC subunit"
FT                   /note="PFAM: K transporting ATPase KdpC subunit; KEGG:
FT                   nml:Namu_5031 K transporting ATPase KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44164"
FT                   /db_xref="GOA:D9T8N7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N7"
FT                   /inference="protein motif:PFAM:PF02669"
FT                   /protein_id="ADL44164.1"
FT                   /translation="MRLPSWLSQHLAALRAVLVFTVLLGLVYPLALVAVGRLPGLDGRA
FT                   DGSLLTVGGRTVGSLLIGQSFTDADGNPVPRYFQSRPSAAGDGYDPTATAAGNLGPESV
FT                   VDTLTGDEETSAHSLLTQVCARSKAVGDLDGVDGRRPYCTPDGVGAVLAVFRADGLTGP
FT                   ITRVVSVNQAAPATPFVTIWQGVPVEAAQPGHDYVAEGGIVTPVRGDAPARPAVPADAV
FT                   TASGSGLDPHISPAYARIQVARVARERGADPAAVRRLVAEHTTGRALGFMGEPGVNVLE
FT                   LNLALDEAFPAR"
FT   gene            598207..600753
FT                   /locus_tag="Micau_0598"
FT   CDS_pept        598207..600753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0598"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="KEGG: sro:Sros_0436 osmosensitive K+ channel signal
FT                   transduction histidine kinase; PFAM: Osmosensitive K
FT                   channel His kinase sensor; UspA domain-containing protein;
FT                   histidine kinase A domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44165"
FT                   /db_xref="GOA:D9T8N8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N8"
FT                   /inference="protein motif:PFAM:PF02702"
FT                   /protein_id="ADL44165.1"
FT                   /translation="MGRGELRIYLGAAPGVGKTYAVLEEAQRRAERGTDVVIGLVETHG
FT                   RRHTAEMVGDLEVVPRRSMTYRGVEFTEMDLDAVLARRPEVVVVDELAHTNVPGSRHEK
FT                   RWQDVQELLDAGISVLSTVNVQHLESLNDVVAQITGTTQRETVPDQVVRAAEQVELVDM
FT                   TPEALRRRMAHGNIYRPDKIDAALGNYFRVGNLTALRELALLWLADKVDEQLDAYRAQQ
FT                   GISDTWEARERVVVALTGGPEGETLIRRAARIAARSKGADLLAVHVARSDGLAGADPAQ
FT                   LARQRVLVESLGGTYHQVLGTDIPAALLDFARGVNATQLVLGASRRGRFAQVFSRGVGV
FT                   TTTALSGPIDVHLVTHPEAGRGRRGTSVPAALSRRRRLIGYALAVLGMPLLTLVLRTLP
FT                   DLTLTNDILLFLAGVVGVALVGGLWPALVAALGGSLLLNWFFTPPYRTLTIAEADNLLA
FT                   LGVFVGVAIAVSWVVDVAARRTREAARASADAQTLATVAGSVLRGERPLPALLDRLRET
FT                   FGLRAVSVLELTDEAGGRPARARGADAWRVVASVGERPPGSPGAGETVVPVDDRLSVVL
FT                   AGRRLEAADRRVVEAFAAQAAVALRQERLAEEAATARPLAAADRMRTALLAAVSHDLRT
FT                   PLASAKAAVSSLRSHDVEFDADDREELLATADESLDRLGRLVANLLDMSRLQAGALGVS
FT                   ATAIGLEDAVPLALDELGPAAAEVTTDIPADLPAALADPGLLERVLVNIVANALRHSPP
FT                   GRPPAITGSAHAGQVELRVIDTGPGIPEDQWEHVFLPFQRLGDRDNQTGVGLGLALSRG
FT                   LAEAMGGSITPETTPGGGLTMVLRLPAATQPEGPQE"
FT   gene            600750..601430
FT                   /locus_tag="Micau_0599"
FT   CDS_pept        600750..601430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0599"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: sna:Snas_1436 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver;
FT                   transcriptional regulator domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44166"
FT                   /db_xref="GOA:D9T8N9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8N9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL44166.1"
FT                   /translation="MTRILVVDDEPQILRALRINLRARGYDVEVAGSGAAALKAAAGHP
FT                   PDLVVLDLGLPDLDGTDVIRGLRGWTAVPIIVLSGRAGSEDKVAALDAGADDYVTKPFG
FT                   VDELLARIRAVTRRLAPATPAVPALRIGHNTVDLADRTVTRDDGVEVKLTPTQWAMLEK
FT                   LLRNPGKLVSQRQLLHDVWGPEYHHETNYLRQYMAQLRRKLEDDPARPRHLITEPGMGY
FT                   RYRP"
FT   gene            601489..602595
FT                   /locus_tag="Micau_0600"
FT   CDS_pept        601489..602595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0600"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="KEGG: kfl:Kfla_4857 magnesium and cobalt transport
FT                   protein CorA; TIGRFAM: magnesium and cobalt transport
FT                   protein CorA; PFAM: Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44167"
FT                   /db_xref="GOA:D9T8P0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8P0"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADL44167.1"
FT                   /translation="MADNRSSEGFGRRLDEHAIDAGAAEPERPDGLVDSGVYVGGVRRA
FT                   SPVTLADTFRCLQHLDDAMAWIGLRRPGREEVASLAAEFQLPDLAVEDAINAHQRPKLE
FT                   RYGDTLFVVLRAARYLDAREAVEFAELHLFLGPGFVITVRHGGTPDLAGVRRRLEAEPE
FT                   VLALGPEAVLYAVLDRVVDGYAPVVAGLENDIDEIETEVFGGDPNASRRIYELSREVIQ
FT                   FQRAARPLLKVVDALTHGFDRYGTDEELRRRLRDVADHLTQVVERVDGFRHLLQNILTV
FT                   NATLVSQAQNEEMRSLTAASFEQNEEIKRVSAWAAILFAPTLIGTVYGMNFTHMPELDW
FT                   RYGYLFAVTLMLAVCGALYLLFKRRGWL"
FT   gene            602686..603645
FT                   /locus_tag="Micau_0601"
FT   CDS_pept        602686..603645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0601"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; KEGG: scb:SCAB_83201
FT                   putative ion channel selectivity component"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44168"
FT                   /db_xref="GOA:D9T8P1"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8P1"
FT                   /inference="protein motif:PFAM:PF00520"
FT                   /protein_id="ADL44168.1"
FT                   /translation="MCRRGTLIGDTVPAPRGGRRTSDGKRGLAGHCARIVASRPFEVAI
FT                   VVLIMANGVVLGIETYPNLGAAGPVLRWTEWMFRAVFVVEITIRVLAYGRRPQDFFRHG
FT                   WNVFDLLVTAAIFVPGLHGDSAVLRFIRVARVLRLVRFSPGLRTIVAALWRSLPGVAGF
FT                   LALAAVTLYVYGMAGWLIFGDRYPEQYGDIGRSLVTLFVLLSLETLPDLLEQGLEVSPW
FT                   TLLYYVSFVMIAVNLLLNILIAVIVNSMEEARRLEMTEGLASDYDSDGDGIPDEVDRIA
FT                   ISQRLDDLRMVIAELERELRIDREEPPGAPRRRQPSDH"
FT   gene            603757..604026
FT                   /locus_tag="Micau_0602"
FT   CDS_pept        603757..604026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0602"
FT                   /product="transglycosylase-associated protein"
FT                   /note="KEGG: sro:Sros_9244 transglycosylase-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44169"
FT                   /db_xref="GOA:D9T8P2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8P2"
FT                   /inference="similar to AA sequence:KEGG:Sros_9244"
FT                   /protein_id="ADL44169.1"
FT                   /translation="MEITGFFTALIIGLVIGALGRLVVPGKQNIPIWLTLLIGVVAAFV
FT                   GTLVAGAFGVDDTPGIDWIELLLQVGFAAIGVAVFAGLYGRRRI"
FT   gene            complement(604096..605679)
FT                   /locus_tag="Micau_0603"
FT   CDS_pept        complement(604096..605679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0603"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_6526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44170"
FT                   /db_xref="InterPro:IPR011935"
FT                   /db_xref="InterPro:IPR025554"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8P3"
FT                   /inference="similar to AA sequence:KEGG:Franean1_6526"
FT                   /protein_id="ADL44170.1"
FT                   /translation="MDTVEIDAPVVGVTVYPDRARVTRRGGVRLAAGDHRVRVAPLPLG
FT                   LRRDSIRVGGRGAVTVLGVDVTAWRQPRSTDAQVVELERRRWELADELAEVGDTDAVEE
FT                   QRGEFLTRLAERAGGTYARALAAGDAAPADVAAFTDSVSGQLTESRARRRGLARRRTEL
FT                   AEELAAVDRELDAARGKREPDRLAAEVSVSVDADDTEVELELTYLVDGARWTPSYDLRL
FT                   VEDTMTVTWFGLVSQGTGEDWPECELQLSTARPAAASGVPELSPWYLDRLRPEPPMAVS
FT                   AASFGGVVPPPAPGAAPAGRPRAARAAAPAVRESVAEVEQGVTAATYRPARPVAVPADG
FT                   SAHRVTIAVLELPARLDHVSVPVRAAEAHLRATVRNSSDHTLLPGPASVFHGADFVAAT
FT                   RLKTWAPGEETELALGIDDRLRVERKLSRRTESKATLGSTRRREVEYRITVANHTPRPA
FT                   TVEVQDQLPVSRDEAVVVRETALTPPPAERTELGELTWRLSLAPGESGEIALGFRVELA
FT                   KGVELTGWRE"
FT   gene            605866..606222
FT                   /locus_tag="Micau_0604"
FT   CDS_pept        605866..606222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0604"
FT                   /product="anti-anti-sigma factor"
FT                   /note="KEGG: kra:Krad_0483 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44171"
FT                   /db_xref="GOA:D9T8P4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8P4"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADL44171.1"
FT                   /translation="MVEFSVTTRQGRVGPVIEVAGDLDMASAPTLRDRLLEVVETGART
FT                   VVVDLTQVGFVDSSGLGALVLVYKNLRERDGWLGLAVVRQSIRNVFSITSVDRVIPLFG
FT                   TVRDAEDGSPAAVR"
FT   gene            complement(606202..607470)
FT                   /locus_tag="Micau_0605"
FT   CDS_pept        complement(606202..607470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0605"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: kra:Krad_0436 stage II sporulation E family
FT                   protein; PFAM: Stage II sporulation protein E; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Micau_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADL44172"
FT                   /db_xref="GOA:D9T8P5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9T8P5"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADL44172.1"
FT                   /translation="MKDSEQAVLAGMLQSAEDAAPVQAVEAVTGVIATALNARGVSLLI
FT                   ADLSGRALVRLTHQPVGGGTGRRHGEEDAEVLPFDGGPYERALRQQAPEVIRRDGTWTV
FT                   LAPVTDRGEAIGLLEIELPDEPDGDVVNWVARTAHALAFVVIANRRHTDLFEWGQRTTP
FT                   FSLSAEIQRRLLPASFTCEAGAFALSGWLEPAASVGGDTFDYSLARDLLHLSVTDAMGH
FT                   GVASALTATLGVGSLRNSRRRGAGLVAQAEEANRAVAENANVRGAYVTAVLGRIDLTTG
FT                   RCELVNAGHVPPMLVRDGRVVPVDLPGNFPFGMFPGESYRSGELPLLPGDRLVVVTDGM
FT                   RDRNAADLDLPAALLRLSHLHPREAVRALSDAVLEIAGPALTDDATLLVVDWYGDHGPR
FT                   RSTAGADTARVSPDEERSAHRRR"
FT   gene            607671..609269
FT                   /locus_tag="Micau_0606"
FT   CDS_pept        607671..609269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Micau_0606"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: extracellular solu