(data stored in ACNUC8465 zone)

EMBL: CP002164

ID   CP002164; SV 1; circular; genomic DNA; STD; PRO; 2532343 BP.
XX
AC   CP002164;
XX
PR   Project:PRJNA40355;
XX
DT   14-AUG-2010 (Rel. 105, Created)
DT   10-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Caldicellulosiruptor obsidiansis OB47, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Caldicellulosiruptor obsidiansis OB47
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacterales Family III. Incertae Sedis; Caldicellulosiruptor.
XX
RN   [1]
RP   1-2532343
RX   DOI; 10.1128/JB.00950-10.
RX   PUBMED; 20851897.
RA   Elkins J.G., Lochner A., Hamilton-Brehm S.D., Davenport K.W., Podar M.,
RA   Brown S.D., Land M.L., Hauser L.J., Klingeman D.M., Raman B., Goodwin L.A.,
RA   Tapia R., Meincke L.J., Detter J.C., Bruce D.C., Han C.S., Palumbo A.V.,
RA   Cottingham R.W., Keller M., Graham D.E.;
RT   "Complete genome sequence of the cellulolytic thermophile
RT   Caldicellulosiruptor obsidiansis OB47T";
RL   J. Bacteriol. 192(22):6099-6100(2010).
XX
RN   [2]
RP   1-2532343
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Walston Davenport K., Meincke L., Detter J.C., Han C.,
RA   Tapia R., Land M., Hauser L., Chang Y.-J., Jeffries C., Kyrpides N.,
RA   Ivanova N., Mikhailova N., Hamilton-Brehm S., Lochner A., Cottingham R.,
RA   Graham D.E., Keller M., Elkins J.G., Woyke T.;
RT   "Complete sequence of Caldicellulosiruptor sp. OB47";
RL   Unpublished.
XX
RN   [3]
RP   1-2532343
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Walston Davenport K., Meincke L., Detter J.C., Han C.,
RA   Tapia R., Land M., Hauser L., Chang Y.-J., Jeffries C., Kyrpides N.,
RA   Ivanova N., Mikhailova N., Hamilton-Brehm S., Lochner A., Cottingham R.,
RA   Graham D.E., Keller M., Elkins J.G., Woyke T.;
RT   ;
RL   Submitted (06-AUG-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b84f971ed034781dc3bac7305ec44e98.
DR   EnsemblGenomes-Gn; COB47_R0001.
DR   EnsemblGenomes-Gn; COB47_R0002.
DR   EnsemblGenomes-Gn; COB47_R0003.
DR   EnsemblGenomes-Gn; COB47_R0004.
DR   EnsemblGenomes-Gn; COB47_R0005.
DR   EnsemblGenomes-Gn; COB47_R0006.
DR   EnsemblGenomes-Gn; COB47_R0007.
DR   EnsemblGenomes-Gn; COB47_R0008.
DR   EnsemblGenomes-Gn; COB47_R0009.
DR   EnsemblGenomes-Gn; COB47_R0010.
DR   EnsemblGenomes-Gn; COB47_R0011.
DR   EnsemblGenomes-Gn; COB47_R0012.
DR   EnsemblGenomes-Gn; COB47_R0013.
DR   EnsemblGenomes-Gn; COB47_R0014.
DR   EnsemblGenomes-Gn; COB47_R0015.
DR   EnsemblGenomes-Gn; COB47_R0016.
DR   EnsemblGenomes-Gn; COB47_R0017.
DR   EnsemblGenomes-Gn; COB47_R0018.
DR   EnsemblGenomes-Gn; COB47_R0019.
DR   EnsemblGenomes-Gn; COB47_R0020.
DR   EnsemblGenomes-Gn; COB47_R0021.
DR   EnsemblGenomes-Gn; COB47_R0022.
DR   EnsemblGenomes-Gn; COB47_R0023.
DR   EnsemblGenomes-Gn; COB47_R0024.
DR   EnsemblGenomes-Gn; COB47_R0025.
DR   EnsemblGenomes-Gn; COB47_R0026.
DR   EnsemblGenomes-Gn; COB47_R0027.
DR   EnsemblGenomes-Gn; COB47_R0028.
DR   EnsemblGenomes-Gn; COB47_R0029.
DR   EnsemblGenomes-Gn; COB47_R0030.
DR   EnsemblGenomes-Gn; COB47_R0031.
DR   EnsemblGenomes-Gn; COB47_R0032.
DR   EnsemblGenomes-Gn; COB47_R0033.
DR   EnsemblGenomes-Gn; COB47_R0034.
DR   EnsemblGenomes-Gn; COB47_R0035.
DR   EnsemblGenomes-Gn; COB47_R0036.
DR   EnsemblGenomes-Gn; COB47_R0037.
DR   EnsemblGenomes-Gn; COB47_R0038.
DR   EnsemblGenomes-Gn; COB47_R0039.
DR   EnsemblGenomes-Gn; COB47_R0040.
DR   EnsemblGenomes-Gn; COB47_R0041.
DR   EnsemblGenomes-Gn; COB47_R0042.
DR   EnsemblGenomes-Gn; COB47_R0043.
DR   EnsemblGenomes-Gn; COB47_R0044.
DR   EnsemblGenomes-Gn; COB47_R0045.
DR   EnsemblGenomes-Gn; COB47_R0046.
DR   EnsemblGenomes-Gn; COB47_R0047.
DR   EnsemblGenomes-Gn; COB47_R0048.
DR   EnsemblGenomes-Gn; COB47_R0049.
DR   EnsemblGenomes-Gn; COB47_R0050.
DR   EnsemblGenomes-Gn; COB47_R0051.
DR   EnsemblGenomes-Gn; COB47_R0052.
DR   EnsemblGenomes-Gn; COB47_R0053.
DR   EnsemblGenomes-Gn; COB47_R0054.
DR   EnsemblGenomes-Gn; COB47_R0055.
DR   EnsemblGenomes-Gn; COB47_R0056.
DR   EnsemblGenomes-Gn; COB47_R0057.
DR   EnsemblGenomes-Gn; COB47_R0058.
DR   EnsemblGenomes-Gn; COB47_R0059.
DR   EnsemblGenomes-Gn; EBG00001051892.
DR   EnsemblGenomes-Gn; EBG00001051893.
DR   EnsemblGenomes-Gn; EBG00001051894.
DR   EnsemblGenomes-Gn; EBG00001051895.
DR   EnsemblGenomes-Gn; EBG00001051896.
DR   EnsemblGenomes-Gn; EBG00001051897.
DR   EnsemblGenomes-Gn; EBG00001051898.
DR   EnsemblGenomes-Gn; EBG00001051899.
DR   EnsemblGenomes-Gn; EBG00001051900.
DR   EnsemblGenomes-Gn; EBG00001051901.
DR   EnsemblGenomes-Gn; EBG00001051902.
DR   EnsemblGenomes-Gn; EBG00001051903.
DR   EnsemblGenomes-Gn; EBG00001051904.
DR   EnsemblGenomes-Gn; EBG00001051905.
DR   EnsemblGenomes-Gn; EBG00001051906.
DR   EnsemblGenomes-Gn; EBG00001051907.
DR   EnsemblGenomes-Gn; EBG00001051908.
DR   EnsemblGenomes-Gn; EBG00001051909.
DR   EnsemblGenomes-Gn; EBG00001051910.
DR   EnsemblGenomes-Gn; EBG00001051911.
DR   EnsemblGenomes-Gn; EBG00001051912.
DR   EnsemblGenomes-Gn; EBG00001051913.
DR   EnsemblGenomes-Gn; EBG00001051914.
DR   EnsemblGenomes-Gn; EBG00001051915.
DR   EnsemblGenomes-Gn; EBG00001051916.
DR   EnsemblGenomes-Gn; EBG00001051917.
DR   EnsemblGenomes-Gn; EBG00001051918.
DR   EnsemblGenomes-Gn; EBG00001051919.
DR   EnsemblGenomes-Gn; EBG00001051920.
DR   EnsemblGenomes-Gn; EBG00001051921.
DR   EnsemblGenomes-Gn; EBG00001051922.
DR   EnsemblGenomes-Gn; EBG00001051923.
DR   EnsemblGenomes-Gn; EBG00001051924.
DR   EnsemblGenomes-Gn; EBG00001051925.
DR   EnsemblGenomes-Gn; EBG00001051926.
DR   EnsemblGenomes-Gn; EBG00001051927.
DR   EnsemblGenomes-Gn; EBG00001051928.
DR   EnsemblGenomes-Gn; EBG00001051929.
DR   EnsemblGenomes-Gn; EBG00001051930.
DR   EnsemblGenomes-Gn; EBG00001051931.
DR   EnsemblGenomes-Gn; EBG00001051932.
DR   EnsemblGenomes-Gn; EBG00001051933.
DR   EnsemblGenomes-Gn; EBG00001051934.
DR   EnsemblGenomes-Gn; EBG00001051935.
DR   EnsemblGenomes-Gn; EBG00001051936.
DR   EnsemblGenomes-Gn; EBG00001051937.
DR   EnsemblGenomes-Gn; EBG00001051938.
DR   EnsemblGenomes-Gn; EBG00001051939.
DR   EnsemblGenomes-Gn; EBG00001051940.
DR   EnsemblGenomes-Gn; EBG00001051941.
DR   EnsemblGenomes-Gn; EBG00001051942.
DR   EnsemblGenomes-Gn; EBG00001051943.
DR   EnsemblGenomes-Gn; EBG00001051944.
DR   EnsemblGenomes-Gn; EBG00001051945.
DR   EnsemblGenomes-Gn; EBG00001051946.
DR   EnsemblGenomes-Gn; EBG00001051947.
DR   EnsemblGenomes-Gn; EBG00001051948.
DR   EnsemblGenomes-Gn; EBG00001051949.
DR   EnsemblGenomes-Gn; EBG00001051950.
DR   EnsemblGenomes-Gn; EBG00001051951.
DR   EnsemblGenomes-Gn; EBG00001051952.
DR   EnsemblGenomes-Gn; EBG00001051953.
DR   EnsemblGenomes-Gn; EBG00001051954.
DR   EnsemblGenomes-Gn; EBG00001051955.
DR   EnsemblGenomes-Gn; EBG00001051956.
DR   EnsemblGenomes-Gn; EBG00001051957.
DR   EnsemblGenomes-Gn; EBG00001051958.
DR   EnsemblGenomes-Gn; EBG00001051959.
DR   EnsemblGenomes-Gn; EBG00001051960.
DR   EnsemblGenomes-Gn; EBG00001051961.
DR   EnsemblGenomes-Gn; EBG00001051962.
DR   EnsemblGenomes-Gn; EBG00001051963.
DR   EnsemblGenomes-Gn; EBG00001051964.
DR   EnsemblGenomes-Gn; EBG00001051965.
DR   EnsemblGenomes-Gn; EBG00001051966.
DR   EnsemblGenomes-Gn; EBG00001051967.
DR   EnsemblGenomes-Gn; EBG00001051968.
DR   EnsemblGenomes-Gn; EBG00001051969.
DR   EnsemblGenomes-Gn; EBG00001051970.
DR   EnsemblGenomes-Gn; EBG00001051971.
DR   EnsemblGenomes-Gn; EBG00001051972.
DR   EnsemblGenomes-Gn; EBG00001051973.
DR   EnsemblGenomes-Gn; EBG00001051974.
DR   EnsemblGenomes-Gn; EBG00001051975.
DR   EnsemblGenomes-Gn; EBG00001051976.
DR   EnsemblGenomes-Gn; EBG00001051977.
DR   EnsemblGenomes-Gn; EBG00001051978.
DR   EnsemblGenomes-Gn; EBG00001051979.
DR   EnsemblGenomes-Gn; EBG00001051980.
DR   EnsemblGenomes-Gn; EBG00001051981.
DR   EnsemblGenomes-Gn; EBG00001051982.
DR   EnsemblGenomes-Gn; EBG00001051983.
DR   EnsemblGenomes-Gn; EBG00001051984.
DR   EnsemblGenomes-Gn; EBG00001051985.
DR   EnsemblGenomes-Gn; EBG00001051986.
DR   EnsemblGenomes-Gn; EBG00001051987.
DR   EnsemblGenomes-Gn; EBG00001051988.
DR   EnsemblGenomes-Gn; EBG00001051989.
DR   EnsemblGenomes-Gn; EBG00001051990.
DR   EnsemblGenomes-Gn; EBG00001051991.
DR   EnsemblGenomes-Gn; EBG00001051992.
DR   EnsemblGenomes-Gn; EBG00001051993.
DR   EnsemblGenomes-Gn; EBG00001051994.
DR   EnsemblGenomes-Gn; EBG00001051995.
DR   EnsemblGenomes-Gn; EBG00001051996.
DR   EnsemblGenomes-Gn; EBG00001051997.
DR   EnsemblGenomes-Gn; EBG00001051998.
DR   EnsemblGenomes-Gn; EBG00001051999.
DR   EnsemblGenomes-Gn; EBG00001052000.
DR   EnsemblGenomes-Gn; EBG00001052001.
DR   EnsemblGenomes-Gn; EBG00001052002.
DR   EnsemblGenomes-Gn; EBG00001052003.
DR   EnsemblGenomes-Gn; EBG00001052004.
DR   EnsemblGenomes-Gn; EBG00001052005.
DR   EnsemblGenomes-Gn; EBG00001052006.
DR   EnsemblGenomes-Gn; EBG00001052007.
DR   EnsemblGenomes-Gn; EBG00001052008.
DR   EnsemblGenomes-Gn; EBG00001052009.
DR   EnsemblGenomes-Gn; EBG00001052010.
DR   EnsemblGenomes-Gn; EBG00001052011.
DR   EnsemblGenomes-Gn; EBG00001052012.
DR   EnsemblGenomes-Gn; EBG00001052013.
DR   EnsemblGenomes-Gn; EBG00001052014.
DR   EnsemblGenomes-Gn; EBG00001052015.
DR   EnsemblGenomes-Gn; EBG00001052016.
DR   EnsemblGenomes-Gn; EBG00001052017.
DR   EnsemblGenomes-Gn; EBG00001052018.
DR   EnsemblGenomes-Gn; EBG00001052019.
DR   EnsemblGenomes-Gn; EBG00001052020.
DR   EnsemblGenomes-Gn; EBG00001052021.
DR   EnsemblGenomes-Gn; EBG00001052022.
DR   EnsemblGenomes-Gn; EBG00001052023.
DR   EnsemblGenomes-Gn; EBG00001052024.
DR   EnsemblGenomes-Gn; EBG00001052025.
DR   EnsemblGenomes-Gn; EBG00001052026.
DR   EnsemblGenomes-Gn; EBG00001052027.
DR   EnsemblGenomes-Gn; EBG00001052028.
DR   EnsemblGenomes-Gn; EBG00001052029.
DR   EnsemblGenomes-Gn; EBG00001052030.
DR   EnsemblGenomes-Gn; EBG00001052031.
DR   EnsemblGenomes-Gn; EBG00001052032.
DR   EnsemblGenomes-Gn; EBG00001052033.
DR   EnsemblGenomes-Gn; EBG00001052034.
DR   EnsemblGenomes-Gn; EBG00001052035.
DR   EnsemblGenomes-Gn; EBG00001052036.
DR   EnsemblGenomes-Gn; EBG00001052037.
DR   EnsemblGenomes-Gn; EBG00001052038.
DR   EnsemblGenomes-Gn; EBG00001052039.
DR   EnsemblGenomes-Gn; EBG00001052040.
DR   EnsemblGenomes-Gn; EBG00001052041.
DR   EnsemblGenomes-Gn; EBG00001052042.
DR   EnsemblGenomes-Gn; EBG00001052043.
DR   EnsemblGenomes-Gn; EBG00001052044.
DR   EnsemblGenomes-Gn; EBG00001052045.
DR   EnsemblGenomes-Gn; EBG00001052046.
DR   EnsemblGenomes-Gn; EBG00001052047.
DR   EnsemblGenomes-Gn; EBG00001052048.
DR   EnsemblGenomes-Gn; EBG00001052049.
DR   EnsemblGenomes-Gn; EBG00001052050.
DR   EnsemblGenomes-Gn; EBG00001052051.
DR   EnsemblGenomes-Gn; EBG00001052052.
DR   EnsemblGenomes-Gn; EBG00001052053.
DR   EnsemblGenomes-Gn; EBG00001052054.
DR   EnsemblGenomes-Gn; EBG00001052055.
DR   EnsemblGenomes-Gn; EBG00001052056.
DR   EnsemblGenomes-Gn; EBG00001052057.
DR   EnsemblGenomes-Gn; EBG00001052058.
DR   EnsemblGenomes-Tr; COB47_R0001-1.
DR   EnsemblGenomes-Tr; COB47_R0002-1.
DR   EnsemblGenomes-Tr; COB47_R0003-1.
DR   EnsemblGenomes-Tr; COB47_R0004-1.
DR   EnsemblGenomes-Tr; COB47_R0005-1.
DR   EnsemblGenomes-Tr; COB47_R0006-1.
DR   EnsemblGenomes-Tr; COB47_R0007-1.
DR   EnsemblGenomes-Tr; COB47_R0008-1.
DR   EnsemblGenomes-Tr; COB47_R0009-1.
DR   EnsemblGenomes-Tr; COB47_R0010-1.
DR   EnsemblGenomes-Tr; COB47_R0011-1.
DR   EnsemblGenomes-Tr; COB47_R0012-1.
DR   EnsemblGenomes-Tr; COB47_R0013-1.
DR   EnsemblGenomes-Tr; COB47_R0014-1.
DR   EnsemblGenomes-Tr; COB47_R0015-1.
DR   EnsemblGenomes-Tr; COB47_R0016-1.
DR   EnsemblGenomes-Tr; COB47_R0017-1.
DR   EnsemblGenomes-Tr; COB47_R0018-1.
DR   EnsemblGenomes-Tr; COB47_R0019-1.
DR   EnsemblGenomes-Tr; COB47_R0020-1.
DR   EnsemblGenomes-Tr; COB47_R0021-1.
DR   EnsemblGenomes-Tr; COB47_R0022-1.
DR   EnsemblGenomes-Tr; COB47_R0023-1.
DR   EnsemblGenomes-Tr; COB47_R0024-1.
DR   EnsemblGenomes-Tr; COB47_R0025-1.
DR   EnsemblGenomes-Tr; COB47_R0026-1.
DR   EnsemblGenomes-Tr; COB47_R0027-1.
DR   EnsemblGenomes-Tr; COB47_R0028-1.
DR   EnsemblGenomes-Tr; COB47_R0029-1.
DR   EnsemblGenomes-Tr; COB47_R0030-1.
DR   EnsemblGenomes-Tr; COB47_R0031-1.
DR   EnsemblGenomes-Tr; COB47_R0032-1.
DR   EnsemblGenomes-Tr; COB47_R0033-1.
DR   EnsemblGenomes-Tr; COB47_R0034-1.
DR   EnsemblGenomes-Tr; COB47_R0035-1.
DR   EnsemblGenomes-Tr; COB47_R0036-1.
DR   EnsemblGenomes-Tr; COB47_R0037-1.
DR   EnsemblGenomes-Tr; COB47_R0038-1.
DR   EnsemblGenomes-Tr; COB47_R0039-1.
DR   EnsemblGenomes-Tr; COB47_R0040-1.
DR   EnsemblGenomes-Tr; COB47_R0041-1.
DR   EnsemblGenomes-Tr; COB47_R0042-1.
DR   EnsemblGenomes-Tr; COB47_R0043-1.
DR   EnsemblGenomes-Tr; COB47_R0044-1.
DR   EnsemblGenomes-Tr; COB47_R0045-1.
DR   EnsemblGenomes-Tr; COB47_R0046-1.
DR   EnsemblGenomes-Tr; COB47_R0047-1.
DR   EnsemblGenomes-Tr; COB47_R0048-1.
DR   EnsemblGenomes-Tr; COB47_R0049-1.
DR   EnsemblGenomes-Tr; COB47_R0050-1.
DR   EnsemblGenomes-Tr; COB47_R0051-1.
DR   EnsemblGenomes-Tr; COB47_R0052-1.
DR   EnsemblGenomes-Tr; COB47_R0053-1.
DR   EnsemblGenomes-Tr; COB47_R0054-1.
DR   EnsemblGenomes-Tr; COB47_R0055-1.
DR   EnsemblGenomes-Tr; COB47_R0056-1.
DR   EnsemblGenomes-Tr; COB47_R0057-1.
DR   EnsemblGenomes-Tr; COB47_R0058-1.
DR   EnsemblGenomes-Tr; COB47_R0059-1.
DR   EnsemblGenomes-Tr; EBT00001654709.
DR   EnsemblGenomes-Tr; EBT00001654710.
DR   EnsemblGenomes-Tr; EBT00001654711.
DR   EnsemblGenomes-Tr; EBT00001654712.
DR   EnsemblGenomes-Tr; EBT00001654713.
DR   EnsemblGenomes-Tr; EBT00001654714.
DR   EnsemblGenomes-Tr; EBT00001654715.
DR   EnsemblGenomes-Tr; EBT00001654716.
DR   EnsemblGenomes-Tr; EBT00001654717.
DR   EnsemblGenomes-Tr; EBT00001654718.
DR   EnsemblGenomes-Tr; EBT00001654719.
DR   EnsemblGenomes-Tr; EBT00001654720.
DR   EnsemblGenomes-Tr; EBT00001654721.
DR   EnsemblGenomes-Tr; EBT00001654722.
DR   EnsemblGenomes-Tr; EBT00001654723.
DR   EnsemblGenomes-Tr; EBT00001654724.
DR   EnsemblGenomes-Tr; EBT00001654725.
DR   EnsemblGenomes-Tr; EBT00001654726.
DR   EnsemblGenomes-Tr; EBT00001654727.
DR   EnsemblGenomes-Tr; EBT00001654728.
DR   EnsemblGenomes-Tr; EBT00001654729.
DR   EnsemblGenomes-Tr; EBT00001654730.
DR   EnsemblGenomes-Tr; EBT00001654731.
DR   EnsemblGenomes-Tr; EBT00001654732.
DR   EnsemblGenomes-Tr; EBT00001654733.
DR   EnsemblGenomes-Tr; EBT00001654734.
DR   EnsemblGenomes-Tr; EBT00001654735.
DR   EnsemblGenomes-Tr; EBT00001654736.
DR   EnsemblGenomes-Tr; EBT00001654737.
DR   EnsemblGenomes-Tr; EBT00001654738.
DR   EnsemblGenomes-Tr; EBT00001654739.
DR   EnsemblGenomes-Tr; EBT00001654740.
DR   EnsemblGenomes-Tr; EBT00001654741.
DR   EnsemblGenomes-Tr; EBT00001654742.
DR   EnsemblGenomes-Tr; EBT00001654743.
DR   EnsemblGenomes-Tr; EBT00001654744.
DR   EnsemblGenomes-Tr; EBT00001654745.
DR   EnsemblGenomes-Tr; EBT00001654746.
DR   EnsemblGenomes-Tr; EBT00001654747.
DR   EnsemblGenomes-Tr; EBT00001654748.
DR   EnsemblGenomes-Tr; EBT00001654749.
DR   EnsemblGenomes-Tr; EBT00001654750.
DR   EnsemblGenomes-Tr; EBT00001654751.
DR   EnsemblGenomes-Tr; EBT00001654752.
DR   EnsemblGenomes-Tr; EBT00001654753.
DR   EnsemblGenomes-Tr; EBT00001654754.
DR   EnsemblGenomes-Tr; EBT00001654755.
DR   EnsemblGenomes-Tr; EBT00001654756.
DR   EnsemblGenomes-Tr; EBT00001654757.
DR   EnsemblGenomes-Tr; EBT00001654758.
DR   EnsemblGenomes-Tr; EBT00001654759.
DR   EnsemblGenomes-Tr; EBT00001654760.
DR   EnsemblGenomes-Tr; EBT00001654761.
DR   EnsemblGenomes-Tr; EBT00001654762.
DR   EnsemblGenomes-Tr; EBT00001654763.
DR   EnsemblGenomes-Tr; EBT00001654764.
DR   EnsemblGenomes-Tr; EBT00001654765.
DR   EnsemblGenomes-Tr; EBT00001654766.
DR   EnsemblGenomes-Tr; EBT00001654767.
DR   EnsemblGenomes-Tr; EBT00001654768.
DR   EnsemblGenomes-Tr; EBT00001654769.
DR   EnsemblGenomes-Tr; EBT00001654770.
DR   EnsemblGenomes-Tr; EBT00001654771.
DR   EnsemblGenomes-Tr; EBT00001654772.
DR   EnsemblGenomes-Tr; EBT00001654773.
DR   EnsemblGenomes-Tr; EBT00001654774.
DR   EnsemblGenomes-Tr; EBT00001654775.
DR   EnsemblGenomes-Tr; EBT00001654776.
DR   EnsemblGenomes-Tr; EBT00001654777.
DR   EnsemblGenomes-Tr; EBT00001654778.
DR   EnsemblGenomes-Tr; EBT00001654779.
DR   EnsemblGenomes-Tr; EBT00001654780.
DR   EnsemblGenomes-Tr; EBT00001654781.
DR   EnsemblGenomes-Tr; EBT00001654782.
DR   EnsemblGenomes-Tr; EBT00001654783.
DR   EnsemblGenomes-Tr; EBT00001654784.
DR   EnsemblGenomes-Tr; EBT00001654785.
DR   EnsemblGenomes-Tr; EBT00001654786.
DR   EnsemblGenomes-Tr; EBT00001654787.
DR   EnsemblGenomes-Tr; EBT00001654788.
DR   EnsemblGenomes-Tr; EBT00001654789.
DR   EnsemblGenomes-Tr; EBT00001654790.
DR   EnsemblGenomes-Tr; EBT00001654791.
DR   EnsemblGenomes-Tr; EBT00001654792.
DR   EnsemblGenomes-Tr; EBT00001654793.
DR   EnsemblGenomes-Tr; EBT00001654794.
DR   EnsemblGenomes-Tr; EBT00001654795.
DR   EnsemblGenomes-Tr; EBT00001654796.
DR   EnsemblGenomes-Tr; EBT00001654797.
DR   EnsemblGenomes-Tr; EBT00001654798.
DR   EnsemblGenomes-Tr; EBT00001654799.
DR   EnsemblGenomes-Tr; EBT00001654800.
DR   EnsemblGenomes-Tr; EBT00001654801.
DR   EnsemblGenomes-Tr; EBT00001654802.
DR   EnsemblGenomes-Tr; EBT00001654803.
DR   EnsemblGenomes-Tr; EBT00001654804.
DR   EnsemblGenomes-Tr; EBT00001654805.
DR   EnsemblGenomes-Tr; EBT00001654806.
DR   EnsemblGenomes-Tr; EBT00001654807.
DR   EnsemblGenomes-Tr; EBT00001654808.
DR   EnsemblGenomes-Tr; EBT00001654809.
DR   EnsemblGenomes-Tr; EBT00001654810.
DR   EnsemblGenomes-Tr; EBT00001654811.
DR   EnsemblGenomes-Tr; EBT00001654812.
DR   EnsemblGenomes-Tr; EBT00001654813.
DR   EnsemblGenomes-Tr; EBT00001654814.
DR   EnsemblGenomes-Tr; EBT00001654815.
DR   EnsemblGenomes-Tr; EBT00001654816.
DR   EnsemblGenomes-Tr; EBT00001654817.
DR   EnsemblGenomes-Tr; EBT00001654818.
DR   EnsemblGenomes-Tr; EBT00001654819.
DR   EnsemblGenomes-Tr; EBT00001654820.
DR   EnsemblGenomes-Tr; EBT00001654821.
DR   EnsemblGenomes-Tr; EBT00001654822.
DR   EnsemblGenomes-Tr; EBT00001654823.
DR   EnsemblGenomes-Tr; EBT00001654824.
DR   EnsemblGenomes-Tr; EBT00001654825.
DR   EnsemblGenomes-Tr; EBT00001654826.
DR   EnsemblGenomes-Tr; EBT00001654827.
DR   EnsemblGenomes-Tr; EBT00001654828.
DR   EnsemblGenomes-Tr; EBT00001654829.
DR   EnsemblGenomes-Tr; EBT00001654830.
DR   EnsemblGenomes-Tr; EBT00001654831.
DR   EnsemblGenomes-Tr; EBT00001654832.
DR   EnsemblGenomes-Tr; EBT00001654833.
DR   EnsemblGenomes-Tr; EBT00001654834.
DR   EnsemblGenomes-Tr; EBT00001654835.
DR   EnsemblGenomes-Tr; EBT00001654836.
DR   EnsemblGenomes-Tr; EBT00001654837.
DR   EnsemblGenomes-Tr; EBT00001654838.
DR   EnsemblGenomes-Tr; EBT00001654839.
DR   EnsemblGenomes-Tr; EBT00001654840.
DR   EnsemblGenomes-Tr; EBT00001654841.
DR   EnsemblGenomes-Tr; EBT00001654842.
DR   EnsemblGenomes-Tr; EBT00001654843.
DR   EnsemblGenomes-Tr; EBT00001654844.
DR   EnsemblGenomes-Tr; EBT00001654845.
DR   EnsemblGenomes-Tr; EBT00001654846.
DR   EnsemblGenomes-Tr; EBT00001654847.
DR   EnsemblGenomes-Tr; EBT00001654848.
DR   EnsemblGenomes-Tr; EBT00001654849.
DR   EnsemblGenomes-Tr; EBT00001654850.
DR   EnsemblGenomes-Tr; EBT00001654851.
DR   EnsemblGenomes-Tr; EBT00001654852.
DR   EnsemblGenomes-Tr; EBT00001654853.
DR   EnsemblGenomes-Tr; EBT00001654854.
DR   EnsemblGenomes-Tr; EBT00001654855.
DR   EnsemblGenomes-Tr; EBT00001654856.
DR   EnsemblGenomes-Tr; EBT00001654857.
DR   EnsemblGenomes-Tr; EBT00001654858.
DR   EnsemblGenomes-Tr; EBT00001654859.
DR   EnsemblGenomes-Tr; EBT00001654860.
DR   EnsemblGenomes-Tr; EBT00001654861.
DR   EnsemblGenomes-Tr; EBT00001654862.
DR   EnsemblGenomes-Tr; EBT00001654863.
DR   EnsemblGenomes-Tr; EBT00001654864.
DR   EnsemblGenomes-Tr; EBT00001654865.
DR   EnsemblGenomes-Tr; EBT00001654866.
DR   EnsemblGenomes-Tr; EBT00001654867.
DR   EnsemblGenomes-Tr; EBT00001654869.
DR   EnsemblGenomes-Tr; EBT00001654871.
DR   EnsemblGenomes-Tr; EBT00001654873.
DR   EnsemblGenomes-Tr; EBT00001654875.
DR   EnsemblGenomes-Tr; EBT00001654878.
DR   EnsemblGenomes-Tr; EBT00001654880.
DR   EnsemblGenomes-Tr; EBT00001654882.
DR   EnsemblGenomes-Tr; EBT00001654884.
DR   EuropePMC; PMC2976464; 20851897.
DR   EuropePMC; PMC3416521; 22636774.
DR   EuropePMC; PMC6307998; 30404970.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP002164.
DR   SILVA-SSU; CP002164.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086827
CC   Source DNA available from James G. Elkins (elkinsjg@ornl.gov)
CC   Organism available from ATCC: ATCC BAA-2073
CC   Contacts: James G. Elkins (elkinsjg@ornl.gov)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Caldicellulosiruptor sp. OB47
CC   collection_date     :: Missing
CC   lat_lon             :: 44.630844 -110.440292
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: USA
CC   environment         :: Hot spring
CC   num_replicons       :: Missing
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi07506
CC   Habitat             :: Fresh water, Hot spring
CC   Isolation Site      :: Obsidian Pool, Yellowstone National Park,
CC                          Wyoming, USA
CC   Cell Shape          :: Rod-shaped
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: 55-85 deg. C
CC   Temperature Optimum :: 78 deg. C
CC   pH                  :: 7.0
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2532343
FT                   /organism="Caldicellulosiruptor obsidiansis OB47"
FT                   /strain="OB47"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:608506"
FT   gene            117..1481
FT                   /locus_tag="COB47_0001"
FT   CDS_pept        117..1481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   ate:Athe_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41382"
FT                   /db_xref="GOA:D9TGP6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGP6"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADL41382.1"
FT                   /translation="MVDYDVNEVWEKVKEAVKKEINPSPTDISYNTWFESLVPLCFDDN
FT                   DTLILKAFADFHRDIVINRYSIVILNALRQLFSPHLSIKVILPEEVEKYKKFLKSKQDE
FT                   KLEIVTQLNPKYTFETFVVGNNNRLAHAAALAVAETPPGERTYNPLFIYGGVGLGKTHL
FT                   MHAIGHHVLKLYPGTKVMYVTSEIFTNELIAAIRDEKTDEFRLKYRNVDVLLIDDIQFL
FT                   GGKERTQEEFFHTFNTLYEANKKIILSSDRPPKEINTLEDRLRSRFEWGLITDIQPPDF
FT                   ETRIAILSKKCQLEGTPVPQHILEFIASKIETNIRELEGALNKILAYSKLMAPDKEITL
FT                   ELAEKALKEFIDTNTKKELTIEDIQAEVASYFNIRLEDFKSSRRSRNVAFPRQIAMYLA
FT                   RELTNVSLPKIGEAFGGKDHTTVLHACEKIKELINKDTNTRNAVENIKKRLIHRE"
FT   gene            1751..2326
FT                   /pseudo
FT                   /locus_tag="COB47_0002"
FT   gene            2331..3869
FT                   /locus_tag="COB47_0003"
FT   CDS_pept        2331..3869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0003"
FT                   /product="transposase"
FT                   /note="KEGG: ate:Athe_1928 transposase; TIGRFAM:
FT                   transposase ; transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41383"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGP7"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADL41383.1"
FT                   /translation="MVTVQAKLIFEGGEDKQRVLDLMRRWSSCMRYAYKRLLEGYKRNE
FT                   LKRQLQGIFNLNSRYVDDAIMKAKSVLNSCKERRESPKKVIFGGRQLFEKLQKRHINGD
FT                   QYRKLQLKWQEKRKGNLYSRGDRSKKGNLNTRIEIDGSLTKLRINVGEKEYVYATIQPG
FT                   WKVKGGTYRDRNQLLQAISTLGEPYSVELKLKNSVVYAYFTVEEIFPKSEITKSNGVIG
FT                   IDTNAYPKHIAWVETDEQGQLLEYGRIPMPELESGISSKREYYRWQYAHMIVEMAKDNQ
FT                   KAIVIEKLNIKDKGKRGDFSGRKSRRIRHYFGYRLLLEKVKLLAKREGIEVIEVNPAYT
FT                   SLIGMLKYAPQFMVSKDVAAAYVIARRGLGLRERIPHNYMMFLSRLDVNELEELKEYVR
FT                   KVVKNTYVRKKQLREIGRVIKFLQSLESEAERLSVPLDGTSTGSRGENHNLWRVLKVAV
FT                   VTPLSPDRVLRDMSVLKSLLVSGQVGKTYKGVSSCFLGQGLWLSQKPPAGAGKA"
FT   gene            3941..5047
FT                   /locus_tag="COB47_0004"
FT   CDS_pept        3941..5047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0004"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: ate:Athe_0003 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41384"
FT                   /db_xref="GOA:D9TGP8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGP8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADL41384.1"
FT                   /translation="MRFVVDKDILQDNISKVIFSAASTKVSSILECVLIEAEDSIIFTT
FT                   NDMKMQMQTEFKAEILQRGAALVKAKLFSDIVKKLPDGDVEVIREENEVKIRSQKIEFR
FT                   LPTLDPLDFPKMEKKPSESFCEFVASEFEDAIDKVIFATSKDETRPTFTGVLFEREEDE
FT                   FVNLVGMDGHRLAICKIKPVEVDGNFSKIVPADNLDDITKIIDIEEAEKVRVSFYENQA
FT                   TFEIGSTTVIVTLISGKFFDYKSAIPTEYSTKISISADVLESTLERASIVSKDEKTNIQ
FT                   AVIFETNGMMFTVRSMSADGRFEEDVLCSVEGKDIRIGFNVKYFLDVLKVLDGEINLFI
FT                   TSQTSPSIVQKPDDENYIYLVLPIKMPE"
FT   gene            5071..6132
FT                   /locus_tag="COB47_0005"
FT   CDS_pept        5071..6132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: ate:Athe_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41385"
FT                   /db_xref="GOA:D9TGP9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGP9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADL41385.1"
FT                   /translation="MIIKSIYIENFRSYHQSFFEFKDKINLIVGNNASGKTSLLEALYF
FT                   CMCGKSFKSRDVDLINFDSQYFKLEMVAEVSGVEYAVGCYVDRMLEKGIMINDKKVNRL
FT                   SELITLFKFVFFEPDTTELVKRQPKLRRRFLDMEVAKLYPYMTKVYQEYQKALLSRNAF
FT                   LKSYDKKDIIDVYDVQLSHLGFLILSKRQEVIKKLSGEAQRIFGHVFENKSLLELEYLP
FT                   SIAASSEEEYYTELKRCLIKDLNFGYTTRGVHRDDFEILIDGKPALDFASEGQIKLAAV
FT                   SVVLASAALYEKPVLILDDVFSELDCQKRKNLVMFLSQYQSFVTSAEDLRSLQSESIFD
FT                   SCSTHIILLERNI"
FT   gene            6162..6446
FT                   /locus_tag="COB47_0006"
FT   CDS_pept        6162..6446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41386"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0005"
FT                   /protein_id="ADL41386.1"
FT                   /translation="MFAHIGEDYVINSSELLVILNWDSFILSEDNRKILENLKLQDRIF
FT                   VINDEIKKSIIILEIDGRMYGIISPVSPGTIAKRLLNFNLYIDNYLDQD"
FT   gene            6480..8396
FT                   /locus_tag="COB47_0007"
FT   CDS_pept        6480..8396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0007"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: ate:Athe_0006 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41387"
FT                   /db_xref="GOA:D9TGQ1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ1"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADL41387.1"
FT                   /translation="MDRMNPGEKQEYSASEIQVLEGLEAVRKRPGMYIGSTSQRGLHHL
FT                   VYEIVDNAIDEAMAGYCKNIEVIIHKDNSVTVIDDGRGIPVDIHPKLQKSGVEVVFTVL
FT                   HAGGKFNERVYKVSGGLHGVGASVVNALSCYLEVEVYRDGKVYYQRYEKGKPVCELKVI
FT                   GTTDKTGTKVTFLPDDEIFETIEFDGDVILQRLRELAFLNKGIRIVFLDEREKNPKPVE
FT                   LKYDGGIAEFVKFLNRNKEVLHQEPIYIEGEKNDILIEVAVQYTDDFGENIYSFANNIA
FT                   TIDGGTHLIGFKTAVTKAVNEYAKKYNFIKGDTQLLGEDIRDGMTAIVSVKIHEPQFEG
FT                   QTKTKLGNSEARWAVENLVSEKLATFLEENPDVSKKIIDKAILAAKAREEAKKARELVI
FT                   KRKSALDSSNLPGKLADCSEKDPAKCEIFIVEGDSAGGSAKQGRDRRYQAILPLWGKML
FT                   NVEKASQDKIYSNDKLLPLIQALGVGIGNDIDLKKLRYHKVIIMADADVDGSHIRTLLL
FT                   TFFYRYMRPLIENGHIYIAQPPLYKITKGKQVRYAYNEKELQKILQEMKDAQVQRFKGL
FT                   GEMNAQELWETTMDPARRILLRVELEDAVMAEEIFTILMGDKVEPRREFIEKNAKYVRN
FT                   LDI"
FT   gene            8413..8523
FT                   /locus_tag="COB47_0008"
FT   CDS_pept        8413..8523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41388"
FT                   /db_xref="InterPro:IPR018739"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0007"
FT                   /protein_id="ADL41388.1"
FT                   /translation="MEVAKKIYEEVIKLPEETQREVLDFIEFKKMKWKKI"
FT   gene            8585..8965
FT                   /locus_tag="COB47_0009"
FT   CDS_pept        8585..8965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0009"
FT                   /product="death-on-curing family protein"
FT                   /note="KEGG: cbi:CLJ_0294 death-on-curing family protein;
FT                   TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41389"
FT                   /db_xref="GOA:D9TGQ3"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ3"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ADL41389.1"
FT                   /translation="MIMLSIEDVLLIAKKLIERFGGTFGIRNKGLLESSLNNAFQTFDG
FT                   EELYKTDVEKIAVISYSIIRNHPMIDGNKRLGISVLLILCKLNNIILEYTREEAVDLAV
FT                   RIAEGSIDIEDVVEWIKKHEKK"
FT   gene            8994..11423
FT                   /locus_tag="COB47_0010"
FT   CDS_pept        8994..11423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0010"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: ate:Athe_0008 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41390"
FT                   /db_xref="GOA:D9TGQ4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ4"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADL41390.1"
FT                   /translation="MEELDFRIIPVEIQEEMKKSYIDYAMSVIVSRALPDVRDGLKPVH
FT                   RRILYAMNEIGLTPDKPYRKSATVVGHVLAKYHPHGDAAVYESLVRMAQDFSMRHPLVD
FT                   GHGNFGSVDGDPPAAMRYTEARMSKIAVEMLRDIEKETVDFMPNFDESAKEPKVLPSRF
FT                   PNLLVNGSQGIAVGMATNIPPHNLAEVIDAIVYILDNENATLDDIMKIIKGPDFPTGGY
FT                   IIGKKGIRDAYATGKGKIIVRAKTSIEQTSKGRQRIIITELPYMVNKARLIEKIAELVH
FT                   EKKIDGISDIRDESDKEGLRIVIEIKKDADANVVLKQLYKNTQLQDSFGIIMLALVDNQ
FT                   PKVLTLMDMLNLYIEHQKEIIVRRTRYDLKKAEERAHILEGLKKALDHIDEIISIIRSS
FT                   KTVSEAKDRLIQRFKFTDVQAQAILDMRLQRLTGLERQKIEEELAELIKMIEYYKNVLA
FT                   SEAMVKEIIKKEILEIKEKYKDERRTKIIQDEHEDFEEEELIQEQETVVTLTHFGYIKR
FT                   LPLDTYKSQKRGGRGITGISTREDDFVEDVFVTTTHHYILFFTDKGRVFRLRAYEVPEG
FT                   SRQAKGTAIVNLIQISKDEKITATMAVKDFKEGYLMMCTKNGTIKKVLLSEFENTTKAG
FT                   KKAITLADDDSLVDVKLTSGNDEVVLVSGNGYCVVFNENDVRVMGRLAQGVKGMTLEEG
FT                   DFIVGMEKASDGKYLLCVTENGFGKRSEIEEYRKTKRGAKGVLTYKVTDKTGKIVDIKM
FT                   VNDEDEIMICSTEGIFIRLEMSQVPVQGRNTQGVKLMRIDGEDIRVSSIARIKAEE"
FT   gene            11555..12559
FT                   /locus_tag="COB47_0011"
FT   CDS_pept        11555..12559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_1226 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41391"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ5"
FT                   /inference="similar to AA sequence:KEGG:Aflv_1226"
FT                   /protein_id="ADL41391.1"
FT                   /translation="MKKLRLIVFFMILSILIMSVSFAGDIKSSIAGKDYGNGVVDKPNS
FT                   EVTYQIKDGYIYIYWGQKPTGGYLIKINEVKYTNGTLYVYFYTKSPAPTDIVTQVITYP
FT                   SDKVKLPTTEEIKEVKLINITNDMVAENGLAKRYFPLTKGSYWIYNFKIKEKDSKGNIV
FT                   EKSKKVKMQILNEYKSKDYVLYELKGDIINVAPEKRFGFISVSDNIYMVDENVLNDIIK
FT                   NIKSFDSFEKLIKKFEEDSIRIIFKFPLLSGKKYPAYSYIKREDVLYSWVVAKEKDIIL
FT                   KGKKYNQFKIEYKSLPERISIGFVYGIGITYVEYHHNGSTCDAYASLVDFKVK"
FT   sig_peptide     11555..11626
FT                   /locus_tag="COB47_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            12679..13224
FT                   /locus_tag="COB47_0012"
FT   CDS_pept        12679..13224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41392"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ6"
FT                   /inference="similar to AA sequence:KEGG:Slip_0278"
FT                   /protein_id="ADL41392.1"
FT                   /translation="MIINSLNTYSGLNIDYRIYSESEKADGKNLAIFNLSKKDTEKNSI
FT                   AEQQKEFNDPKIRFLKRIGILECKTCKNRKYQDVSNDPGVSFKTPSHISPEFSASVVLA
FT                   HEREHVAREMQNSKEKGKEVVSSSISLTLSVCPECGRVYVSGGKTKVVTKSAPKDPFIE
FT                   NYNRNIIENFGLFVDAVV"
FT   gene            complement(13308..14333)
FT                   /locus_tag="COB47_0013"
FT   CDS_pept        complement(13308..14333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_3833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41393"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_3833"
FT                   /protein_id="ADL41393.1"
FT                   /translation="MRIEQSYVKLSSEVQRIEKTESKVEFEVWHNIKTSAYSVEISDKA
FT                   KNTQKISCENNQNSQDIKDEIEISPEDKLKILLIEKLLSKITGKKIKFKLLEKLKTDQQ
FT                   DGKENIQIQTQNQIAPSGFRLSASYSRELKTDFSFSAKAIVKTQDAREISIDLNLNFSQ
FT                   SFVERFDIDIRFGMPKNVDPLVINFDGNLPSFIPKTFEFDIDIDSELEIIPLLSNRNGF
FT                   LALDKNQNGKIDNGSELFGPTSNDGFLELSQYDSDKNGWIDENDEVFSNLLVWIKTESE
FT                   DKILKIKELGIGAIFLGNTNSQYNLQNSKNNKTFGTVQKTGLFLFENGKPGILQHIDVA
FT                   I"
FT   gene            14551..15213
FT                   /locus_tag="COB47_0014"
FT   CDS_pept        14551..15213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0014"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="manually curated; KEGG: ate:Athe_0023 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41394"
FT                   /db_xref="GOA:D9TGQ8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ8"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADL41394.1"
FT                   /translation="MEITNRIPLLGEKFPSMTVKTTHGMIKLPDDYAGKWFVLFSHPGD
FT                   FTPVCTTEFVAFAKKADEFKKLNAELIGLSVDQVFAHIKWIEWIEEKLGVKIPFPVIAD
FT                   ELGTVAKTLGMIHEAKGSNTVRAVFIVDDKGILRLMMYYPQEVGRSIDEILRALKALQV
FT                   STQNGVALPENWPNNSLIGDKVIIPPAATEDLAKERLQKAKDGEIECFDWWFCYKKL"
FT   gene            15534..15725
FT                   /locus_tag="COB47_0015"
FT   CDS_pept        15534..15725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0015"
FT                   /product="integrase catalytic region"
FT                   /note="KEGG: tit:Thit_2281 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41395"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGQ9"
FT                   /inference="similar to AA sequence:KEGG:Thit_2281"
FT                   /protein_id="ADL41395.1"
FT                   /translation="MRIEVIAYDNHTTKRRRFKHLSEAERGIIEKLLELEYGIREIARE
FT                   LGRSASTISREVKRGTAT"
FT   gene            15726..15833
FT                   /locus_tag="COB47_0016"
FT   CDS_pept        15726..15833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41396"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL41396.1"
FT                   /translation="MRADREINSIECSEEHTTQNNISDFPEGKLVYIGS"
FT   gene            15972..16562
FT                   /locus_tag="COB47_0017"
FT   CDS_pept        15972..16562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0017"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ate:Athe_0024 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41397"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR1"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADL41397.1"
FT                   /translation="MPLPKKEEFYTYEDYLNWPNDQRIELIDGKIYLMAPPSTIHQRIL
FT                   REIFINFAMYLKGKQCEVFSAPFGVRFPSANEKSNKEIKTVVEPDIVVVCDKSKIDNEG
FT                   CKGAPDLIVEITSPSTASKDKIEKFNLYEKYGVKEYWIVEPESRIISVFTLQENGRYGR
FT                   PDVYTVGNRIKVSIFEDLVIDLREIFEGADKNL"
FT   gene            16660..16866
FT                   /locus_tag="COB47_0018"
FT   CDS_pept        16660..16866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41398"
FT                   /db_xref="GOA:D9TGR2"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR2"
FT                   /inference="similar to AA sequence:KEGG:CLK_0825"
FT                   /protein_id="ADL41398.1"
FT                   /translation="MKKINKFLSIGLIIIALMLLLKHFSVQLPDFFEELCYGIGVGLEL
FT                   FGIYLMFGDTSKFRNYKIRLVKK"
FT   gene            complement(17096..18619)
FT                   /locus_tag="COB47_0019"
FT   CDS_pept        complement(17096..18619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0019"
FT                   /product="KWG Leptospira repeat protein"
FT                   /note="KEGG: ate:Athe_0032 KWG Leptospira repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41399"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0032"
FT                   /protein_id="ADL41399.1"
FT                   /translation="MKRIKRLVCFLLAVVWVIGTLTLAYSQQASSQKFVYIKPQFENVL
FT                   FWPNGWISYLQGGKWGILSSSGNVLLKPQFDRIEPIVYDGPSIMGIKDKFYKDIFIVWQ
FT                   NGKAGFVDSNLKILPKPELDSFEVLNPWLSLYVCKKDDKYGFLNLDKKAYIAPQFDKIY
FT                   FVVVLSYNPNAKYSNPHIKCTLPNENNKEFCLYALDLKDGIWPNSYLEYILVSKDGKCG
FT                   AVDTNGNVFVDLKYNSFEEALSDSKFTEALQDMLANESKSAPPSTKNEIEKTSSSYILY
FT                   EIVNNKYYLVFEKYTNKGLTRTKSKEAYENVKYVEVNKLMAVCKNKKWGIVDINGNYVV
FT                   KPQFDDIKELSEGFIAFEQNGKWGFMDKNFKILIKPQFDIAENFSEGYAAVNKSGLWGY
FT                   INSSGKLVIKPQFTLAGSFFAKLATASTKDYVGLIDTKGSFVLKFSAKNSQYMFVDTET
FT                   YRYRYQPDSDLNSGGYFMYKSSLIFPKFGYVVIDKNSKKVGLVLRGQGK"
FT   sig_peptide     complement(18545..18619)
FT                   /locus_tag="COB47_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.545 at
FT                   residue 25"
FT   gene            18863..19432
FT                   /locus_tag="COB47_0020"
FT   CDS_pept        18863..19432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0020"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: ate:Athe_0033 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41400"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR4"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADL41400.1"
FT                   /translation="MKKGTKILLAILVLVVVLVVYTFSTYNSLVRLKENVDSKWSQVEN
FT                   QLQRRADLIPNLVNTVKGYAKHEKEIFETLAQARSKLLNSSTLEDKAKANDELSSAISR
FT                   LLMIVENYPNLKADRTFVQLMDELSGTENRIAVARKDYNEAVREYNMKIKVFPNVIVAR
FT                   MFGFEEKKYFEASSQAKSVPSVDFSK"
FT   sig_peptide     18863..18931
FT                   /locus_tag="COB47_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.577 at
FT                   residue 23"
FT   gene            19449..20327
FT                   /locus_tag="COB47_0021"
FT   CDS_pept        19449..20327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0021"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   csc:Csac_2589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41401"
FT                   /db_xref="GOA:D9TGR5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR5"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ADL41401.1"
FT                   /translation="MKTKPGSLLMILAMAVAIAVLSFLFASFVLAKTQIPQKPVENVYI
FT                   FDYANLIDSSDEEEMRALAKEVEDKSKAEIVVVTVETLGSYTIEEYANELFNSWGIGDK
FT                   ELNNGVLILVNKENLLSGKRGRIRIEVGYGLEGAITDGEAGRILDEYAIPAFENKEYSK
FT                   GIKNTFLAVASEVANEYGLKINSIEGFKNDKSKHSNDKSNVVMVVFVAILIGFSLSIMG
FT                   IVILLAYKNPKLFNDSQYTLWKWEKRIYFKDKFDKNDEDDDSFKWFRGGSSGGGFGGFG
FT                   GGSSGGGGASR"
FT   sig_peptide     19449..19544
FT                   /locus_tag="COB47_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            20486..22233
FT                   /pseudo
FT                   /locus_tag="COB47_0022"
FT   gene            22184..22750
FT                   /locus_tag="COB47_0023"
FT   CDS_pept        22184..22750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0023"
FT                   /product="protein of unknown function DUF820"
FT                   /note="KEGG: ate:Athe_0036 protein of unknown function
FT                   DUF820; manually curated; PFAM: protein of unknown function
FT                   DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41402"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR6"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADL41402.1"
FT                   /translation="MIFLRKTSKSDLKRISENQVYSLIDGTLFLHAAPSWQQQKVLKEL
FT                   MFIFGNYLKDRDYEIFSAPFDVFLEAKDEHEVENATTVVQPDLTIICEKSKLAKTGYIG
FT                   VPQMIIEITSPSTVRLDRVLKFNKYEEAGVKEYWVVEPENKIITCFVLEPDGRYGRPKI
FT                   FSEGDIIKVVTFPGLEIHVNKIFEI"
FT   gene            23096..24721
FT                   /pseudo
FT                   /locus_tag="COB47_0024"
FT   gene            25307..25714
FT                   /locus_tag="COB47_0025"
FT   CDS_pept        25307..25714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41403"
FT                   /db_xref="GOA:D9TGR7"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0673"
FT                   /protein_id="ADL41403.1"
FT                   /translation="MTNLKIKRLLGAIGIIIFSLCFMIAWAVSSGNYTIILPAFKGDVI
FT                   AMQDYKQTNDQFVYNKVISVGKGYKGADFWVTKQDDTRISNVTPCYPSNGTVMINLNNG
FT                   PYSKGTYIKLYAQNHELTYVDVQLNGWADLR"
FT   sig_peptide     25307..25390
FT                   /locus_tag="COB47_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.943 at
FT                   residue 28"
FT   gene            25780..26619
FT                   /locus_tag="COB47_0026"
FT   CDS_pept        25780..26619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41404"
FT                   /db_xref="GOA:D9TGR8"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR8"
FT                   /inference="similar to AA sequence:KEGG:Thit_0800"
FT                   /protein_id="ADL41404.1"
FT                   /translation="MFMDVLKFEFKKLLSRKEFNIVLMVKFILICVAFIYAVLTLYKFP
FT                   SSEIPSAYQLWICQDGVNFVNYLGDIYALFLITLPVCIAYADTYLEDRKEKVFELIITR
FT                   CKKEIYILCKAICVFLSGFIIVFFPLLLHQILCIIALPLYSISEATNGLPVYRSYFLST
FT                   QLYFFNIHVKNPYLHNILYMFLDGLFGGIVAIFSYSLSFLKKINRYVVIILPTVLFLTE
FT                   NFVAAVLHKANFSLGYYLSVTTNVVGMNYNIFSFSLIVLIMISVVIILTNVCRDDIE"
FT   gene            26616..27368
FT                   /locus_tag="COB47_0027"
FT   CDS_pept        26616..27368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41405"
FT                   /db_xref="GOA:D9TGR9"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGR9"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0839"
FT                   /protein_id="ADL41405.1"
FT                   /translation="MKLKQIYTFNLVKRFCIYVLLLTFEIGLFILMMKEIKFKENLNLD
FT                   YLFAQFSQIKYFSLYYIPLFLFVLNNLNILDNYLVFTKYTNIKDWWKEKIKKLMAETLI
FT                   YISIFASPIIIAVMVNGKKLILSNLKASIFIIIYFLIVFMLFCVVGVIYLITSFTFKKQ
FT                   YIGFAISFLVGSLDFLLSLFKYYNFAMTTSGMLADFILSFRFPLKKFLFLQFIYVGYFI
FT                   MFFILLNFISCTILEKSDLYRGDIKLER"
FT   gene            27509..28150
FT                   /locus_tag="COB47_0028"
FT   CDS_pept        27509..28150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41406"
FT                   /db_xref="GOA:D9TGS0"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS0"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0840"
FT                   /protein_id="ADL41406.1"
FT                   /translation="MNIWLTPYLLYAVPKLYVLFEMGNFFYEDFIICSVYVFTRKESRL
FT                   FWFIKKLGNISKYVFGYYTGVIVSVVVVGIIRGLKTRSFSDFVFIIISVIILNFLSSLI
FT                   FVLLTNVLSLYSNSRLSILYSVLVWTVCFLQAFVYIGNIQPLLIKLNPVLQPVIIWHDN
FT                   YFLKKYNVFEIEPIHTFDMLWSLLVLCIYLLGIILFGVRVIKTIEITDRD"
FT   gene            28172..28819
FT                   /locus_tag="COB47_0029"
FT   CDS_pept        28172..28819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0029"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: tit:Thit_0802 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41407"
FT                   /db_xref="GOA:D9TGS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41407.1"
FT                   /translation="MNAVEIRNLTKIIRGKVILNDINLELEQGKIYGFFGRNGSGKTML
FT                   FRAICGLIKPTSGEVVVFGKRIGIDVSFPDSLGLIIENVGLWGQWTGFQNLKFLASIKN
FT                   IINDNEIRAAIKRVGLDPDDKRPYRKYSLGMKQRLAIAQAIMERPQLIVLDEPTNSLDE
FT                   EGVSLVRKILLEEKERGATILIASHIKEDIDLLCDYKFKVDDGKVYCVEGGR"
FT   gene            28821..29516
FT                   /locus_tag="COB47_0030"
FT   CDS_pept        28821..29516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_0803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41408"
FT                   /db_xref="GOA:D9TGS2"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS2"
FT                   /inference="similar to AA sequence:KEGG:Thit_0803"
FT                   /protein_id="ADL41408.1"
FT                   /translation="MNKKYYVTVVFFIAISVIVAVTVRLSFIDFKSLERMNKDNFKILR
FT                   GGNILTIEKNNDIIENDNLSFSDLLNDAEVVVKGITLNERIYLHGATLTAFKVNKVYKG
FT                   NISSKKIYLFEPSYFDFKYSTFFIYNGYNLMRAGKEYILFLKNWQYKKCVQYHPFYKTK
FT                   NVYILAHNSGIDKYSVNKSFEVKIVEDDVVYYKQIKNLDFCAYTNKEAEKYNELKKEVI
FT                   VKLYNTRFN"
FT   gene            complement(29702..30646)
FT                   /locus_tag="COB47_0031"
FT   CDS_pept        complement(29702..30646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0031"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ate:Athe_2221 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41409"
FT                   /db_xref="GOA:D9TGS3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS3"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADL41409.1"
FT                   /translation="MSKIIKAQNEKFLKLLCIIKKIAETTVQRRKNSKRGRPRKFSLFQ
FT                   IIACLVYKVKRGIASFRELEYRINQDTEFKKSIGLEKSPDYSYIAKLAAKIEEDLLQAI
FT                   RDVLIAEINPDVSITIVDSTPLRSSKQDKEAKIGIHVTIGFYKGYKLHLLCTGKEEVIP
FT                   LFWILTTANKHDSTQEELLYRAWNYNSKILLADAGYDCNRWFDIANRLEIKFVAGVNRR
FT                   NMRNEENVKNRFRAENIKFLGTEEGKKLYKLRMKIEKLFSKLKGEYNLENIRLRGFKSY
FT                   KRHTDWILITFLFEQFLRKLEGKKFSFAYEWNQ"
FT   gene            complement(30873..31517)
FT                   /locus_tag="COB47_0032"
FT   CDS_pept        complement(30873..31517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0032"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="KEGG: ate:Athe_0037 proton-coupled thiamine
FT                   transporter YuaJ; TIGRFAM: proton-coupled thiamine
FT                   transporter YuaJ; PFAM: thiamine transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41410"
FT                   /db_xref="GOA:D9TGS4"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS4"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ADL41410.1"
FT                   /translation="MSYIASIFKDFAKLKWYSLAIVAVLIFISIFLYLAQKRQKFSTKA
FT                   LVYGGVAISLSFILSFIKLYRMPQGGSITPASMLPLFAYAYMFGPFAGIVAGMAYGILQ
FT                   LIQDPYVVHWAQLLLDYPLAFGALGFAGFFRKNLPLGILAGGFGRFVFHVISGVVFFAS
FT                   YAPKGTSPLVYSAIYNATYIAPDLAVCLVLALIPSVKKAIERLSKEAYIQK"
FT   gene            31803..34187
FT                   /locus_tag="COB47_0033"
FT   CDS_pept        31803..34187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0033"
FT                   /product="protein of unknown function DUF1355"
FT                   /note="PFAM: protein of unknown function DUF1355; KEGG:
FT                   ate:Athe_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41411"
FT                   /db_xref="GOA:D9TGS5"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS5"
FT                   /inference="protein motif:PFAM:PF07090"
FT                   /protein_id="ADL41411.1"
FT                   /translation="MKKRLCAAFAVIIFIFLCYVQIAPAGSFINIENIEYGIDNTLKLQ
FT                   KMAEAKITLTNSSSNNFKGKLSFERWILDNNAVIINRGSRKTKIKAFSFSKQFEIAGNS
FT                   KKVISIPVYFGNDGVAEQYFKIYTSDGRLISSVKVKPKLFYVKNCVGIFSLKGAASDLS
FT                   YVLENSGKAANVVVLSSKNFPTRESLLEMFEFIIIHNYKTSNLTEQQYQALKDYVAKGG
FT                   NLIITLGENYQKNLSVFTDDFLVGRIGKEKTGDILLKRISQKDYTRNVIVPSNQKDIVL
FT                   EKIKYVEFDLKNAEFINQKHMQRIKYGKGTVLVTSFDPFDDQITDEEKKQIFDIIVDNL
FT                   NTTFYTPANAVMGYAGNSHLYTAVNVKWPNNTMILILIVIYIIFVSFGNYFILRRLNKR
FT                   HLTWQLILVGSIVWTAIIFGVANFYRINQPNINALNFIVYNSDGKGYVVDKYYQIFAPF
FT                   KTDIKIKGIENQKIEPLLLEYENLPVGESPTNGYEYYPWQEIVFKGLPAPFMKSVKDQT
FT                   VYKADDIPLDVNFNIKDMSKITVEINNRSDYEIKNIFVVLYNSYVYIEELEPHSKVTKT
FT                   ISDVYGMLADEIRNRFYNNQSSRIKDFQLIDRETDLLCSILPKVLSNPFLIGHIENYKE
FT                   DKLNINSEVLKVHSEAVFRKDLDRVAIVKDRRIILPGSVIPNLIKNTFPNANYITPNYA
FT                   ISFYGRGELEIEYDLSGYLDRIEKVLIQMPKQYGRFNVEEFIFNVKTQRWDKTSFEKPL
FT                   AFGKDEIEKYFQDYKIKIRIVGKDDRSVTAIPLISAEGGEK"
FT   gene            34189..35121
FT                   /locus_tag="COB47_0034"
FT   CDS_pept        34189..35121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0034"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0039 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41412"
FT                   /db_xref="GOA:D9TGS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41412.1"
FT                   /translation="MALVEVEGLVKFYGKKKALDNLTFTVDSRQIFGFVGPNGAGKTTT
FT                   MKIMCGLLRADGGTVKIEGIDVAKKTNKIKFLIGYMPDFFGVYDNLKVNEYLEFFALAY
FT                   GIRGTKVQKLIDDLLELVRLTDKKYDFVDSLSRGMKQRLCLARCLIHNPLLLVLDEPAS
FT                   GMDPQSRIEMKEILKNLKDMGKTIIISSHILPELSELCTHVGIINGGRMVAQGDINQIT
FT                   LLAHGTKRIKIRFVNSFDEAYMVFKEFPAVCDIQVIEGGYILGFNGDDNDLFLLIKSLI
FT                   DEGAKVCEVSMVEGSLEEAFMKVVQGVEN"
FT   gene            35111..36049
FT                   /locus_tag="COB47_0035"
FT   CDS_pept        35111..36049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0035"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ate:Athe_0040
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41413"
FT                   /db_xref="GOA:D9TGS7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL41413.1"
FT                   /translation="MKIREIISKQGSEEVLKNIKRFLTAIFSNPIVTKEIKQRTRGLKF
FT                   SFTIAGWLLLMTLFTIMFLKSYTRSVVVISRYRSFVESFCVFLIFLFAGFFELLVVILC
FT                   SQAIAKEKENQTLDILLSTPLTNFEIVVGKMIAAAGEALILFFSAVPILVLLYFYGITS
FT                   MGNILLIMLYVFVIILFYGSLSLLLSTLIKKGIAATVIVVSIVIASTIFSYFIFVTGAQ
FT                   PFVSNSPQPGKTQNFWNLLSISLSSTFALIEFTIVRLNSDMPAFFPYHYKIRGYQIHLI
FT                   ICIVGTILNIFLSALFLSPLRRIRIFRRKPN"
FT   gene            36066..37517
FT                   /locus_tag="COB47_0036"
FT   CDS_pept        36066..37517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41414"
FT                   /db_xref="GOA:D9TGS8"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0041"
FT                   /protein_id="ADL41414.1"
FT                   /translation="MHESEMQILGFLKKVQRRQILCSFLSRLWQCVSASLSFVILVEAL
FT                   SKIVPMYYKSFYQIFILLLSLSVYTIFIISKKPALEHSALIVDSFGLKERLTTSLELIG
FT                   VDTEISRYVKQTTAQMIKDIDIKKLIKPKFEKSKWMFMALLFFVFIILSNVHSPKMDEA
FT                   KRLHLLSSLKKKEILKIEKQKKEVLKSYKLNEVEKRKIDEVLLKLKKEIKLAKTKSEIE
FT                   LTKQKAWFLLNDLKNSPTSSQFYSAVEKLKNFVAHDNKSNQSDTKNSLANTNTKSNNKS
FT                   GGSSSSSNGQSIAQKSENNKSSSAFSKGESTQDVGSSLTASNDQGQVQQEQVQSSSAEA
FT                   NGTSNDSGSGASTNTVQNASGQSAGGGMQGESKGMTRVDNLDGRSGGLGAAIPRTSNKV
FT                   QMPSIYTKNLLSLDASKKVLADTGQESGRVSQKQGIGERGQKLSFDRVFSQYKQEANEY
FT                   IEADEVPSWAKEITKRYFENLENMR"
FT   gene            37525..38502
FT                   /locus_tag="COB47_0037"
FT   CDS_pept        37525..38502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0037"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="KEGG: ate:Athe_0042 ATPase associated with various
FT                   cellular activities AAA_3; PFAM: ATPase associated with
FT                   various cellular activities AAA_3; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41415"
FT                   /db_xref="GOA:D9TGS9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS9"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADL41415.1"
FT                   /translation="MVLQDIEYTMQVLNKVESEIEKVIIGQKGVIRKVLIAIFCGGNVL
FT                   LEGLPGVGKTHLVKSIAKVLDLKFSRIQFTPDLMPSDIVGTNIISKDKDGSLNFTFQKG
FT                   PIFANIILADEINRATPKTQSALLEAMQEKTVTVMGQTYKLDEPFFVLATQNPLEQEGT
FT                   YPLPEAQQDRFLFKIEVPLPGFDEMIRIVNLTVESQMLEPQKVIEGKEILNIGRIVRQV
FT                   PIAKPVLEYATRLVLSTQPHIEENDIARKYLKFGAGPRALQHLILGAKANALFEGRPNV
FT                   AFDDIKSLAKSVLCHRIGLNFEAISEGLTQSDVVDIILQRQKEW"
FT   gene            38532..39398
FT                   /locus_tag="COB47_0038"
FT   CDS_pept        38532..39398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0038"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   ate:Athe_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41416"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT0"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADL41416.1"
FT                   /translation="MFGGLVDDKTLKKLSNQKFKFGIEITSQFEGQQKSKGRGNSLEFS
FT                   DHREYIPGDDFRKVNFRIFAATQRLYVKLFEQERQTTYNFFIDMSKSMDFGSKVKKGDM
FT                   AKALVFCLSYIALSQLDSVNIFLVRENGILPSGCLKGKQSLHKIVRFLEDANFKGEADF
FT                   ESIKNIYISRKSVSFIFSDFLFESAAEVLKVLCARCSFVCCCQILDEIEAYPSFEHIFC
FT                   QLIDSESAKVIDVELSNSLIKEYVEELRRYQNDLKEILKKANGRFYEVLTSSALEKTVL
FT                   KMIGVGR"
FT   gene            39395..41212
FT                   /locus_tag="COB47_0039"
FT   CDS_pept        39395..41212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0039"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: ate:Athe_0044 von Willebrand factor type A;
FT                   PFAM: von Willebrand factor type A; SMART: von Willebrand
FT                   factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41417"
FT                   /db_xref="GOA:D9TGT1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT1"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADL41417.1"
FT                   /translation="MSFSQPLFLLFLLTVPVLIFLYMIKPRHKKVTIPSTFLWERLKKQ
FT                   KRVAKPAQKLRFSLLLLLGIFALFSFSMYLASPNIFIKNTGKNVVFVFDNGASMSSKSD
FT                   DSKSYLQKSKEIAKDIIDMLPATAKVSIVTFSDTIEVLQKEGTRSFAKDAIDKVTQTYY
FT                   ATNLKSSLALVSKLFKPSDKTLFIFTDKNVPHLENAKLYKFPKPKDNVSIENISCVSRK
FT                   EGFDALIEIKNRGIKKASFEFELFADGRLVGLKSISLLPGKIVTFLFENIKGNYKVVWG
FT                   RINYPDQVTKDNVFWTVLEPLMAKQKVLYVGKGNFFFEKVWLTFDDVEFYKTQDVKNIA
FT                   GDFDIYIFDQCIPQKFPQKGAFIFVLPNNGSASKLLGIKIGKSASNEGYARFVKSAISQ
FT                   NIIGMDFAVQKTVSIDEKAFEPVAKIGGKPIISFGSIHNHPSILFGFALDNSDLPLKVS
FT                   FPILMANIKSAFVKKNQLFEKTAFYPGEEIRVFSYSDKKADLILPDGKREIVDLSGYPS
FT                   ILPKKDVLGVYSLILSEESKENYKFAINFPTYALDLTDDRLAKSDAHFSDTSKINSVKM
FT                   PYSLKDIFLILALIFLSLEWMVFLNENRV"
FT   gene            41196..43898
FT                   /locus_tag="COB47_0040"
FT   CDS_pept        41196..43898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0040"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: ate:Athe_0045 von Willebrand factor type A;
FT                   PFAM: von Willebrand factor type A; SMART: von Willebrand
FT                   factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41418"
FT                   /db_xref="GOA:D9TGT2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT2"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADL41418.1"
FT                   /translation="MRIEFERPFVLLAAAVLGVFIWLVSRRFSKESLGKKFVVWMRIVL
FT                   IMLMVLALSMPKLAISSDKVTTIYLVDMSESNRKNAEKMKDFIQKSIKLKKSNELQSVV
FT                   VFGQDANIEFTPTKYPNFSEFGTAVDGTQTNIENAIKYAVNLFDKDQQKRLVILTDGKE
FT                   TIGEAKNEVELLKNNGIDVKVVLFKSEKEKDVQFSSLKIPQKVFKNQAFSIFANINSTF
FT                   STEALLKIFRDNDLIFSQQVTLEKGENRFVIKDKLDKEGVFSYQGEVEVMDDEEESNNV
FT                   AYAMCQVRKPQKVLVVYENINDVKNVKSLLDSYSADYDAVKSDQANFGFDKLLGYSFVI
FT                   LCNVSRESFSGEFLSAVEKYVKDLGGGLIVIGGVNSYALGNYSNSVLEKMLPVKMEIKN
FT                   KEKEKNIDVVLVLDHSGSMADTEDAGISKLEIAKSASAKMIEHLESSDGVGVIAFDHNY
FT                   YWAYEFSKLVRKKDVIESISSIEVGGGTAIIPPLSEAVKTLKKSKAKSKLIVLLTDGMG
FT                   EQGGYEIPANEAKRNNIKITTIGVGKFVNLPVLSWIASFTSGRFYLVSNPYELVDVFLK
FT                   ETKIIKGKYMKEKKFVPKMVETNAINSGFTSYPPLYGYIATTKKDLATSLLVSDEDEPI
FT                   LTVWRYGLGKVAAWCSDLSGQWSRDWVLWDKFSQFWTKVFKWLEKGADDSSFDFNVRKE
FT                   KDLVVSLVGKFDADTIATLKCVYPNDQEKTIAMRRTAPDMFESKVDFMLGNYVFVATIS
FT                   SKDKSKVSTFFYSANYSDEFRVDVDSSRFEQFISLSGAKVIKNPNEVYAGRLKSTEEKR
FT                   DISSLLIILCIVLFLLEVSIRRFGLYPQVERYFLAISSGFKKIAKPHSLKKARDKVSFL
FT                   RKKDTYAKKSKEAEPISDDTLDVKRLRRF"
FT   gene            43984..45264
FT                   /locus_tag="COB47_0041"
FT   CDS_pept        43984..45264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0041"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: ate:Athe_0046
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41419"
FT                   /db_xref="GOA:D9TGT3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT3"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADL41419.1"
FT                   /translation="MQQIRAIVGTQWGDEGKGKIVDFLAKEADVVVRAQGGNNAGHTVE
FT                   AFGKVFKLHLIPSGILYKDKLNIIGNGVVIDPESLIQEIENLQKEGISTENLKISDRAH
FT                   LVMPYHKILDEEQERQRGEDSLGTTKRGIGPAYTDKTERTNLRVCDMLDEDEFVQKLRN
FT                   VYERKNQILTHVYHKTPMKFGELLEQFMKYGEILKPYITDTIKLLNDSIKAGKKVLLEG
FT                   AQATMLDLDYGTYPYVTSSHPTVGGFCIGAGIAPKYIQEVIGVVKAYTTRVGKGPFPTE
FT                   LLDEMGNVIREKGREYGTTTGRPRRCGWLDLVVVRYAVLINGIDRIALTKLDTLSGIPK
FT                   LKICTGYRYEGKVLDLFPASLRVAMECEPVYEEFEGWNEEEIKSAKDYDSLPKSAKRYI
FT                   EFIEKETGAKVWLIGTGPSRENIIVKE"
FT   gene            45431..47173
FT                   /locus_tag="COB47_0042"
FT   CDS_pept        45431..47173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0042"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0047 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41420"
FT                   /db_xref="GOA:D9TGT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41420.1"
FT                   /translation="MDYLKRLMKYVDECRLLIFVGLILALVGIFCNMTVPKISKHIIDD
FT                   VLVAKRFGKLGYFASIFAGLIILKAIVAYFQNYIFEYTSQKALYRLREQLYTKLQYQSF
FT                   EYYDRASTGAIMNRMVGDLEAIRNFLNQSFVQVVSIAITIVAALSIMFSMNLFLSILSI
FT                   ATAPLIFLNVKSLAKKLQPTFKAIRTSFERLTSKVQENITGIRVVKAFGNEDLEKKSFE
FT                   KVAYDFTEKNIKAADIRSVHNPVAGFLNGLNSVIILIVGGYFAIKGKISIGTLFAFVSY
FT                   VNMFSAPIGNIQNLVNQWQNAFASLEKVFEVLDSDVTIKSPKNGVVLKNVRGDIKFENV
FT                   YFKYREKFVLKEINIHIKPGEVVAILGQAGSGKSSLINLLARFYDPSSGRVLIDDIDVK
FT                   NIKLCSLRRNIGIIMQEPFIFSDTIAANIAFGKPDATDEEIRIAAKLARADEFIENLPD
FT                   GYNTVVGERGVGLSGGQKQRIAIARALVYNPRILVLDDATSSLDFETEAEIQETLKEVI
FT                   KGRTTIIITHRISQLVVDADMIYYMHGGRIVEQGKHEDLMKIKGRYYSTFKKQLIERAN
FT                   TLPA"
FT   gene            47203..48999
FT                   /locus_tag="COB47_0043"
FT   CDS_pept        47203..48999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0043"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0048 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41421"
FT                   /db_xref="GOA:D9TGT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41421.1"
FT                   /translation="MSDSGARRPIFSQEETTYELKIPHLKRLFKFLIPYKKWLLLTLVF
FT                   MFVATVADLISPYLLKQAVDIYIPKKNFKGILIIGFLMILMLFINKECSKNKIRLANRT
FT                   GQMVLFDIRKALFDHIQNLSFSFFDRNSTGRITVRIVNDVNTLNNLFTNGIVNVVTDMS
FT                   TLIIATVIMFSINFKLALVTFSVIPVFLAVLFATRNAIKRNWRQVRRKISNLNAYIHEN
FT                   ISGIRVIQAYVRQKVNRSIFKEVIDDVFLSWMKAVKVNGIFAPAVEVCSMIGTLIIYFY
FT                   GVKLLKINGVTVGTLIAFVSYLDRFWRPVVTLSNFYNQLLVASASSERIFEVLAIEPEI
FT                   KEDENPVYIEDFKDRIEFKNVWFAYKDEEYVLKDVSFEIKKGTMVALVGATGSGKTTIA
FT                   NLLARFYDPTKGSILIYGIDLRKISFKSLRKLIGIVQQEPFLFSGSILENILYGRPDAK
FT                   FEDVVRVCKFLGIHEFISELENGYDTQVSERGTRLSTGQKQLICLARVMLQNPPILILD
FT                   EATASLDTQSEIMVQNALSKVMKDRTSVVIAHRLSTIKDADLIIVMEKGKIAQMGNHEE
FT                   LIKKKGIYYDLCMSQIRFVKAS"
FT   gene            49082..49157
FT                   /locus_tag="COB47_R0001"
FT                   /note="tRNA-Lys1"
FT   tRNA            49082..49157
FT                   /locus_tag="COB47_R0001"
FT                   /product="tRNA-Lys"
FT   gene            49180..49254
FT                   /locus_tag="COB47_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            49180..49254
FT                   /locus_tag="COB47_R0002"
FT                   /product="tRNA-Glu"
FT   gene            complement(49257..49832)
FT                   /locus_tag="COB47_0044"
FT   CDS_pept        complement(49257..49832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0044"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: ate:Athe_0049 protein of unknown
FT                   function DUF95 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41422"
FT                   /db_xref="GOA:D9TGT6"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT6"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADL41422.1"
FT                   /translation="MKFVFQTFKAEKRLIFISFLIFALSCILGILIGVFFGDEIQKFID
FT                   QYLRKLFESIIKDAKSPYLLFIGILKNNMKVYFIIITLGTLSFGLISALVLFTNGVIVG
FT                   AIGAISAKHMSIAKTLLLILPHGIFEIAAFLIGSAASTIFLESAVLSKEKPDIKLSFKR
FT                   FFVLAVCGAILVVFAAFIEAFVTLRFAK"
FT   gene            50054..50632
FT                   /pseudo
FT                   /locus_tag="COB47_0045"
FT   gene            50634..52172
FT                   /locus_tag="COB47_0046"
FT   CDS_pept        50634..52172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0046"
FT                   /product="transposase"
FT                   /note="KEGG: ate:Athe_0076 transposase; TIGRFAM:
FT                   transposase ; transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41423"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT7"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADL41423.1"
FT                   /translation="MVTVQAKLIFEGGEDKQRVLDLMRRWSSCMRYAYKRLLEGYKRNE
FT                   LKRQLQGIFNLNSRYVDDAIMKAKSVLNSCKERGESPKKVIFGGRQLFEKLQKRHINGD
FT                   QYRKLQLKWQEKRKGNLYSRGDRSKKGNLNTRIEIDGSLTKLRINVGEKEYVYATIQPG
FT                   WKVKGGTYTDRNQLLQAIGTCGEPYSVELKLKNGKIYAYFTVEEVFPRPAMTRTSGVIG
FT                   IDTNAYPRHVAWTETDKSGQLLEYGRIPMPELESGSSSKREYYRWQYAYMIVEMAKDNQ
FT                   KALVIEKLNIKDKGKRGDFSGRKSRRIRHYFGYRSLLEKVKLLAKREGVEVIEVNPAYT
FT                   SVIGMLKYAPQFMVSKDVAAAYVIARRGLGLRERIPHNYMMFLSRLDVNELEELKEYVR
FT                   KVVKNTYVRKKQLREIDRAKKFLQSLGSEAERLSVPLDGTSAGSRGKNHNLWRVLRVAV
FT                   VTPLSPDRVLRDMSVLKSLLVSGQVGKTYKGVSSCFLGQGLWLSQIPPAGAGKA"
FT   gene            52249..52881
FT                   /locus_tag="COB47_0047"
FT   CDS_pept        52249..52881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0047"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: ate:Athe_0050 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41424"
FT                   /db_xref="GOA:D9TGT8"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0050"
FT                   /protein_id="ADL41424.1"
FT                   /translation="MKITYLAHASFLIETESRVKIITDPYDSSVGYTVFELSADVVLTS
FT                   HKHFDHAYTKSLKGDYVLVDKEGEFNVKGVKIKGIKTFHDKEKGQKRGENIVFVIEDKF
FT                   SVAHLGDLGHELAETELEKMGRVDILLIPVGGVYTINAKEALNVAKAINPKIIIPMHYK
FT                   TEKLKFDLGKVEEFTKHFEDVEVLQTSEIEINSLPEKQKVLVLKYKG"
FT   gene            52897..55104
FT                   /locus_tag="COB47_0048"
FT   CDS_pept        52897..55104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0048"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ate:Athe_0051
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41425"
FT                   /db_xref="GOA:D9TGT9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGT9"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADL41425.1"
FT                   /translation="MAKKSERKSISQSANKFGESETSIFPGKTLAAYKAFVLFAFCVLV
FT                   LMSPYYRGLYFDYELSVFQAIMAGIFILFAIYLYFSKEGFLVNSKLELILRLFMVAYIV
FT                   PYFFAANRRLALGEFFKYAFYFAVFYIASRISKGKAEKFAILNTLFLSTVGVAFFGYQA
FT                   AVKLIPETARPLGMAMNGLWVGNMINSTLQYHNTAGTVLAFGFIISLMLAIYSENKLLK
FT                   SFYFAFSSFIFTAFFYTYSRGSYITLLLALLVFFLLLPREKRISLIFNIAIIGAFVIAF
FT                   LNKVGANLNEHGKVKLWLLLLFQMLLVFVLTYAFGFVERRLYGISNNIYIAGAAVVGIL
FT                   AIIGFAIALKTHLIPSDMVEKMKSIAMFWKERNFVERMVFYKDGLKIFLKSPVFGYGGG
FT                   AWVSLYFMYQSYLYFTTQSHNYFLQVLLDTGIVGFCILLIFLWFLFSTSLRAWAKKEQK
FT                   ENIIIAGLVAAAVQLYFHSALDFDFSLASVQVLLFAGLGVLVSTSLQILQKHKQEKVIY
FT                   TGKTTNFVSALLAIFYLLMIVISLNFRLGNYYANIGQQALQMGNLSAAYSFLSKAVTYD
FT                   PLSSNALSDYAVALYRIGDQNKDANLIAKADGYFKQAIVNDRFNAKIRFKYAVYLLSHG
FT                   AIDSGLSQIEEGIKLQPLQPANYELKADAYAKVGDYYLGKGDKEKAKKYYEVVLKIPEE
FT                   IERLKKYREHIPKELIGQEKIVPFAMTQRTQQIIEEVKKKI"
FT   gene            55137..55928
FT                   /locus_tag="COB47_0049"
FT   CDS_pept        55137..55928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0049"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ate:Athe_0052
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41426"
FT                   /db_xref="GOA:D9TGU0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL41426.1"
FT                   /translation="MNRFLANFLKYRDLLYELVLRDIKIKYRRSILGMFWSLLNPLLMM
FT                   IVLTIVFSHLFRFDIKNYPIYLLTGQIMFAFFSESTSSAMRAIIDNASLIKKVYIPKYI
FT                   FPVSKVLSSFFNLIFSLLAIVLVTIGMIVLGNNVNLSWTFLLFPIPLLFILIFSIGIGL
FT                   ILSCYAVFFRDLIHLYSVGLTAWMYLTPIFYPVSIIPQKYLTLIKLNPMYYFIEYFRKV
FT                   TFYGTLPTLKETLICILVDIIFLVIGLLVFYRKQNKFILYV"
FT   gene            55960..56694
FT                   /locus_tag="COB47_0050"
FT   CDS_pept        55960..56694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0050"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0053 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41427"
FT                   /db_xref="GOA:D9TGU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41427.1"
FT                   /translation="MDKNTAVKIENVSMMFNMASEKIYSIKEYFIKLVSGKLYFQEFWA
FT                   LRDISFEIKKGEIFGIIGLNGAGKSTLLKIIAGVLKPTMGRVYVNGTMAPLIELGAGFD
FT                   FELTARENIFLNGAILGYSRKFMKEKFDEIVEFAELRDFLDVPLKNFSSGMQARLGFAI
FT                   ATIVDPDILIVDEILAVGDFHFQEKCERRINSMLEKGTTIVMVSHSIDQIERMCQRVLW
FT                   LEKGRMKMIGNAKEVCEAYRNS"
FT   gene            56739..57470
FT                   /locus_tag="COB47_0051"
FT   CDS_pept        56739..57470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0051"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: ate:Athe_0054
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41428"
FT                   /db_xref="GOA:D9TGU2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU2"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADL41428.1"
FT                   /translation="MKGIVLAGGTGSRLYPLTKVTNKHLLPVGKYPMIYYPIFKLKQAG
FT                   IKEIMIITGKEHMGAVVNLLGSGREFGLEFTYRIQDEPGGIAQALGLCSFFVGNDKCVV
FT                   ILGDNIFEDDISEYVRNFEKQEKGARILLKEVPDPHRFGVAELKDGKIISIEEKPRNPK
FT                   SNYIVTGIYMYDSKVFDIIKTLKPSQRGELEITDVNNEYIRRGELYFDFLKGWWTDAGT
FT                   FESLKRANELAENMVLDFNGI"
FT   gene            57492..57953
FT                   /locus_tag="COB47_0052"
FT   CDS_pept        57492..57953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0052"
FT                   /product="dTDP-4-dehydrorhamnose 35-epimerase related"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose 35-epimerase related;
FT                   KEGG: ate:Athe_0055 dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41429"
FT                   /db_xref="GOA:D9TGU3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU3"
FT                   /inference="protein motif:PFAM:PF00908"
FT                   /protein_id="ADL41429.1"
FT                   /translation="MELIEGVKVKRLEKFADDRGFFMEILRDEDGLLEKFGQASMSLTY
FT                   PGVIKAFHYHKLQDDVWFFPKGNAQVVLYDLRPDSPTYKKTNVFYMGEHNPIVLLIPKM
FT                   VAHGYRVLGNEPAIIVYFTTEHYNRENPDEYRIPWDDKEINFDWTTKFR"
FT   gene            57969..58919
FT                   /locus_tag="COB47_0053"
FT   CDS_pept        57969..58919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0053"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: ate:Athe_0056 dTDP-glucose 4,6-dehydratase;
FT                   TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41430"
FT                   /db_xref="GOA:D9TGU4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU4"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ADL41430.1"
FT                   /translation="METILVTGGAGFIGSNFVKYMISKEEYKIINYDALTYAGNLENLK
FT                   EVENHPYYTFIKGDIVDRAKVEEVFKNYQIDYVINFAAESHVDRSIKDPDIFVKTNVLG
FT                   TQVLLDVSRKFGIKKFIQISTDEVYGSLGPEGYFTEESPLAPNSPYSASKAGADMLVRA
FT                   YFKTYGLPVNITRCSNNFGPHQHPEKFIPTVILNALQDKPIPIYGDGQNIRDWLYVEDH
FT                   CRAIELVFKKGRIGEVYNIGGNNEWKNIDIAKLILKLLGKPESLIQFVADRPGHDRRYA
FT                   IDSSKIQKELGWKVEYRFEKALLKTIEWYAKYPNK"
FT   gene            59087..60292
FT                   /locus_tag="COB47_0054"
FT   CDS_pept        59087..60292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0054"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ter:Tery_4437 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41431"
FT                   /db_xref="GOA:D9TGU5"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADL41431.1"
FT                   /translation="MKNILRKSVVVLKEEGVKGLLGRVQQKMKNINQPTTYDFYSFITY
FT                   ARKSEWEEKEINENEKLKINWIIPAFNIGSGGHMTIFRMIHYLDKWGYQNYLTIIPPYL
FT                   IQKKETIRELVDKHFINIGNTIVYLWGEKLPPVDVTFATSWQTAYYVNSIKNTYQKFYF
FT                   VQDYEPIFYPMSAEYLFAEATYSFKYKYITAGKWLCKILKEKYGVIGDYFELGFDPQIY
FT                   NIKNIQRSKNTIVFYARRETPRRAYELGILALKLVKEKRPKTEIIFFGSNLRHNPGFSI
FT                   EDKGVLSSAQLSMLYNYATVGVVFSLTNYSLIPIEMIACGLPVIEVKSECNKLVFEEVP
FT                   GITLVEPDPFVIAERIIEVIDNPSVFHSKLYKEVDKLEHLTWEKQARKVEKLIYALSKI
FT                   KY"
FT   gene            60341..61330
FT                   /locus_tag="COB47_0055"
FT   CDS_pept        60341..61330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0055"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tpd:Teth39_1631 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41432"
FT                   /db_xref="GOA:D9TGU6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41432.1"
FT                   /translation="MDVKISIVIPTLNAEKYIRTQIERIFAQTIKPCEVIYIDSTSNDN
FT                   TQKIILEYIEKNLPIKLKIIKREEFNHGRTRNEGAFLSRGNIIVFMTQDAIPYNEVWLE
FT                   NLIKPFGVRDDVACVFARQMPFVDATPIIKRELINHFNSFKSEDSDYTFQKVDFNDRNS
FT                   LKVYNEKKHWFWFNSNVCSAVRKDIFLQIKFKEIPYAEDQVFGKEIIEKGFCKVYAHNA
FT                   IVLHSHNYTLINFFKRYFDEYRGLKVSLDIDLVNKYNVLKVIFGNIVQDVKYIFNNVDK
FT                   RRVYWLIYSILFEILRGGGAFLGSNYDKIPLSLQKYLSLEGKAIKPPR"
FT   gene            61366..62376
FT                   /locus_tag="COB47_0056"
FT   CDS_pept        61366..62376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0056"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ate:Athe_0059 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41433"
FT                   /db_xref="GOA:D9TGU7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41433.1"
FT                   /translation="MNNIEVIIPTLLKNMYIFNVLSSLKNIKGKKGNINVTVINNTNMQ
FT                   ITNEAKFINLNIKEILLGDNQGFSKAVNIGINVTKEKLIFLINDDAMIYNAFEIKQIED
FT                   LFEKHEDIFSLSCKMISHDFPNLLDDAGDMYTILGWQFKRGNGLPKELYDRPCEIISSC
FT                   GGAAIYNKKILDEIGYFDEDFFAYLEDVDLGLRALMRGYKNLYYPYISVLHVGSATTGG
FT                   KYNDITIRLTARNSIYVIYKNLPLPLLIINFPFILLGYLIKFIFFAKKGKGKIYISGVL
FT                   EGLKNLPKFKEKRKENMRKKEISNIKLEWILIKATFEYFHQYVKRTLYNLRGAKK"
FT   gene            62373..63218
FT                   /locus_tag="COB47_0057"
FT   CDS_pept        62373..63218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0057"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="KEGG: ate:Athe_0060 dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41434"
FT                   /db_xref="GOA:D9TGU8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU8"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ADL41434.1"
FT                   /translation="MILITGSKGQLGSEFIKQFENKYNVKGIDIEQVDITDLDSTVNYI
FT                   SAIKPSIIIHCAAYTNVDGCERDKDIAFKVNAIGIRNVAMAAEKVGAKLVYISTDYVFD
FT                   GEKEKPYNEFDRPNPISIYGLSKLAGEEFVKTFCSRYFIVRIAWLYGENGNNFVKTIVK
FT                   LAKEKGEIDVVNDQRGNPTFTKDVVQAVEVMMNSEKYGIYHVTNEGIASWYDFACKIVD
FT                   TFGINCKVNPTTSDKFIRPAKRPKNSALDKMMLRLEFGYKMRRWEEAFEEFAMLMKGRI
FT                   "
FT   gene            63219..64109
FT                   /locus_tag="COB47_0058"
FT   CDS_pept        63219..64109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0058"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ate:Athe_0061 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41435"
FT                   /db_xref="GOA:D9TGU9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGU9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41435.1"
FT                   /translation="MDLSIIIVNYNTRNLLRKTLESIYKNPTYRELEIIVVDNASSDGS
FT                   QEMVKKEFPDVILIENKQNLGFAKANNIGIRIAKGKYILLLNSDTEVLKGTLDSCIDFL
FT                   EKDEAKEIGILGCKVVLSDGKLDLACRRGFPTPKNSFFKIFGFAKLFPKSRFFAGYNLT
FT                   YLDENQSYEVDSVVGAFMLIRREVIDKIGLLDEDYFMFGEDIDFCFRAKQNGFKVYYYA
FT                   DAKIIHHKRGSGRNLKVLSAFYDSMWIFYRKHYYDKYPKSLALLIFVTIKLIKFLKLVQ
FT                   TKIKNTFSERKKGHA"
FT   gene            64102..65475
FT                   /locus_tag="COB47_0059"
FT   CDS_pept        64102..65475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0059"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; KEGG: ate:Athe_0062
FT                   undecaprenyl-phosphate glucose phosphotransferase; PFAM:
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41436"
FT                   /db_xref="GOA:D9TGV0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV0"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ADL41436.1"
FT                   /translation="MHSLKSLYANLNKVFDIVVVFLSFFIAWFIKFESNLFPKVGHLDV
FT                   ENYLLILAIFLPSYFLLALISKVYQPAAKSSALRVSLKLFRANVISLAVVVIIFYIIKQ
FT                   VDYSRIFLALFTLINFTLSLISRYILIRLIISNKTKFIKQENILIIGANDLSDNLILKI
FT                   KTSPYVEYNVIGIIDDYSKSALAKSSELENVIKMHHVDEIIIALRLEEYKKLPWIINIC
FT                   EKYGIRTYIIPDYLRYIPSKAQIEEFEGIPLINIRYSPLDEWTNRFIKRSFDIVVSLIG
FT                   LILCLPLFIIIAILIKLTSKGPVLFTQERVGYNRRIFKMHKFRTMYVQDPDEEKVRWTT
FT                   KDDPRRTPIGRILRRLSLDELPQLWDVLVGNMSLVGPRPERPYFVEKFKEEIPKYMIKH
FT                   RVRPGITGWAQIHGLRGDTSIEERIKYDIWYIENWSFWLDIKIILATIFGGKFMENAY"
FT   gene            65568..66159
FT                   /pseudo
FT                   /locus_tag="COB47_0060"
FT   gene            complement(66270..66815)
FT                   /locus_tag="COB47_0061"
FT   CDS_pept        complement(66270..66815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0061"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: ate:Athe_0064 Appr-1-p processing domain
FT                   protein; PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41437"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV1"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADL41437.1"
FT                   /translation="MSAKEILQKIIIKKGDITKEQVDAIVNAANSHLKHGGGVALAIVR
FT                   AGGQEIQKESDEIIKKIGFLPTGNAVITNAYRLPCKFVIHTVGPIYGEGNEDEKLSRAI
FT                   YNSLYLAHLYNLKSIALPAVSSGIFGFPKDRCAKILIDTSIDFLSSIKTSIEKVVFCLF
FT                   DDETFNYFLSYYNSKFSS"
FT   gene            complement(66836..67210)
FT                   /locus_tag="COB47_0062"
FT   CDS_pept        complement(66836..67210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41438"
FT                   /db_xref="GOA:D9TGV2"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0065"
FT                   /protein_id="ADL41438.1"
FT                   /translation="MKVTLIFVLGLLSGIGLIIICNKLRFPFKKKKPLIKIAPEQKSFD
FT                   ELVQVYNSVSQDIKRNLEEYSSFPTTDCGKLLAASLFTQVTVCLSILSSLEKFGIDTKA
FT                   VFDEIVSKNKAQQTSQLKNF"
FT   gene            67542..72866
FT                   /locus_tag="COB47_0063"
FT   CDS_pept        67542..72866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0063"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: ate:Athe_0077 S-layer domain protein; PFAM:
FT                   transglutaminase domain-containing protein; S-layer
FT                   domain-containing protein; Ig domain protein group 1 domain
FT                   protein; SMART: transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41439"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV3"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADL41439.1"
FT                   /translation="MHSFRKGIAVIAVFAFVFNFIFPIAAVQAAFKDINSNYWAKDLIE
FT                   KWGNTYQVVKGYSDGTFKPSQYISRAEFAKLLANVIREISIDAGINFKDVKKTDWYYSA
FT                   LNSLSRYITGYNDQTFKPNKNITREEAAVICARVFGIDQINDNNVLSAFKDADEISSWS
FT                   RNYVAALVQKNYIKGYPDNTFKPKKFITRAEALSILDNIIGLLLYKEGYYTSKEVKGNL
FT                   VINKSGVRINGFSVNGNVIIAEGVGKGSVKIENSNINGSIIIRGGGEHSVTLENVKAQK
FT                   VKVDNIQAATRVIVSGNSNIEKVEVKENAIIENLSKLPIKSIVISSNESSSISVSIKGN
FT                   AERVEIISARAEVNITQGNINKVIIQNQANLKVETNSKIQELTVNSQNVNILSQGMIEK
FT                   IQVNEERVYVNNNEVTKGQIVTVIDGKTEKIQNQQQTSSQSNTSSTSSQTTSNNTASLS
FT                   EGGSQGSVGSIGSTTSSSSGQTGGTSSGTTGSLPSGSTGVSSSGIVALVSVDKETITVG
FT                   QDNTVSVTVKDAQGNPLAGKLVTIEGKSSYTNSNGVATISLNVFESKELIINVDGKNYG
FT                   GLLYAIKPTEGVIKLKLKTATDIYENQFNVKVVGRSSQFSQTYQVNTTELGVIVPVGND
FT                   YKILAWKYAAEKGLIYALLEEVNVVSGMNRIVVDTTTSEFVNATISFSYENKALTDYEF
FT                   SVANSTYSDVFTTDDVKVNLQNSQINIIANKGTYTIKVAKEINGEKLYFVRTCQLNTSG
FT                   ATLQFAFTSLKKLTFTFNGLFNLTSVAESVYVKLNNQRYQLSDDLSVYLPKGTYTLDEV
FT                   VVNVYDANNSHLRYTFAVDKNNSPLSIDLTSSNEEVTKEIDFNINESESNFIVCNVNDE
FT                   KITSLKARSVAVLYENVKTVSGYNLDVVVNDVYSNFLGFEIPYGTNISLQDGAQLRPLS
FT                   VLATKILENNVCATLFYTPSEIADGNYTLVVQKDLGPLYENRVLAESYSFEINSNGDAS
FT                   GYAEQTSNESEIVEKVSYKIDSTADDVMFISVPTNLQIADYNQLCQNIFMNLMRNYPLA
FT                   LDYGVSDVIGVRFFTGEVEDVMMFIIPYIYEKQERIARRQAVFQKAQEIVQTVIDRTYN
FT                   EYDKALALHDYLILHTRYDMESYLNRSGPFDIHTAYGALINGLAVCDGYAKAMYVLLNT
FT                   AGIETIVVYGEAGDVASKVGHAWNMVKLDGDWYQLDVTWDDRDSLGGVEIDYSYFNVTD
FT                   DDISSDHWWDKSLYPTCTSTNYRYGNYYKAEIVPEVVYYNLPNTVQIVVKDYKGNPQPE
FT                   RLITVTYYDLTTQSDEVAFVGYTDQEGKVVFDVTPDEFTSYKIYVTPRMEPKGYIDVVE
FT                   KLKPVTIKFNINGTTVTQFGLVRNGKELFYTNDGQIPVDMSIYFDNNITLFGEGFVVKR
FT                   SLSVDGYDPEEVTVFNDIYYDASVQLHVYDGTTDIVGASVYIVDKDTYKELFVGTTDTA
FT                   GRLPLIITKGEYVAKIVYGDGDEDFKNYAYAKLNAFEDSQIDLDLAKFSTVQFIPHFTE
FT                   GGLHLNDRLYIGFETSASYAKIATFIGKRREAKFAPGDYGYVWVFAHNPYYDDPRSLGY
FT                   KPTEKLVIPAEPQIITYDLGIDASKIAIKSIYKFNPETWKFEPTTLDSVYQGDVLKLDI
FT                   YIPTYSHYIIGETGICMEMTYDNQPSISFISSDIPYPISAVIKTQDLSENNIEVFFPGF
FT                   DERTDTWSIILAGVNGDLNSTLIINLPFVPYDGNYTLQSPIKVYQAQSSSSGGSPRRTF
FT                   IKMLQLKNNFKQINPVKK"
FT   gene            73077..74711
FT                   /locus_tag="COB47_0064"
FT   CDS_pept        73077..74711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0064"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: ate:Athe_0078 CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41440"
FT                   /db_xref="GOA:D9TGV4"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV4"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADL41440.1"
FT                   /translation="MEKQVKYIFVTGGVVSGLGKGITAASIGRLLKARGLKVTMQKFDP
FT                   YINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLTKNSNVTTGKIYWSVIQR
FT                   ERRGDFLGGTVQVIPHITNEIKERIYRLGKSNSTDVVITEIGGTVGDIESLPFLEAIRQ
FT                   VATDIGKENVLYVHVTLVPYLSKSGELKTKPTQHSVKELRSIGIQPDIIVCRTEKPLSQ
FT                   DLKAKIALFCNLKPEYVIQNIDAESLYEVPLMLEKEGLGEIICEKLGFVCTKPDLSDWI
FT                   EIVEKEKNLKKNVKIALVGKYVELHDAYLSVAEALKHAGIANDSHVEILWINAEEVTYE
FT                   NAHEKLKSADGILVPGGFGDRGIEGKIAAIRYARENKIPFFGICLGMQCAVIEFARNVL
FT                   GLEGANSTEFDETTPYPVIDIMPEQKDIFTKGGTMRLGLYPCKLEEGTLAHRIYNDELV
FT                   YERHRHRYEFNNEFKERFKQAGMVFSGVSPDRRLVEIIELKDHPWFLGVQFHPEFKSRP
FT                   QRPHPIFTDFIRASLEHKAKKGGYEDF"
FT   gene            complement(74724..75212)
FT                   /locus_tag="COB47_0065"
FT   CDS_pept        complement(74724..75212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41441"
FT                   /db_xref="GOA:D9TGV5"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0079"
FT                   /protein_id="ADL41441.1"
FT                   /translation="MENRNVAFEIFLWLLIYLCFFAGINLFSKDNILLFVWSFISLLII
FT                   FLITIILRFYITSTLLLLPGFIISCVLAILFMFNVRFPNFFVLLLQVFSIHLMGFVEFV
FT                   RQSSEMVILQRPLYIYIHVGLNLVLFLIHLFVIYLLSELPRQQKPKTLDLTYTRRRRR"
FT   gene            75406..76098
FT                   /locus_tag="COB47_0066"
FT   CDS_pept        75406..76098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0066"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ate:Athe_0080 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41442"
FT                   /db_xref="GOA:D9TGV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41442.1"
FT                   /translation="MSKAHILVVDDEKPIVDIIKFNLEKEGYKVTTSYDGEDALNRIKS
FT                   GNFDMVLLDVMLPKIDGFSVCKKVREFSDVPIIMITAKADEVDKVLGLELGADDYITKP
FT                   FGIRELIARIRANLRRTAQSSAQDGKVLKAGALTLNPETFEVKKNGKIIELTVREYELL
FT                   KFLMSQKGQVFSREELLEKVWDYEYYGDVRTVDVTVRRLREKIEDNPSEPTFILTKRGI
FT                   GYYFNPNI"
FT   gene            76122..77822
FT                   /locus_tag="COB47_0067"
FT   CDS_pept        76122..77822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0067"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ate:Athe_0081 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; PAS fold
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41443"
FT                   /db_xref="GOA:D9TGV7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL41443.1"
FT                   /translation="MTRSIESRLILVFGLLILMVMFISSFFIIDRTKNYFYEDVQKKIE
FT                   FMVSSSLIRLLEDKNLTQERIQTIVDQSMKESQYGFMIQKLIVTDSRGKVVASFPRMDI
FT                   SFFPSDEILTSLAGYKVVKREVEDQAMVFAFPIKSGRSVERALYLEVSVQNILATVTDI
FT                   KNILLMAYIVAMLFSLFIGLLFAKTLSNPLRKLTKQALEMAEGNLDVKIEVSSQDEIGK
FT                   LASAFRTMATNVKKYISELEFEKQKLERILQNMSDGVLAVNSKNEIIHINESAKKFLKG
FT                   DVKKFLEYIQNEENRSVTQHIYEVDGWTLEVSTAAFIDSYHGNGTIFILHDITQQAKLD
FT                   QMRKQFVADVSHELRTPITTIKTYSETLLDVDDETVKREFLSVIIKECDRMTRLITDLL
FT                   YLSRLDSGENILKIEEVNVSELVRFVCEKMRIHAKKKNQKLLCSAEENVVIEADRDRLE
FT                   QVLINLINNAVVYVQEGGQIEVGLKKDGSYVKITVDDNGPGIPEDDLPRIFERFYRVDK
FT                   ARSRSLGGSGLGLSIADEIVKAHGGKIQVESRVGVGTKFTVILPVKNTV"
FT   gene            77923..78411
FT                   /locus_tag="COB47_0068"
FT   CDS_pept        77923..78411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41444"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0082"
FT                   /protein_id="ADL41444.1"
FT                   /translation="MKKLALILSMLFILSIATIAFAGDEKDLKKAKNINSIEIDGSKIT
FT                   STVSSLVEIAEYESQLTTSIFVLSGKASEGVEISIYTKKDKKEAFSQQGLVDKFQVGKS
FT                   GYFAKKINVDEGTTYILVVAKKDKDTQISLIKVFYEKKESFFTKVEKAISNFVSSLGK"
FT   sig_peptide     77923..77991
FT                   /locus_tag="COB47_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            78430..79728
FT                   /locus_tag="COB47_0069"
FT   CDS_pept        78430..79728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41445"
FT                   /db_xref="GOA:D9TGV9"
FT                   /db_xref="InterPro:IPR009996"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGV9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0083"
FT                   /protein_id="ADL41445.1"
FT                   /translation="MRKSKVEVIKSIVLSILVILSIYLYYKVYFDYNVEDIVKAIDIYQ
FT                   NSQSDQQLLKKAREILASPKEMYLNISKNVVVRILSNQSQYSQVVSKFIEGIEKSLVKK
FT                   EFEISQKNISANFFKQRRVLILSYGYEIDFITFVYELTKRNIGNLVQGFKFDRIFIEEN
FT                   GKGTVLYFFNSQEQRAAILRFSPFGFLPLENLIEKDLKLVYSWSDSLGFTEIANKDILI
FT                   PVEFSDVQFSEIKTRESSYKKELIVRRLFPDTILTRKNILKNGDVVITDERRTLKLKND
FT                   GGFVFEYSESAFGEKVDSISDALMFYLKTFYAEEDLRVCRLEFKKEDDFEIYLMTRANG
FT                   IDVVAGDGEFCAKIEVQGGRLQEISGDLFDILKVRTSQIKVDGIAAIDAIKERKGDIFI
FT                   EEIDLEYISGGASSYPYWKIKTQSGVVYVETIK"
FT   gene            79753..80481
FT                   /locus_tag="COB47_0070"
FT   CDS_pept        79753..80481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0070"
FT                   /product="Protein of unknown function YycH"
FT                   /note="PFAM: Protein of unknown function YycH; KEGG:
FT                   ate:Athe_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41446"
FT                   /db_xref="GOA:D9TGW0"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW0"
FT                   /inference="protein motif:PFAM:PF09648"
FT                   /protein_id="ADL41446.1"
FT                   /translation="MNWAKAKTTAIVVFLLIFVFLIIKYLNLFPKEETLTDQQINMAKN
FT                   ILSQNSIKLSCSIDRKIYYVSKLGVAIESKYDNIVTKLFGKRVDRYQNEFESSIYHLKI
FT                   VNQTLFLESKYYQDPFELFDIKRGDYIKDYDGSFVQVYKGYPIFDGRLTVKEQGSSTLY
FT                   IFTKVNPRRFEIKRSRAISALEAIFNLLNQQKGIKEIQNIKFGFYLKDFNVIQGQAIPV
FT                   WRIVADGNVYYINGFTGMLE"
FT   gene            80702..81658
FT                   /locus_tag="COB47_0071"
FT   CDS_pept        80702..81658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0071"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0085
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41447"
FT                   /db_xref="GOA:D9TGW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41447.1"
FT                   /translation="MESAISPNVQHGRQSGFRRFLHKLNEQKFLQAMAIPGVIWMIIFN
FT                   YIPMYGIIIAFKEYDITLGFNKSPWVGLANFKEFFADERFWLIIKNTVGISFFKLLVGF
FT                   PLPILFAVLLNELVSVRFKRTVQTISYLPHFISWVVLGGILMNWLSETGLINIILAKIG
FT                   ILKQPVAFLAEPKYFWGITVVSEVWKELGWNAIIYLAAIAGIDPELYEAATVDGAGRFT
FT                   KMFKITIPCISGTIAIMFILAVSGLMNSNFDQIFVLRNPLNADASDVIDIYVYRMGIEA
FT                   FRFSYATAIGLFKSIIALILLLTANGVTKKLTDKSLF"
FT   gene            81706..82590
FT                   /locus_tag="COB47_0072"
FT   CDS_pept        81706..82590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0072"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0086
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41448"
FT                   /db_xref="GOA:D9TGW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41448.1"
FT                   /translation="MKIKSSVGDKVFDIFNVTLMLIICFLTLYPVWYIIVYSFNEGKDA
FT                   MLGGIYFWPRKFTLDNYKIVFSNSDITTAFMVTVARTVITTTLHVFFTAMVAYAFLKKE
FT                   LMGRKIYMAMGTITLFFGGGLIPYFLLIKSLGLYNTFWVYVIPGMFNFYNLIIFQAFFR
FT                   ELPIELEESAKIDGANDFIIFTRIILPLSTPVLATIALFVGVYNWNDYFMGVIFINNPK
FT                   LQPIQTFLYKVIAQTTSNQMLAYAPGGIATRNVTSQSLKMATMVITTLPIVCVYPFLQK
FT                   YFVKGLLIGAIKG"
FT   gene            82684..84297
FT                   /locus_tag="COB47_0073"
FT   CDS_pept        82684..84297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0073"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2552 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41449"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41449.1"
FT                   /translation="MRKLKLKRLFAVFVVIAFVASLIPFAIGSAASSVKPGWKEDAKKP
FT                   ITFDWYINFSWFGTKWGGNAVSDYITKKTGVKINFIVPAGNENEKLNVMIASNTLPDFI
FT                   TLGWWEEAVRKMISGKLVYALDELAKKYDPYFFTVANKQRLGWYTQPDGHVYGYPNASY
FT                   TPDDFNNPKLKIYSNQTFLVRKDMYEALGKPDMRKPDTFLKALADAKKKFPTVNGQPLI
FT                   PIGFHEFTDTGCYSLESYLWNFLALPREKNGKLYDIVTNPEYIRWLKTFNEAYRRGLIA
FT                   KDVFIDKRAQMEEKIAQGRYFSMIYQRTDFVAQQQELYKKNPNMIYIAVDGPANSKLEK
FT                   PKLAGPGISGWTLTMISKNNKDPKRAIRFMSYWLSPEGQKDFYLGPKGVTWDVIKGKEQ
FT                   FKPEVVKLMQTDRPTFDKKYGAELTYWMLGDWPYVSQWDPGMPPYLQQMADWTVGKTVS
FT                   YAQYDGLEPPADSPEGIIARKVALKWGQTLPKLIMAKSSSDFDKYFKEFQEYKKQVGYD
FT                   KVLAYQQKKLEENKKKLGIK"
FT   sig_peptide     82684..82782
FT                   /locus_tag="COB47_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.277 at
FT                   residue 33"
FT   gene            84465..86291
FT                   /locus_tag="COB47_0074"
FT   CDS_pept        84465..86291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0074"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_2551 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41450"
FT                   /db_xref="GOA:D9TGW4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW4"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL41450.1"
FT                   /translation="MDSSKIKQLVRSIFKLNIRQKLILTYVLIVALPLTILQVNAFYRV
FT                   RIMTEKEYISNINFEVNKLKNDIVKNVEQFIKATQFVLNNQEFIEFVSTYQERSVDEIF
FT                   SFKVNVLDKIEYLQYVNFNINRIRFFTNNNFIPEMWPTLYQIDRLKSFKFIDKFLSDTK
FT                   QTSLWKLNNTDMLGPPLNSEEKVVSLYTKVTDLVGNLIGIIEVNMKVDEFFASELSRES
FT                   DNSVTIVISDEGDVIFSKQTPAFLKRLNISSEKLVEILEKKSTAQVDEGIVHLKINKNS
FT                   AAFVYTHIPVLGIKLYKLILFDELAQKINGVTLQMLGQVLILIIASSILIFILITLILK
FT                   KLRQVILSMRAVENGNFDVSIDIKGDDEIDELAQHFLNMVEKLKILIGEMVRREVAQKD
FT                   AQIKALQSQINAHFIYNVLENIKMMAEYSENYDVSDAITKLGKMMRYNMSWKRKFVTLK
FT                   EEIENIQNYISLMNIRYDKEIKLLVNVDNEILNIEIPKLILQPIVENAINYGIEPKGEG
FT                   GSIFIDGSIIGNYIVISIIDDGLGIEKEKLVAIQMALENDIETECYHGQGIALKNVNER
FT                   IKLAYGKEFGIKIDSKFGEFTKVTITLPYNRF"
FT   gene            86325..87872
FT                   /locus_tag="COB47_0075"
FT   CDS_pept        86325..87872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0075"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2550 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41451"
FT                   /db_xref="GOA:D9TGW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41451.1"
FT                   /translation="MRKVLIVDDEKLIRKGIRTILERNVADLDEIKEASNGKEALDLLF
FT                   SEKFDILIIDIRLPQIDGISVLKKIQNLTHKPKIIVISGYDEFSYAKECMQYGARGYIL
FT                   KPVDKKELIEIVEKLKNELQEEENNLRLLSLQKIMRAKMFEAEINNIIFSEIDIDRFRE
FT                   RLKDMAIPVDEKIMAVYLLLPGDNSEQNDFSAEEDKLKLSKILPEGSYVSTIYNQRKDI
FT                   LIFTKMHFCYEDVKKSYESLTERKVYMGICDLQENFENVKLLYERAYKAALYCFILNKD
FT                   IEFWSQISWREKEEFSQSDRIEKLKELILAGKQKEAIIFLESIFDHHFFNKYSADSILA
FT                   LSEKLYTQIVDWFCHHVPKKVLDIHEYQVLASIFNFTTISDYVNHFKKFVVEATEMISS
FT                   LKGILNVKDEIDKAIKFINQNYHRDINMAMVANHVSLNYYYFSTIFKEKTGLSFLDYLN
FT                   KVRIEKAKELLVNTDLKVWEIAEKVGYKNPKHFARIFKDITGLTPNEYRDAQKRLRE"
FT   gene            88037..93235
FT                   /locus_tag="COB47_0076"
FT   CDS_pept        88037..93235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0076"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="KEGG: csc:Csac_2548 carbohydrate-binding CenC
FT                   domain-containing protein; PFAM: glycoside hydrolase family
FT                   16; S-layer domain-containing protein; Carbohydrate-binding
FT                   CenC domain protein; Carbohydrate binding family 6"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41452"
FT                   /db_xref="GOA:D9TGW6"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW6"
FT                   /inference="protein motif:PRIAM:3.2.1.39"
FT                   /protein_id="ADL41452.1"
FT                   /translation="MRAKKFVANILLFTFLIMSIFPGGIAKASSGQIFKDISTNFAKDD
FT                   ITRFYQLELISGYPDGTFKPAKNISVAEFCKILNSYMGFVQEAPFDVSLRISPLAWYYK
FT                   ELKKAQAAGYLVEFIKEGKLDPNRFVTRQEAFAAVAAALQLDSQKADILNSFSDAQKIE
FT                   PRYLSGVAALISFGFVKGYPDGTLKPEKRITRAEIVKLLSSIGALIVTKPGEYTLSKNE
FT                   GFVIVNSSDVEIKDVSIKGNIYINQSVRDGSVTLNNVTVDGGKLFVFGGGENSVKLVNT
FT                   KVKEVVIDSKLSRTNIELYKNSQAENIIVLSSAKVTQVSDESSIKFITLKQSGNQSADV
FT                   EIKANCEALYVYSPNSKVNIKNSKVKNLTISDLAQNFTLSVASSKIDSVELNSNGNLNI
FT                   DKESGIEKLVVKALAKDVKISSNGKINEASVYSEGVVLNGKTLSKGEKVDISAVESKQP
FT                   SSSTALQSTLSAQSSGSTSSTTGSSSQGSTGGATDQTGNNNQNQQGGNQTQPTWQLVWE
FT                   DDFNGNSIDTTKWNFTIGAGGYGNNELQYYSSRPENARVENGNLIIEARKENFEGSPYT
FT                   SAKLTTQGKFSFTYGKVEVKAKLPEGQGVWPAIWMMPEDLNLYGGWPVCGEIDIMELLG
FT                   HEPNKVYGTIHYGNPHTYHGGNYTLPNGQKFSDDFHVFGLEWEPGKIKWYVDGQLYYET
FT                   SDWFSRSSNEAFDYTYPAPFDREFYLILNVAVGGNWPGYPPQDANYFPQKMVVDWVRVY
FT                   KPAGVTYSDNVAKPQESITYPQDARPPLSDGNLIYNGSFDIDSPDVDGIEGVANTDYWQ
FT                   FLHLPDFGGDGTIENIGGSVKINITKPGSQTYSVQLIQRPICLIKGKTYKLTFRAKSEG
FT                   SRTIEVKFSSGGGDNGSTWIDYAVKTFNLSSDWQDYSYIFTMQSSTYAKARIEFNVGLN
FT                   NLPVYIDDVKLIEYDVNAPSAIKEPLPNGNLIYNGTFDQGDGRFAAWEFAKETAADATY
FT                   TIGSKPEDRYFKAVIANGGQNFSDIKLVQSNIKVGAGENLLLAFSAKAFESPRQIKVYI
FT                   SDQNFNPITEVKVVSLSLDWNVYKFNLKSIDNLPSDTRAKLVFEIGSSNSDVAIDNVSL
FT                   KKVLPSSFIVVQAEDFGSLSNATNNGQYVAFSQGGAASFSVNVPKSGEYLVSYKLKAGQ
FT                   GSSLKLVVGSTVYDAEVAPTSANWAVVSDTVYLDSGENNMQLLADNVDLDYVEFSPNFI
FT                   KNGDFSKDLESWTTWFGNGGTGAAQVSRGQLKVSITNIGLAFWSIQVIQGPMTLESGKT
FT                   YRISFDAKSTSARDMFIKIDDSTYYGHLEKYVPLTDKMKNYTFDFVMDATRSDIRLVIG
FT                   LGTMSPGGANPQTQAHTVTIDNVAIAEVSENCGYFEREVAEILTGEADSEPQQFVGDKL
FT                   LPDGSFDTQESLNNWHWWSSAGNNVSMTIENGELKLSVSSIGSDPWDPQLYRQEIPLVN
FT                   GKNYKISFKARATYPRKINVAIGKPLTSAPWFIEYMPKKTIDITSEMAQYEIYFAMNNP
FT                   TDLGAKLAIEIGNVAGYSQVPFDIYFDDIQIEVVDSIPQETAPPAQHTQKVGDQIIPDG
FT                   TFDVSLGEWVYWSGDQWSGVSDMQVTTENGKLKVHLNSVGWQPYSAQVARKNLTLENGL
FT                   TYELKFKMSASQNTKIQVNIGKELSTDPWFIAYAPTTVFDIGTQEKEYTLRFKVTQPTD
FT                   VTKVVFEFGPINGQNPPLPLDIYLDDVTLTVVSDQ"
FT   gene            93344..96577
FT                   /locus_tag="COB47_0077"
FT   CDS_pept        93344..96577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41453"
FT                   /db_xref="GOA:D9TGW7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW7"
FT                   /inference="similar to AA sequence:KEGG:Csac_2547"
FT                   /protein_id="ADL41453.1"
FT                   /translation="MQANPKYYYDEKTNSFCIENYQISKPFSSFLPGIAGIFGIPLWCF
FT                   YVNRGQCIVSFGTKNKDGAILEFLPADRAYRLASTHGFRTFLKLNKNLFYEPFQIENLL
FT                   YFAKSKMSIFADHLEICEENSNLGIKAEVRYYTLANKNVASLVRELKIVNVSEKPIDIE
FT                   ALDGLALIVPYGKGDFALKNMSRTAEAWNFVENLDKKAPYFRFHSSSEDTTEVVEIKEG
FT                   NFFVSFDNTHGNFERCDVVIDPKIVFGISSEIVKPYEFIFSDNLDISNQVFANKTCCAF
FT                   AYAKRTLKPHEALSIYSIIGHAKRVDELNHFVDSIDSAEFFDRAFEENKAVINAIIEKN
FT                   TIVTSDKKLDEYAKICYLDNILRGGMPFTIEYDNKKDVIYLFSRKHGDLERDYNFFEIQ
FT                   DTYYSQGNGNFRDINQNRRNDIIFNPDIFDFNVWYFMSLIQLDSYNPLVVKGVKYRLNN
FT                   LEHLEKYIINGKEKLKKFFEKDFLPYELIKFLESQDIKINISKEDFVNCCLVNSEKVIE
FT                   ADPGEGYWIDHFTYNFDLIENFESIYPDKMRQLLLQRKYYYYDNEHYVKPRKERIKIIE
FT                   GQIKQHGAYALDKEKQELINSRADKKRYVRTHNGHGDIYTGSLIEKLLVILLNRMASLD
FT                   PFGVGVEMEASKPGWNDALNGLPGIFGSSVCETFELLRLVRMLKKYFEVYLEDVKEIEV
FT                   FEELYNFFVKLKKLLSQTQDEKDTLFYWIESNNIKEEYREKTRFGVSGNIVCISREEML
FT                   EFLDLCSEKFSKAKEKAFDSEKGLFYTYFINQPVEYEYDAQKQEIKIKKFSQKRVAFFL
FT                   ESQVRAMKVIDDKEQKRKIYQNVKESSLFDRELKMYKTNESLANETNQLGRIKAFTPGW
FT                   LENESIFMHMEYKYLLELLKGGLYTEFFEDFKVVLPPYMDPAVYGRSIFENSSFIASSS
FT                   NPDKSVHGTGFVARLSGTTTEFLNMELIILFGEKPFEYKNGELIFKLSPKLPGWMFTEE
FT                   EREVEIVLNGNKQTIVIGKNQLAAVLFGRTLVVYHNPRRLCTYDPGVNVQKYILHFDGE
FT                   VVEIEGEKVPEPYSYEIRNGMCKKIEVLL"
FT   gene            96660..97082
FT                   /locus_tag="COB47_0078"
FT   CDS_pept        96660..97082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0078"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: csc:Csac_2546 signal transduction histidine
FT                   kinase, LytS"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41454"
FT                   /db_xref="GOA:D9TGW8"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGW8"
FT                   /inference="similar to AA sequence:KEGG:Csac_2546"
FT                   /protein_id="ADL41454.1"
FT                   /translation="MIKKLLVKWNDIKLKNKLLIAFVILMLLPMSLIFFLSYTSLKNST
FT                   LEKFTLYNQVLFENATEEVQNFLDELNNIKYDFIMDDNLISDIGKTFARYTDHQDSFLY
FT                   TNILTKMSQYISTKEIIQSVQIKKKQRNIFLFKTSG"
FT   sig_peptide     96660..96779
FT                   /locus_tag="COB47_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.461 at
FT                   residue 40"
FT   gene            97084..99150
FT                   /locus_tag="COB47_0079"
FT   CDS_pept        97084..99150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0079"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2546 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41455"
FT                   /db_xref="GOA:D9TH90"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH90"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL41455.1"
FT                   /translation="MPYEDDKQIKEGFFSEIVTQEGKYVNGGYDKSRNVYVVGCELFSK
FT                   DKIQPVGEMIVSFSLDFLKDIIEKYHLTEGGFYVADRSSNQVIFKTTDRFENITKKLIL
FT                   KDETKLAPKFIFFEETIPDLNWKLIYIVSESTLLNNFSYTKRLLILSFSFLAIFAVLFL
FT                   FFISENITAPITRLIYQMRNLEHSKLKNNIKFARKDEIGDLLNSFYQMLKKIDELVIKV
FT                   YEEEIARKNAEINLLYMQLNPHFLYNTLDTINALAELGRCKDVSVVSISLAKFLRESLN
FT                   FSTSTIPLFQEIQHTEHYLTIMKIRFSGKLSYKIATEDDTVFDAQVPRHMLLPLVENSI
FT                   VHGFKNKKDGAKIFIRARRIEDKLRIEVVDNGCGIEKQKINQIKKNLNSGSIGISNIVK
FT                   RLKILYDNKFHFEISSKAGFWTKVVIEIPWKKKNKLGGEKMYTLLIVEDEEILLERLMK
FT                   TIDWKIAGVDKVIGKTNSEEALNVVMTENVDVILTDIRMPIIDGLDLAEFIKNGRKRPY
FT                   VIFMSAYKEFEYAHRAIKLGVMDYILKPFSKEEVLEAVKRAVEKLNTENIRQDISNCYE
FT                   DVVDIVINFITVNCSRQISLNDVAEYVHLHPVYLSRLLKNRTGKTFKEILTEARLKKAE
FT                   KLLKNSSLKHYEIAEAVGFSDAQYFSQVFKKAYGMTPIEWRRKATEIETKLKI"
FT   gene            99242..100546
FT                   /locus_tag="COB47_0080"
FT   CDS_pept        99242..100546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0080"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2544 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41456"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH91"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41456.1"
FT                   /translation="MKKSLRVIALAVVVIFAFSFVLLAQVNGKKVQGATNELTFWSWVS
FT                   DSDTIKQVYEQAIKEFNSNNKYGVKIKAVYTPGEQYKTKLQTAMAANNPPDILNMWAAG
FT                   KMKPYVDANRLYSISDIMNKDLQWKNRYVNGVFDLTTFNGKIYGIPQIRVATVIYYNKE
FT                   IFKKYNLSVPKKWSELINIVKVLTKNNIIPFALDARDPWILAMYAEYIANRIDPDAYRK
FT                   VQKDPNAWTDKAYIETGKKIQELVKLGAFPKGATSLDYVAARNLFDQGKAAMYVMGIWD
FT                   VGYLSTQSPVKNKVGAFKWPEIEGGKGNINNFLAGIEQVIAVSSNCKNKEAAAAWLKLL
FT                   SEPKYAKDLLAEKAGYFPSVKVNPDPKKVTGLYLEVLNMLKEQNTKDSFTYYDVMFGPI
FT                   IGDGFNNTIQSIYLGKDPVEAFKKLADIAKKEMKK"
FT   sig_peptide     99242..99316
FT                   /locus_tag="COB47_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            100633..101511
FT                   /locus_tag="COB47_0081"
FT   CDS_pept        100633..101511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0081"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2543
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41457"
FT                   /db_xref="GOA:D9TH92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH92"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41457.1"
FT                   /translation="MEKAFGNKFTIAVFIAPALILFTLVVPIPILHSFYMSFFKWDMLS
FT                   NMTYTGFENYKELFSDEIFLSSIFHTIEITVLSLIFQVILGLFLALCIVNITKGRRFYQ
FT                   SALFIPNVLSSAVIGILWFFVYNYDFGLINSVLRSLGLQNLQQEWLSQKYVLFSLSITT
FT                   CWQWVGYHMILYVAAISGISQDIIEAAVVDGAEGLKMVTKIIIPQILPVLKVSIVLIIT
FT                   GSLKYFDMAWIMTEGGPDFASETIATYIYRTAFNKLQYGLGSAASTFLFVVSILITVII
FT                   NNFASKREIEY"
FT   gene            101532..102380
FT                   /locus_tag="COB47_0082"
FT   CDS_pept        101532..102380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0082"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2542
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41458"
FT                   /db_xref="GOA:D9TH93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH93"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41458.1"
FT                   /translation="MYAKYTKISTVGKIIILSFLTIYSVITLFPILWLAYNSVKTNNDF
FT                   LANPFSLPSLSKLQLKNYYDAWVTMGIQKFTLNSLIISCTSVLLSLIISSMAAYAIERM
FT                   IWNSSQKVLNYFLAGIMVPIQIILIPLFINFKKLNLLDSRIGLLIPTVAFALPTSIYIL
FT                   TGFYKAIPRELEEAALIDGCSVYKIFYKIILPLTMPAFVTIAVFNFLGAWNDLLIPLVL
FT                   IQTPELMTLPVGLLNFRGMYGAELTKMFAAVFISAIPSIIIYFVLQDKLLKGMIAGAVK
FT                   G"
FT   gene            complement(102581..103329)
FT                   /pseudo
FT                   /locus_tag="COB47_0083"
FT   gene            103650..104771
FT                   /locus_tag="COB47_0084"
FT   CDS_pept        103650..104771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0084"
FT                   /product="protein of unknown function DUF955"
FT                   /note="KEGG: csc:Csac_2536 helix-turn-helix
FT                   domain-containing protein; PFAM: protein of unknown
FT                   function DUF955; helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41459"
FT                   /db_xref="GOA:D9TH94"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH94"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADL41459.1"
FT                   /translation="MSLAKVIGNNILALMKKQNVKIKQLADLIGVTRQTMTKYLEGEVI
FT                   IDSEKLFKIAEFFGKPLDYFLENKHEEMAFLFRAHVLNKESISTVQNKICDLINRVYEI
FT                   YELAGEKISYLPQQYNLKIDSKEKQIPKEIKLQIEQIALEEREWLNIGESRGEEIIECF
FT                   ENKGIRIIFEKFDMPDMFGVSALHDQKGCFIVINDDENIPEERKIFSIVHEYAHILFDR
FT                   NQYRQVILQSTHRNIYEKIADKFAGYFLIPRKSLAKYSVLLKSQLSWNDLIYIKKDLRV
FT                   SLKALLHVLNDYEYISDKEYQKWLKYLNMKGYTKKEPDPMPYFKKNTAHEKIVRMLFMK
FT                   EQIGINKVAELLGISVEEARENTKKWMMDERED"
FT   gene            104755..105054
FT                   /locus_tag="COB47_0085"
FT   CDS_pept        104755..105054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41460"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH95"
FT                   /inference="similar to AA sequence:KEGG:Csac_2535"
FT                   /protein_id="ADL41460.1"
FT                   /translation="MREKIKKLIDKVAILDTNVIIDFQRLSYLEIPLQVFSKVFVSGFV
FT                   VSKELPAEVVKKLKDLGYDIANLETEEGYRFFQELKKFKALSVYDRLVISIAFQ"
FT   gene            105380..106525
FT                   /locus_tag="COB47_0086"
FT   CDS_pept        105380..106525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0086"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="KEGG: ate:Athe_0096 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41461"
FT                   /db_xref="GOA:D9TH96"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH96"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADL41461.1"
FT                   /translation="MRKYILVKKIFNGYSFIKDNVLVVEDGIILGTQEGIDTAEDEIID
FT                   KRDFVLSPGFVDKHTHGIGGVDFFNTTADDAKTIQNYYFKHGVTTIVPTIVSAPFENIY
FT                   KLAKTIKEAKKDPDFKLNIPGIFLEGPFINPAKKGAHDKRFLQKPTVEKLEELIFNCEE
FT                   KIIDIALAPELLENPNEFISKAVEHGINISLGHTESSFEQAKQAHLLGAKNIVHLFNAM
FT                   PQIHHRQNSITTYALLSSIKVELICDLIHLSPEIIKLTYKLKGPENIILISDSISATDL
FT                   SDGEYSLGALDVKVENGICKLADGTIAGSTLTIDKAIKNLTKIGIRLEDALRSATYNPS
FT                   RLLSLECGAIKEGFRADFVLMDEDLNVKEVYVGGELVYKAQ"
FT   gene            complement(106531..107052)
FT                   /pseudo
FT                   /locus_tag="COB47_0087"
FT   gene            107282..107644
FT                   /pseudo
FT                   /locus_tag="COB47_0088"
FT   gene            107794..109137
FT                   /locus_tag="COB47_0089"
FT   CDS_pept        107794..109137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0089"
FT                   /product="Glucosylceramidase"
FT                   /EC_number="3.2.1.45"
FT                   /note="KEGG: ate:Athe_0097 glucosylceramidase; PFAM:
FT                   glycoside hydrolase family 30"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41462"
FT                   /db_xref="GOA:D9TH97"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH97"
FT                   /inference="protein motif:PRIAM:3.2.1.45"
FT                   /protein_id="ADL41462.1"
FT                   /translation="MFKKIASYVTAKDQSIPMQQVDNIKECQKIKNETIITIDPSCTFQ
FT                   EVIGFGGALTEAAAVNILSLLPQQQEEILRGYFDPKDGLGYKLCRIHMNSCDFCTDSYS
FT                   CDDVEGDTDLKYFNIERDKKMVIPLLKRIKEYCPDLKILVSPWSPPAWMKTNGDMCHGG
FT                   KLKDEYKKTWARFFCKFIKAYKEEGIDIWAVTVQNEPMATQVWESCIYTAEEERDFVKD
FT                   YLGPTLEEEGLSHIKILIWDHNKDIIYDRVKTILSDKDAAKYVWGVAFHWYGGDHFDQL
FT                   KKIKEEFPYVNLVFTEGCQEGGVKLGSWELGERYAHEIIGDFNSYTIGFMDWNIVLDTV
FT                   GGPNHVGNFCDAPIVVDKNEKKIYYQNAYYYIGHFSKFIKPGAKIVASNCNNPKLEVLV
FT                   GRNNDNSLVIVIFNKNQEEIEFGIKIAGEIFSGKSSARSISTIILQNQ"
FT   gene            109329..109601
FT                   /pseudo
FT                   /locus_tag="COB47_0090"
FT   gene            complement(109697..110440)
FT                   /locus_tag="COB47_0091"
FT   CDS_pept        complement(109697..110440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0091"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ate:Athe_0100 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41463"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH98"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADL41463.1"
FT                   /translation="MCKAKVYIGTSGFSYSHWRGIFYPENLPSTKRFEFYTNYFQTTEI
FT                   NSSFYRLPQEKTILNWYFSSPDNFVFSLKAPKAITHLKRFLEVEEEWNKFENRIKLLNE
FT                   KLGPVLLQLPPSFKADDENIKRISEFLDGKENFKLAIEFRHKSWCDEKIFEILKSFNVA
FT                   WVIADSSRYPKAKVITANFTYIRLHGPKEMFSSCYSDDELYNLANEIKEYSKVCNQIYV
FT                   YFNNDFNGYAVKNAETLINIVNNTI"
FT   gene            complement(110480..111565)
FT                   /locus_tag="COB47_0092"
FT   CDS_pept        complement(110480..111565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0092"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: ate:Athe_0101 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41464"
FT                   /db_xref="GOA:D9TH99"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9TH99"
FT                   /inference="similar to AA sequence:KEGG:Athe_0101"
FT                   /protein_id="ADL41464.1"
FT                   /translation="MNYIYRSKKAVKKSRIKILLILTLIFFVTALIIFIFYYPKFDNKK
FT                   QQIIKPTKVRIGFAMGTLKEERWFKDRDILIAKAHERGYEVEWVNANENDVEQINQVKY
FT                   LLSKNINILIIVPNNYEKCSGAVNLAKKRGIKVISYDRLVKNSDIDVYISFNNYKVGEL
FT                   MAKWLLKSVPRGNYVFLLGDPGDYNVQMIKEGYHKVLDSFINKKQINNILEKYCYNWRK
FT                   EYAYNYINNLLEEGKRIDAVLASNDSLAEGAIMALSEKRLAGKVPVTGQDADISACQRI
FT                   VKGTQLMTVYKPIDRLVDLTLEIVDKLIKEEPLKSVYMLNNGYKNVPTFFIDPIGVDKS
FT                   NINDTVIKDNFHTWDEVYITK"
FT   gene            complement(111587..113146)
FT                   /locus_tag="COB47_0093"
FT   CDS_pept        complement(111587..113146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0093"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_0102 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41465"
FT                   /db_xref="GOA:D9THA0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41465.1"
FT                   /translation="MTYKILIADDEKIVVDSIKFILENNLDEDIEISTFTLGREALENL
FT                   LFYSYHIAFVDIKMPDLDGLELIEEFRKMRNSEFPLFIIVSAYDKFEFAKKAIKEKAFA
FT                   YILKPYSIEDIVLTVQSAIAHINSILAKTKENIEKNAQLIVMRNLLENSFIPTLIFKNV
FT                   FDIVDINQYEKIFGINLKSGILMVLSLKDKSDFVSSFKELDNIRKDLKISFEHKALTSI
FT                   GMGEYLICFFSASSQKEAEGLKEKIQEILKQKPYWNNVKIGFSDFYYLDEGYENAFWEA
FT                   YYSTLDIDSSDENEENEHLLLLTENLEGKLIHSINNPTQIPVIENYINQLCRLYVELFG
FT                   ENNLKYKVIKLIIMLLLETGIENRNESIDIEKLIAQILNSSSEQIVEIFKKALLTLFSK
FT                   AKIKHDQIINNDSINKAIEFINQNYNQEITLSQISTAFNFNPYYFSKLFKKYTGVSFKT
FT                   YLTKLRIQNACQLLKNSSKSIKEISFAVGFSDPNYFIKAFKKFTGMTPSAYRSLPDESK
FT                   PL"
FT   gene            complement(113143..114630)
FT                   /locus_tag="COB47_0094"
FT   CDS_pept        complement(113143..114630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0094"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: ate:Athe_0103 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41466"
FT                   /db_xref="GOA:D9THA1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA1"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL41466.1"
FT                   /translation="MKFFSVQSKLLAFFFIIILSLLAIDILIQYNNNYLVSLVNETFET
FT                   INTINITKKDISSLNSNLQRYLISGDSDSMLSVYGSLNSIDEKLSALESKILTKEEYLY
FT                   YTNLITIFEYLSKLTERLVIYKKGNLPLSKTYSEYIDFSNFLNLYLEKFSEQKIKFTME
FT                   IHHKAQRQLNTIRKINNLVILIWTLFASLLSIIFSNTFTTPIINLSKVANKIAHGNLET
FT                   QLPEYSANDEVAVLYQSFSNMISNIKDMVKKLEEKADLERMYAQQKIEAIKYRQALQEA
FT                   ELKNLQAQINPHFLFNTLNTILQIAMFENAKQTYEILLRTSNYLRYVVHNITRVVKLEE
FT                   EIENVKNYMFIYRMRFGDRIKLEIDVENETKLLLMPCMILQPLVENAIIHGFKESEYGT
FT                   IKILAKKNEDMVIIEVSDNGKGIEKETLEDLKNFSFEHNKTTGIGINNIAKRLSYFYNI
FT                   ESPLYIDSNSEGGTTVTIKVPFITDISKLPKQEVNNI"
FT   gene            complement(114643..115617)
FT                   /locus_tag="COB47_0095"
FT   CDS_pept        complement(114643..115617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41467"
FT                   /db_xref="GOA:D9THA2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0104"
FT                   /protein_id="ADL41467.1"
FT                   /translation="MKKRLQNLSFRIMVFFSVIIFVLIALYDIYNIRFINISEKKANFK
FT                   NSVRIMMILPQNQTYWDWFLNEYKDISEKQKIITDIVFYNTPKDAYKLLKLVTVTKPDA
FT                   IVMCNIYNSKDIAQVLSSIKNNNIFIVSLFNDMLFRYEDVFVGIDYYYKGKIAGKIIYN
FT                   VLNKKNNMPERLKIAIVNPFYTTIGGTLEVKGLTDFLKSKGIKNINIKNFNFEYFSFPS
FT                   EELTRQLILEDKQKFNVIYIGSETDTLTIAQNIITFNKLDQFIVIGAGTNQKLQKYVRE
FT                   RIINGIINDNGKLIAQKLCEAILSWKRFGHASSYISTNFNVME"
FT   gene            115832..116884
FT                   /locus_tag="COB47_0096"
FT   CDS_pept        115832..116884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0096"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: ate:Athe_0105 D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; TIGRFAM: D-xylose
FT                   ABC transporter, periplasmic substrate-binding protein;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41468"
FT                   /db_xref="GOA:D9THA3"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA3"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ADL41468.1"
FT                   /translation="MKKSLLRIVSIVVAVAFIIGIGFAVVPKYAKAKTSKQIKIGLSLA
FT                   TLQEERWHKDRDEFVKAAQKLGAKVLVQAANMDDVKQKEQCENLISQGIDVLVIVPNNA
FT                   EVFTSIIDEAHKAGVKVISYDRLIKNANVDLYVSFDNVKVGELQGKYLTSKVPKGNYFV
FT                   FRGAPTDNNATLFYQGAMKYIQPLVKSGKVKVLFDQPVKDWKPEEALRLCENALTAAKN
FT                   NVQGILAPNDGTAGGIIQALKAQGLAGKVVVTGQDADLAAVKRIVEGTQTMTVFKDVRL
FT                   LAKKAAEVAVELAKGKKVSQLKDVNGKVYNGKFNVPSILLTPVAVDKSNIDKVLIQSGW
FT                   FTKEQVYGKK"
FT   sig_peptide     115832..115906
FT                   /locus_tag="COB47_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.829) with cleavage site probability 0.709 at
FT                   residue 25"
FT   gene            116986..118503
FT                   /locus_tag="COB47_0097"
FT   CDS_pept        116986..118503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0097"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0106 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41469"
FT                   /db_xref="GOA:D9THA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41469.1"
FT                   /translation="MSEYILEMVHITKEFPGVKALDDVTFKVKKGEIHALVGENGAGKS
FT                   TLMKILSGVYPYGTYSGDIFIEGKKQHFRNIKDSEHAGVAIIYQELTLVKGMTVGENIF
FT                   LGREPVVNGIINWNKVYADSKKLFEKLNIEIDVYEKVENLGIGQQQMVEIAKAISKDSK
FT                   ILILDEPTAALTESETKQLFRILKDLKNHGVTCIYISHRLEEIFEIADTVTVLRDGKTI
FT                   STDPISALTEDEIIRRMVGRELTQRFPKVPHKAKRTIMEVRNFSVYDKDNPEKKIIDNV
FT                   SFEIKEGEILGISGLMGAGRTELFMSIFGAYPGRKEGEIWLDGKKIEINNPREAIEHGI
FT                   CYLSEDRKRYGLVLMMDIKDNILLPNYQKFANGGIINIPKSLSTALDYVGKLRIKIASP
FT                   FQRVENLSGGNQQKVIIAKWLLANPKVLILDEPTRGIDVGAKFEIYNLMNQFVEHGVGI
FT                   VMISSELPEILGMSDRILVMQKGKIAGELMADEATQEKIMTLATGGR"
FT   gene            118507..119628
FT                   /locus_tag="COB47_0098"
FT   CDS_pept        118507..119628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0098"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_0107 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41470"
FT                   /db_xref="GOA:D9THA5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADL41470.1"
FT                   /translation="MNLKKNLRTYTLIIAILLIWTIFTILTDGNFLTPRNLSMLARQMA
FT                   ITALVAIGMVFVIVAGHIDLSVGSVVGFTGAIAGVLQVWHGWSTPATVLAVIVIGILIG
FT                   IWQGYWIAYRGVPAFIVTLAGMLIFRGGVLLASKGITISPFKESFTFIGQGYLNKALSI
FT                   VFGAVLIVGYLLLTINQRNRRKKYNLEVLPMGLEIAKAAVVIALIAAFTGVMISYEGIS
FT                   IPVLILVIFTILLTFISQNTTFGKYVYAIGGNKEAASLSGINIKNITMKIFILMGFLSA
FT                   LAGIVLTSRLDAATSGAGTNMELDAIAAAILGGTSTLGGEGTVPGAIIGALIMASIDNG
FT                   MSLLNMEYSYQLIVKGLVLVFAVWLDIMSRKKA"
FT   gene            119789..121913
FT                   /pseudo
FT                   /locus_tag="COB47_0099"
FT   gene            complement(121985..123028)
FT                   /locus_tag="COB47_0100"
FT   CDS_pept        complement(121985..123028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0100"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: ate:Athe_0101 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41471"
FT                   /db_xref="GOA:D9THA6"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0101"
FT                   /protein_id="ADL41471.1"
FT                   /translation="MKKVLKFKVVMITLTIVIILIALFLSAYIHFLKKISINRPPKIGF
FT                   AMSTLKEERWFFDRKYLIDTAKKKGFEVEWTNANENDMTQYQQVKYLLAKGIDLLIIVP
FT                   SSYDSAKNAIELANQKNIPVICYDRIALDANIDAYVGFNNKKIGEIMAKYLLKQSPSGN
FT                   YVFILGNPRDYNTYQIREGYRRILGSYINSGKINILLEDYCYKWKKEYAYEYVAKLLQA
FT                   GKRIDAILAQNDSLAEGAISALAEKRLAGKVPVVGQDAELSACRRIVNGYQLMTVYKPI
FT                   KKLSDLTIEIAEKIIKKDKLPYTKNFVNNGYKMVPAYLVEPVAVTKNNINLIIKDNYHS
FT                   YEEIFGK"
FT   gene            complement(123045..124577)
FT                   /locus_tag="COB47_0101"
FT   CDS_pept        complement(123045..124577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0101"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_0102 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41472"
FT                   /db_xref="GOA:D9THA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41472.1"
FT                   /translation="MKKILICDDESIVIESISHILRKNFSEQMTIDEAYDGEEALQKLM
FT                   FENYHIVFIDIQMPDMSGIEVMEEIRKTKKEPFPLFIIISAHDKFEYARKSVELGAFSY
FT                   ILKPYLVSDIVNITKKAFEEIDNILSKQKEEMEKKRKIKAMQSLIENGLLFFILNNKLF
FT                   SDLNLRQIEQFLEIQSLQYGIIAIVRLEQENTLNNIDILNDLKTEIKSAFSNKCVVSFL
FT                   SPSSLLCIFSAENETYKDVLKDKLQKIIKAKTDAEIQIGLSSLCNLYDDFEEAFYESYS
FT                   NIISDDNQDVTDLYVEIEIMEKRLLNSLLKTTNIIQKQQQISELIKKYITAYGINQARY
FT                   KVILFVIQLLIEINIKESAKAIHVMEKFLKDIITIDNENELTQKSSEIIQIIISEAAIQ
FT                   KKTYSSSNIVSQAIEYIKNNFKRNISLEEMSQVLNISPYYFSKIFKKSVGINFKEYLIK
FT                   MKIEHAQKLLIETNMPIKEIAYEVGFDDPNYFIKAFKKYTGSTPASVRNRNK"
FT   gene            complement(124601..126052)
FT                   /locus_tag="COB47_0102"
FT   CDS_pept        complement(124601..126052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0102"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: ate:Athe_0103 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41473"
FT                   /db_xref="GOA:D9THA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA8"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL41473.1"
FT                   /translation="MKIFFNTYRAKLIFFILTFVFITITINLLIQINVNFLHNYFDRTY
FT                   HNIESINTITNNFGTIRRSIQSYVISGDSDSILNVYDSLNSISYELNQLSCQSEDEIVY
FT                   KRSITNIYKTINDNIDMVILFKKQGKDYTKKLSETIESLEYANYFLQKFTQSKINHSVE
FT                   YYNSLKSSIRKITNTNYVVIVLWFVLSIVVSLLFTKELTEPISRLAHYSNKVAKGELNF
FT                   SIPKVEPTDELGILNNSFSDMLENIKDMLKRLEDKAELEKELAKKEIEMVRYQQALQEA
FT                   ELKSLQSQINPHFLFNTLNTLAQMAMLENADKTYDMLIKTSNYLRYSVQNINKLVTLNE
FT                   EIENVKNYVFIHNIRFRNKINLEIDIEKDIEDAKIPSMILQPIVENSIVHGFAKKREGT
FT                   IKIVAKKHYSNYVKIQIIDNGSGIEPKVLEEITKKSFVSKTSTGIGIENIKKRLEFFFG
FT                   IKEPIFIESKKNIGTTVTITIPYIN"
FT   gene            complement(126067..127032)
FT                   /locus_tag="COB47_0103"
FT   CDS_pept        complement(126067..127032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41474"
FT                   /db_xref="GOA:D9THA9"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9THA9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0104"
FT                   /protein_id="ADL41474.1"
FT                   /translation="MTSTKNFILKYFIITVFILLALILVWLSASDFLIIRKMGNLNNFS
FT                   QNNYINCAVILPKNEMYWKEFLGEFEQFAQAQKVLSETIFYESEQEEVFGLKLALFSKF
FT                   DFVIICDLFATKEIKSLIDQLKMQKIKVISILSSKNKDLFDTTLGFDYFQKGRVVASNI
FT                   ETTAKKKNLDKLKIAVITNTINKSISDTLEVEGIKSYLKEKGIAFSVDLFSIEYGNAIS
FT                   EKLLNNIITAQQYNCYYTTEELETFAFIDSFVKSPKDSNFIFIGAGDDSRLLRYRDEGL
FT                   IDRLVMPNYDELAIRSILIMKDFEKLSSKGEFIPISIIVK"
FT   gene            127265..128335
FT                   /locus_tag="COB47_0104"
FT   CDS_pept        127265..128335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0104"
FT                   /product="D-galactose ABC transporter substrate binding
FT                   protein precursor"
FT                   /note="KEGG: bbe:BBR47_06800 D-galactose ABC transporter
FT                   substrate binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41475"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB0"
FT                   /inference="similar to AA sequence:KEGG:BBR47_06800"
FT                   /protein_id="ADL41475.1"
FT                   /translation="MLNKKKFWVVLVSIVLAISLVLVGCGKKSTNENSGGTSEDNKPYI
FT                   GVAIYKFDDTFMTGVRNAIAKEGEGKAKLDFVDCQNSQSTQNDKIDLFITKKVDALAIN
FT                   PVDRTAAGVLIDKAKQANIPVVFFNREPLPEDMKKWDKVYYVGAKAEQSGTLQGEIMAE
FT                   YWKSHPEADKNHDGIMQYVMITGEPGHQDAILRTEYSIKAVEAAGIRVKCLAQDTAMWD
FT                   RVKGQEKMQAFLASFGDKIEAVFCNNDDMALGAIEALKAAGYFKDGKYVPVVGVDATTP
FT                   GLQALEEGTLLGTVLNDAKAQGKATFNLAYVLAKGEKPTKENVGFEITDGKYIWVPYQK
FT                   VTKDNLEEMKKYVNEQ"
FT   sig_peptide     127265..127339
FT                   /locus_tag="COB47_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.773) with cleavage site probability 0.715 at
FT                   residue 25"
FT   gene            128453..129970
FT                   /locus_tag="COB47_0105"
FT   CDS_pept        128453..129970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0105"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: bbe:BBR47_06810 galactoside ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41476"
FT                   /db_xref="GOA:D9THB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41476.1"
FT                   /translation="MAKPEYILEMNGITKEFPGVKALDNVTVKIKKGTVHALLGENGAG
FT                   KSTLMKCLFGIYKPDSGDIILDGQHVHIHSPIDAIKLGISMIHQELQPVNQRNVMENIW
FT                   LGRFPRLTIGPFKFVNHKKMYEYTRQLLQKLEIDVDPKAIVGHLSVSKVQLVEIAKAVS
FT                   YNSKVIVMDEPTSSLTENEVEHLFRIIRDLKAKGVSIIYISHKLEEIFEIADEVTIMRD
FT                   GKVVGSWSISELTPDMMIANMVGRQMSDRFPQKTNKPAEVILKVENLTSIDSKSFKNVS
FT                   FELRKGEILGIGGLVGAQRTELIEAIFGLRTIKEGKIFIKGKEVVIKNPQDAIKNKIAL
FT                   LTEDRKLTGIIPELNILENTTLASLKKYLNGFGLLNDKKRVLDTQNFIDILRIKTPSYK
FT                   ALIKNLSGGNQQKVLIARWLLTEPEILLLDEPTRGIDVGAKFEIYNLINQLATEGKSII
FT                   MISSEMPELLGMSDRILVMCEGRVSGILERNEATEEEIMKLATKFSA"
FT   gene            129996..131009
FT                   /locus_tag="COB47_0106"
FT   CDS_pept        129996..131009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0106"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bbe:BBR47_06820 galactoside ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41477"
FT                   /db_xref="GOA:D9THB2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADL41477.1"
FT                   /translation="MSFTKKARQVLSQNAIYFILLALIVVIAFISPDFLSWRCFRDILL
FT                   QSSTRAIIALGMSLVLITGGVDLSAGRAVGLAAVVSASMLQTADYARRFFPDLPQLPLI
FT                   VPILIAMVITLLFGIINGVAISRLNLPPFIATLGSMVIIYGANSLYFNMPPNNSQPIGG
FT                   LRPDFTNLGTGYIGISGEYSIPYILIIALIVALVVWVLLNKTALGKSIYAVGGNVNAAR
FT                   VSGINVTKVLIFVYAFAGLLYGLAGVLEAARTGGATNNYGNMYELDAIAACVVGGVSTT
FT                   GGIGTVPGVLAGVLIFGVINYGLTFIGVDPYWQLIIKGLIIGVAVALDIRKYLAKR"
FT   gene            complement(131141..132346)
FT                   /locus_tag="COB47_0107"
FT   CDS_pept        complement(131141..132346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0107"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ate:Athe_0112
FT                   ABC-type Na+ efflux pump permease component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41478"
FT                   /db_xref="GOA:D9THB3"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL41478.1"
FT                   /translation="MKINFKHVWIVLKKELKDAFRDRKALLVNIILPMIFIPVIFIISS
FT                   IAAKSAVEVKPEKTPICVIGLENSKLISSMIEKSEFNIVKSTNPKKDLQDSKIKAVLII
FT                   PKDFEKLLSQGKQVNIQILTNEADMKSSNVGNILSNMINEFSKQIVKQRLIQKNLDPSI
FT                   IEPVVINKENVAPPKKQSATILSFLIPMFLTLWATLGGMNVAIDLTAGEKERGTLEPLL
FT                   TTAATRSSLVTGKYLAVSIMALLAGLSSLFGIIASFVLLPSVLGESFKNSPFYGYSVSP
FT                   LTVLIMLLVVILTAIIFAAIEVALASYARSFKEGQTYLSPISIIVLIPPYFTMYKMPNE
FT                   LTDTYFLLPIVNAISVLKELIYDIVNLQHLGLFVISSIVYIVISIMFASRMFENEKVLF
FT                   RN"
FT   gene            complement(132343..133068)
FT                   /locus_tag="COB47_0108"
FT   CDS_pept        complement(132343..133068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0108"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0113 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41479"
FT                   /db_xref="GOA:D9THB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41479.1"
FT                   /translation="MVELIELTKDFGKVLAVNRLSFKIERGEIFGILGENGAGKTTTLR
FT                   MLATMLKPTSGTAIISGLDITKEPEKVRRKIGILFGSESGLYARLSARENIEYFGLLHD
FT                   MDKNELKKRIDDLSERFGMQDYINKPAGTFSKGMKQKVCFVRSIIHNPEVMLFDEPTNS
FT                   LDVSSAKEVHDFIKLCKQEGRTIIFSSHSMNEVEKLCDRVAIIHKGKLVALGTIDEIKH
FT                   RFTGASFEEVFLRLVGDER"
FT   gene            complement(133189..133866)
FT                   /locus_tag="COB47_0109"
FT   CDS_pept        complement(133189..133866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41480"
FT                   /db_xref="GOA:D9THB5"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB5"
FT                   /inference="similar to AA sequence:KEGG:Csac_2500"
FT                   /protein_id="ADL41480.1"
FT                   /translation="MSKIKTYLVYIKNFRGRIIFLLILLLLNILLFVLIPQRINQIVFS
FT                   LSEIFILTILVQSRFYLNAEMTRKNNTVSLSFLSLLLSLPIKRITIVTMEFLSEVILIL
FT                   IYIFVLNIPYIFYSKSLNMPLFVFPLTVVIGIYSVYSILAVLVSIVKIKNFASILLGVL
FT                   NSLFFCTFYFFIFPLSKTKNNTSLLSYLYYNPKNLLLLSICSVILFLCALWINIKIIYS
FT                   KDF"
FT   gene            complement(133877..134539)
FT                   /locus_tag="COB47_0110"
FT   CDS_pept        complement(133877..134539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2255 permease"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41481"
FT                   /db_xref="GOA:D9THB6"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB6"
FT                   /inference="similar to AA sequence:KEGG:CAC2255"
FT                   /protein_id="ADL41481.1"
FT                   /translation="MKKYLILCKREIFLFGIFSLIYIVVTCLINFPFKDAILICKASHD
FT                   YFNMFLIGTIIYFLASVFYNEKNFQATLRFILSIPIKVKKIVAFFMIRNILLIAIPQLI
FT                   GLLFFGLLIFFSPKSDIYRNMFITQFLGFVFCNIGVALLVVPFNILSSVQIIKNYLSNL
FT                   ILYIVSILIIIIMLLPLNNLQPQFFDLYKMLPSVIYIIFIFVISFGLASYLLSKKEF"
FT   gene            complement(134514..135395)
FT                   /locus_tag="COB47_0111"
FT   CDS_pept        complement(134514..135395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0111"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0117 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41482"
FT                   /db_xref="GOA:D9THB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41482.1"
FT                   /translation="MIALSVRNLVKRYKNFKLEIPELILESGYIMALLGRNGAGKTTLI
FT                   RCILDFAKKECGEVFIFQQPFDCDKVDIKQRIGIVFENPVFPTHLKPKELKEIMKGFYK
FT                   SWDEKLYKNLCDLFEIEQNKSIFQLSKGTVMKLSIALALAHKPDLLILDEPTSGLDPVA
FT                   RNQFVEILQSFVQSEEKAVFYSTHIVSDIENVADFVTIIDKGKIICSTNTEEIQNSFCI
FT                   VKGSAADVDKLLKSSIIALKKSSMIFEALCKKNCLKDEFRSYFVFEKPSIEKFYVMLVR
FT                   KDDNDEKVLDIM"
FT   gene            complement(135392..135781)
FT                   /locus_tag="COB47_0112"
FT   CDS_pept        complement(135392..135781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0112"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_0118 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41483"
FT                   /db_xref="GOA:D9THB8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB8"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL41483.1"
FT                   /translation="MIKILISHTSTQPIYEQIKNQIKKQIIEGSLKAGEALPSIRVLAK
FT                   ELNVSVITTKRAYEELEKEGFIITVPARGTFVAEIDREKIVGIKTKEVEEELEKVVLKA
FT                   KELGIELNKLIDMVDKFYKGDEFQK"
FT   gene            136048..136638
FT                   /locus_tag="COB47_0113"
FT   CDS_pept        136048..136638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41484"
FT                   /db_xref="GOA:D9THB9"
FT                   /db_xref="UniProtKB/TrEMBL:D9THB9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0119"
FT                   /protein_id="ADL41484.1"
FT                   /translation="MKKKSFENPFLIAFIVYLVMSLVVIFIFTAKMNRLEVFKTNYNAK
FT                   IPNIFFAEYSHNLSDAKDILKHLVEDQNVDFSYLRGRTEEYFLNNTLTMSIAKEPDIFE
FT                   ERDIGRIIDERYELVVNVRDFLKKIDEKIIAHKDKNLIQKTKPDIEKIIFLLDALNEDL
FT                   QSFRDENTKKVFKEYEKELLEYLNKADKMILQS"
FT   gene            136832..137617
FT                   /locus_tag="COB47_0114"
FT   CDS_pept        136832..137617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0114"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="KEGG: CRISPR-associated protein Cas6; TIGRFAM:
FT                   CRISPR-associated protein Cas6; PFAM: protein of unknown
FT                   function DUF57"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41485"
FT                   /db_xref="GOA:D9THC0"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC0"
FT                   /inference="protein motif:TFAM:TIGR01877"
FT                   /protein_id="ADL41485.1"
FT                   /translation="MRAKFIFEVSESQSELHNLPVYYRTVFMSFLKRALSLYNKDYFDR
FT                   IYWWGEKKNKWQKPFVFALNLPNMNFQDDTVYFRGDIMFNLSTSDYEFFVNMYNSLLNS
FT                   NLYPYPLTDNCKIALKRMYLVKEPEKFDSKMVFKTFSPILIEKKEGNKKVPVLPFDEGF
FT                   EDVFNEVVDFEIRNVRLLRGQNKGLHKRLTFRPINVQKTVVKHRISEFVENTGKDIMFL
FT                   TGFSGIFELSGDPEDLKELYQNGIGFRRGQGFGFVEVAK"
FT   gene            137649..139304
FT                   /locus_tag="COB47_0115"
FT   CDS_pept        137649..139304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0115"
FT                   /product="CRISPR-associated CXXC_CXXC protein Cst1"
FT                   /note="KEGG: CRISPR-associated CXXC_CXXC protein Cst1;
FT                   TIGRFAM: CRISPR-associated CXXC_CXXC protein Cst1; PFAM:
FT                   CRISPR-associated protein, CXXC-CXXC region"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41486"
FT                   /db_xref="InterPro:IPR010180"
FT                   /db_xref="InterPro:IPR019121"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC1"
FT                   /inference="protein motif:TFAM:TIGR01908"
FT                   /protein_id="ADL41486.1"
FT                   /translation="MLERVYLGDWAYNAGIIGFIEIMLDGEDIASQNIITIGSNYIEFD
FT                   RNNLKGFSDKFFKKAYQRYPRTDELLDLGNKLLQRLENNDFDKNLKQEISNFKKRVEGF
FT                   SKLKQLVDSYKLTLPRNFNNVDAEQYISQIIDLLNANKQELIEDNVKTYLKNTSSICGD
FT                   RSFLNRNFKGELKKKFFDDFEGPIVNQTNRQDKNHDCIFCGLRPAKKDALLDTGLVSFL
FT                   GANKDNKNFFWNFKPQLPICEICELIYFCIFAGLTEFRIGQTKKFYFVDRNTSVLELYQ
FT                   TNKLFMEMMAKEENILKEKGILNFINDYLLTKFKEESKFRLTNNIMFIEIDLTSSVAPK
FT                   LYGFSITKQKAEFINSNYDLLKKTTGSYIRIKENVLYPFSEFMQKFINNTLSSQFLSFL
FT                   EYQYLNSQKPNSKIKTNLSPYRLQIYNMLIYKYLKSVKRGEDLMDEKWLWKMYFFGQEL
FT                   KKKFLESKAENKVTSLAYRLISALRIGDINTFMNLIIRTYMSYSMEVPALFVSCIKNEE
FT                   NFCALGYSFVNGLLGVEIEKDGEIENSEEVEENV"
FT   gene            139297..140226
FT                   /locus_tag="COB47_0116"
FT   CDS_pept        139297..140226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0116"
FT                   /product="CRISPR-associated regulatory protein, DevR
FT                   family"
FT                   /note="TIGRFAM: CRISPR-associated regulatory protein, DevR
FT                   family; CRISPR-associated autoregulator DevR family; KEGG:
FT                   CRISPR-associated autoregulator, DevR family"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41487"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="InterPro:IPR013414"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC2"
FT                   /inference="protein motif:TFAM:TIGR02585"
FT                   /protein_id="ADL41487.1"
FT                   /translation="MFKNAGITLTVVFEAMSLNYGESIGNISELKKLTRENKVYTYMSR
FT                   QALRFEKYKFMMENAGIKETPVTGDEQVVQFKKEATITEYPEIDLFGYMKTSGQGQNAQ
FT                   TRTAVVKITPAISLEEYKNDMEFATNLNLAKRANTNPNPYQLEQHKSLYTYTVAIDLDR
FT                   LGKDFNEKGELVEEIPADEKLKRLCSLFDAIKFLSREIKGRRENLSPLFVIGGLYPVKN
FT                   PFFLNRIKLIKEDSAYAIDPRLLRSTCELTLPNGKKVFDYTLLGILEGFFVNEEEFKKL
FT                   LPASSGTIDYFFENLKERARKYYEEGTV"
FT   gene            140229..140975
FT                   /locus_tag="COB47_0117"
FT   CDS_pept        140229..140975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0117"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5; KEGG: CRISPR-associated
FT                   protein Cas5 family"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41488"
FT                   /db_xref="GOA:D9THC3"
FT                   /db_xref="InterPro:IPR013337"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC3"
FT                   /inference="protein motif:TFAM:TIGR01895"
FT                   /protein_id="ADL41488.1"
FT                   /translation="MLNSLLKIKIYQPFANFRKPFSYGIVDSYPLPPPSTVKGWLHNIL
FT                   GAKNGEYYEMAVSVCGRFNSISYDIQRIVKFDRLRKEDTIAPVVNEVSARVQNSIIYVT
FT                   NLVDVQLCIHVNAERNVLEKIYKNIFDSYWGLGRKEDLMRIDEIKFFEPRKVEYRKYIK
FT                   KRPPEIGMYLKSSTAETLMIDGIRFRLNNRYEKTKDGLRIFTDKKDVVFVETLVQLNPM
FT                   AIIEKEVFVDDEDIIIDLIGDEMYEN"
FT   gene            140965..143298
FT                   /locus_tag="COB47_0118"
FT   CDS_pept        140965..143298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0118"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3;
FT                   CRISPR-associated HD domain protein; PFAM: helicase domain
FT                   protein; KEGG: metal dependent phosphohydrolase; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41489"
FT                   /db_xref="GOA:D9THC4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC4"
FT                   /inference="protein motif:TFAM:TIGR01587"
FT                   /protein_id="ADL41489.1"
FT                   /translation="MKIDIYKDIELYAKRFKSNKGNKYQTIYQHTMDLLNNMEKLFEEY
FT                   NEEIEESCIKLQINYQKLKYLLKLAIIYHDLGKANSKFQQKIRDKTRVKEVPQVKGLSK
FT                   EVPHNFISIAFVDLEDEITAGNITVEDLENLLFAIAFSHDRDFDFNCQYFEKYICEDVS
FT                   KYIENKTLKPLLELLPSVLDRDLIINNSNYTYRVINQLRELMLKDSYNFSNKNTIFRTF
FT                   LKGLLHRLDHSSSAGISTEEPKIKNFPEKVEVYLKSKGSFSGFKDFQKKAVELSGRNII
FT                   LFAPTGSGKTEFGINWAFKSKLIYTLPIRVSINAMYERLAKIFGEDKVGILHSDSMIYL
FT                   LERYMEIYRENQELETLFDSVDLAKNMSLPIIVTTGDQIFTSALKWPGFEKIYSLFLYT
FT                   KIIIDEPQSYSPESLAIIIKALQEIISLNGKFCLMSATVNPLILKYLGNYADYIQAYSD
FT                   EELKKKYSHIIKIRQLSILDCIDEIIECGRRKNVLVICNTVKRAQEVYKVIHENLRGFE
FT                   KIHVELLHSRFLEGQKTQKEKIIISNQMRNGIVISTQLVEASLDIDYDILFTELASADS
FT                   LLQRMGRIYRKRQYEEAVPNVIILTKEPSGIGKVYQKEIVERTETFLKKFHENKITEYD
FT                   KKELNEYVYDIDALSATNFINKFNKAYEILKLGFRSEKKIEAQKIFRDVVTISGIPREV
FT                   FNKNIDEIEEIVDKINSKDLNSIEKLKLISHIRKYTVTAPLYFFEKGGISCYDKKLGLY
FT                   LLDCEYDEQLGLKPPKDIEKSDIW"
FT   gene            143320..143832
FT                   /locus_tag="COB47_0119"
FT   CDS_pept        143320..143832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0119"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; KEGG:
FT                   CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41490"
FT                   /db_xref="GOA:D9THC5"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC5"
FT                   /inference="protein motif:TFAM:TIGR00372"
FT                   /protein_id="ADL41490.1"
FT                   /translation="MEDAMEFSDLKFQGIKINYLYICKRKLWLFSKNITFENKSDKVLL
FT                   GKVLHEYSYPKENTKEVLIDNLIMIDILSDGSIREVKYSSKMKEADIMQVMYYLYYLKQ
FT                   KGIHKQGIINYPKEKRKEVLELTPDYEEKIKQALREIEEITTKSIPPPAQKQKICKSCA
FT                   YFEFCWG"
FT   gene            143837..144817
FT                   /locus_tag="COB47_0120"
FT   CDS_pept        143837..144817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0120"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="KEGG: CRISPR-associated protein Cas1; TIGRFAM:
FT                   CRISPR-associated protein Cas1; PFAM: protein of unknown
FT                   function DUF48"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41491"
FT                   /db_xref="GOA:D9THC6"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC6"
FT                   /inference="protein motif:TFAM:TIGR03641"
FT                   /protein_id="ADL41491.1"
FT                   /translation="MQKTLYITSNGRLRRHENTLYFESGEEKRAVDIENIEQIHIFGEV
FT                   DLNTKALNYISQYGIILHFYNYYGFYSGSFLPRKKNVSGEVVVRQALHYLEREKRLFLA
FT                   YCFVESAVHHMMRNLRERKEAEAFLTAIEDEWEKGRFAISSVTELMGLEGRIRNIYYQS
FT                   FNQFLPDDFAIEKREKRPPTNPINALISFGNSLIYSHTLSQIYQTQLDPTISFLHEPSE
FT                   KRFSLSLDISEIFKPLIVDTVIFKLLNNHQITLEHFDEDLNYCYLNQDGRKIFIKELQT
FT                   KLETTVRHRQLNRNVSYKGFIRLECYKLIKHFIGDQVYSPLKAWW"
FT   gene            144842..145105
FT                   /locus_tag="COB47_0121"
FT   CDS_pept        144842..145105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0121"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="KEGG: ate:Athe_0128 CRISPR-associated protein Cas2;
FT                   manually curated; TIGRFAM: CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41492"
FT                   /db_xref="GOA:D9THC7"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC7"
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /protein_id="ADL41492.1"
FT                   /translation="MFVIVTYDINEKRVNKVRKILKKYFTWVQNSVFEGEITLGKLEKC
FT                   KRELLSVIEKDEDSVYFYEMEYKLVCNKKILGQEKNYDSIII"
FT   repeat_region   145343..156960
FT                   /rpt_unit_range=145343..145372
FT                   /note="CRISPRS"
FT   repeat_region   157041..157995
FT                   /rpt_unit_range=157041..157070
FT                   /note="CRISPRS"
FT   gene            158183..159468
FT                   /pseudo
FT                   /locus_tag="COB47_0122"
FT   repeat_region   160079..160240
FT                   /rpt_unit_range=160079..160109
FT                   /note="CRISPRS"
FT   gene            complement(160303..161546)
FT                   /pseudo
FT                   /locus_tag="COB47_0123"
FT   gene            161631..162375
FT                   /pseudo
FT                   /locus_tag="COB47_0124"
FT   gene            162594..165752
FT                   /pseudo
FT                   /locus_tag="COB47_0125"
FT   gene            complement(166015..167085)
FT                   /locus_tag="COB47_0127"
FT   CDS_pept        complement(166015..167085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0127"
FT                   /product="CRISPR-associated RAMP protein, Cmr6 family"
FT                   /note="KEGG: aae:aq_380 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated RAMP protein, Cmr6 family; PFAM: protein
FT                   of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41493"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC8"
FT                   /inference="protein motif:TFAM:TIGR01898"
FT                   /protein_id="ADL41493.1"
FT                   /translation="MSKQQKSKNLKSDQQANRQLNSAIAEWDNFSLAFLKGVSFEIRKN
FT                   KNFDLINQKSKKVYLQSISISKAKEKLPLIQNQINYKLKSIEEYLLANHFLKVIDINMK
FT                   NISRLVVGLGSEHVFETSLTLDYIWGIPYIPSSAVKGGCKAAAFWEIVSLILNNYDKKE
FT                   SQKEISQDEINEVAKYVFQNLYNEDIYFENYKLLDLSDINKRILLYKLIFGTKNFEGLF
FT                   TFLDAYPQNLSELTSIFELDIINSHYPDYYSNPINNPAGDWYNPQPVNFLAVKPGIEFK
FT                   FIVFYDKHRAEKLVEFFETKSTCETKSICFELIQLLEKDNFKIFKNIIKTALNFYGIGA
FT                   KTRLGYGLFEEVRRDN"
FT   gene            complement(167063..167434)
FT                   /locus_tag="COB47_0128"
FT   CDS_pept        complement(167063..167434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0128"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="KEGG: tte:TTE2632 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated protein, Cmr5 family; PFAM:
FT                   CRISPR-associated protein TM1791.1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41494"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:D9THC9"
FT                   /inference="protein motif:TFAM:TIGR01881"
FT                   /protein_id="ADL41494.1"
FT                   /translation="MNIKSIEQEMAQFCFNEISSYKIKLDKSDELLKFKSDIRRLPAMI
FT                   TNNGLLATLVFFKKSNENVYNIINGWFSNKLQNIDLIEYLTKENYEDLLFKTSEVLKLA
FT                   NWLKRIVEVEIKDVKTTEE"
FT   gene            complement(167454..168509)
FT                   /locus_tag="COB47_0129"
FT   CDS_pept        complement(167454..168509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0129"
FT                   /product="CRISPR-associated RAMP protein, Cmr4 family"
FT                   /note="KEGG: tte:TTE2633 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated RAMP protein, Cmr4 family; PFAM: protein
FT                   of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41495"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD0"
FT                   /inference="protein motif:TFAM:TIGR02580"
FT                   /protein_id="ADL41495.1"
FT                   /translation="MFKDVILATYYCETPLHMGSGQSISYVDLPIQREKHTDFPVIWSS
FT                   SIKGVARDKALRSGWSKTKLLYIFGSEAEESSDNLVASCISFTDAKILFYPVRSANGIF
FT                   AWLTCPFVIKRFIQEMEYTGILCDNPDILKAINEWITSIETPISQNKVVLIDENSCIKN
FT                   SSEKVMLEEFEFSSEVVSNDKIIGFFKEILPTNTLTEELEKRLAIVSDNIFSAFVKYAV
FT                   EIRTRIRIDQITGVVDDKALFTEELLPSESIFYGFIFSTDPFFGIGNDLYNKLKLSSVD
FT                   WEELGSSVSTEKLNILKEAAGEKCEDRYLSSQDVINQLKKLLDNGLLQLGADSTLGRGF
FT                   VKVKATSKLQG"
FT   gene            complement(168538..169773)
FT                   /locus_tag="COB47_0130"
FT   CDS_pept        complement(168538..169773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0130"
FT                   /product="CRISPR-associated RAMP protein, Cmr1 family"
FT                   /note="KEGG: tal:Thal_0006 CRISPR-associated RAMP protein,
FT                   Cmr1 family; TIGRFAM: CRISPR-associated RAMP protein, Cmr1
FT                   family; PFAM: protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41496"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD1"
FT                   /inference="protein motif:TFAM:TIGR01894"
FT                   /protein_id="ADL41496.1"
FT                   /translation="MREYNFHCEIVTPLYMCGSEKEKLELRSQSFNGLFRYWFRIGGGD
FT                   LEDEKRIFGFGGNNGRKGLVQIIVEQTSNKDSYQRSEKLNFELKKGFDYLNYFLRKREN
FT                   FCFQCGQQFKLTFRFSPLATEDDIKKFFCSVWLAMNLGNFGARARRGFGSVKVNKIDGS
FT                   DEIFKFLEFIPTAPLKDWFNKNLNSIKSILFSKERESIPCLFNNSVEIYYLKKGNLEDS
FT                   YKKWVSEIYKNKKKNKYMPHLKALDFELGNPLKALSFMGCLLMEFRNYYMPDYKNLISA
FT                   IKNPLSAKNNGITIERSVFGLPLPFRIGNYNYSVDACYKQSQNSKSRRASPLWFKILLL
FT                   NSPSNSSNSVECLFIVMKSDFLPNNMEILLNIQNNKNNENNEIKCSTNNWNAIDSFINT
FT                   LKYCDLIDKLDF"
FT   gene            complement(169776..171029)
FT                   /locus_tag="COB47_0131"
FT   CDS_pept        complement(169776..171029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0131"
FT                   /product="CRISPR-associated protein, Cmr3 family"
FT                   /note="KEGG: tte:TTE2634 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated protein, Cmr3 family; PFAM:
FT                   CRISPR-associated protein, Cmr3"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41497"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD2"
FT                   /inference="protein motif:TFAM:TIGR01888"
FT                   /protein_id="ADL41497.1"
FT                   /translation="MLKFEFEPFDVLFFGSGKAFNRGDDASSIFPPFSHTFAGAISKKL
FT                   ATFLNIESSKVIKYIYGPFVKRLTETYNEETNSCQKKETIFFSIPSNIYTARKEDNPNF
FT                   FCILKPLENRALKLFFSKNTNKPDKISTFCVYTKDETEIEPFTGFISIEYLKHWLEGSL
FT                   ENKLSNTNIDIENKKNIIKLDEICQNDNRIGIKINHRDGTVEKKSGVYRVSFKKLKIEP
FT                   AEKFSFVVWVEFNLEDENLKKTNLGYEQIKAIFEKSPRVLKVGGESRIVSYKIEEVSFF
FT                   DEIKDLLKVENTFVGFLKFENNNLLIFPEFPGKIIEIQKDEQIQILFLTHGVFDNFLPD
FT                   LLDKCGFRTITMTMNSCLNITLYSSKNTRFFSKAIPAGTVIWAIAEKDIEISSGNISSL
FT                   PINSFIGSNLVLIRKEKT"
FT   gene            complement(171058..174015)
FT                   /locus_tag="COB47_0132"
FT   CDS_pept        complement(171058..174015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0132"
FT                   /product="CRISPR-associated protein, Crm2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Crm2 family;
FT                   KEGG: tte:TTE2639 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41498"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD3"
FT                   /inference="protein motif:TFAM:TIGR02577"
FT                   /protein_id="ADL41498.1"
FT                   /translation="MSIWKLKLKAFLHDPLDKQWILSFDNDDPNTKAQLNIDKFTCPKN
FT                   KNHKEAIHEIVAEKFLNYILPGECIEELLPIIKIADRISYPMNEVLSEKLKSKTEKIRD
FT                   HKDICFRNIYIEKLEENVICKDFENKHQELEEFFKLLGNICSVLTCNDDKAKLAFLLLW
FT                   LYVPDLFKWVNIHPADSRIPSHSIYNHLVQTSAITTAIVDVDKLSSGDLVGSIPTFLIF
FT                   TIGPVQSFIATARKTQDLWAGSYILSYLTYKCLEPLIDQLGPDIVIYPNLRGQPLIEKR
FT                   WLYKTFEDENDCLEKIIKLLKGIYCKAENEDNSKLLIANIPNRFLAIIPYSKNTIVEEC
FT                   KKALENALKNFAKKIVNFIKKQLSEEEENKKFVKNQHSDELEINPSICDEIETQLLSYF
FT                   QVYYAILPWTTNKCNLQNSGKIPGGLTSENVFHDHKILFEESEIRNLIEEIIRIEQGLE
FT                   NKEDIDFSKVGIGRAYPLLIDLLEKLLGARKSVREIKFIPYYNREKCHLCGENEIVFLA
FT                   KDEEKNKLYWHKLREKNPGLLKQNERLCGVCLFKRLFPKLLEEEFGFEISSFPSTSEIA
FT                   CIPVKEKLLKTNPKFIEEFIEKYNQFKTQIESSGKKFPSSETVPALKKFFGTKYQDFAF
FT                   IDGQWLMEESYTKDYLKNELGIENIDESILENMRNFLKSANLNFSRYFAILQMDGDHMG
FT                   KWIRGFGKSEGDNIEFPTIGETIHPDVYNELLKNSNGIEELFNKIHPATPTYHQILSSR
FT                   LCSFALYDVRKIVEEKYFGKLIYAGGDDVLALLPVNTVLNCAYELQERYKKTVISRATM
FT                   SAGIVIAYHKYPLSLALKAVRSAEKKAKNKLGRNAFCVQLITHSGEIKECGGKWELVEF
FT                   INKVKNEFQNGSVPKVICNQIIEVINRLLDTEKEYVSEEIVDILELEIKRLWKRKKKNE
FT                   DKKSVLKIEDIIYCFRKCITEKEENCNKFKTQNILMFGYLFALAKFLTGKNDLDL"
FT   gene            174145..175557
FT                   /locus_tag="COB47_0133"
FT   CDS_pept        174145..175557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0133"
FT                   /product="CRISPR-associated protein, MJ1666 family"
FT                   /note="KEGG: tte:TTE2636 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated protein, MJ1666 family; PFAM:
FT                   CRISPR-associated protein DxTHG"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41499"
FT                   /db_xref="InterPro:IPR010171"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="InterPro:IPR027419"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD4"
FT                   /inference="protein motif:TFAM:TIGR01897"
FT                   /protein_id="ADL41499.1"
FT                   /translation="MKLIYQLGRLDTNMEQQKFKIGKDNEDYTEKAELSSLFLKKYFKE
FT                   KNNDEVKVILLYPVSLPFNPNLIRDNSKLHEISKKKIEEIWEREDEYFNNPYNYFESYF
FT                   PYCNEKDDFRIIHSLGSYSYGKKRDDAKKVQFDTTYGDIVLEIFLDMIKRYLKMNNSIS
FT                   EIYIDISSGHNIYISAMLEAFRHFATFTSLRHWVDKRKRPKFFITICDPILPGSENIYQ
FT                   VYIEEQRFNVFLESPIKRWEFEDIKSENFEDMKKMLFDKQTCELLVAVLERFLMTFSAI
FT                   KNNIPLYLFDTYTIIDEPDEIQKLLDEIIEYLHVEIAKNYKNSPKLDKNKWIKIINTLG
FT                   FYLGIIDVINHANILKYKKQKGVKKDDIKNIMKNIYNKFGLTNNIDILSVELDKLSPPD
FT                   RRIAADILRSNFRNLLNRKNRDRIQRNFFAHCGLEENFVIVNEENGDIYVEYIDDLPEL
FT                   REMVGKMLLERI"
FT   gene            175845..177869
FT                   /locus_tag="COB47_0134"
FT   CDS_pept        175845..177869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0134"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: ate:Athe_0142 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41500"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR017037"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD5"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADL41500.1"
FT                   /translation="MIELLFMLGILLILVYLLLKLIGLRVIPNDKVGIVEKWWSFKGSL
FT                   NEQIIALRGEAGFQPEVLRGGIHFRTPLMYKVHIVPLVTIPQGQIGYVFARDGKPLEPT
FT                   QTLGKVIPECNNFQDVRAFLENGGQRGPQRAILREGTYAFNLAQFIVITEDKIYYLPMG
FT                   NKEEKEMIEKMVQTLKSRNAFRPIVITEDKVGIVTVHDGPSLPSGDIVAPTVGDDPSNP
FT                   ETYHNNFQDPEKFLKAGGFRGRQLQVLVEGTYFINRLFATVELIDKTVIEVGYVGVVVS
FT                   YVGPKGQDTSGEDYKHGELVERGFRGVWKDPLMPGKYAFNTYAGKIVKVPTTNIILKWI
FT                   SNQTGTHRYDENLKEVSLITKDAFEPSLPLAVVLHIDYRKAPLVVQRFGDLKMLVEQTL
FT                   DPMVSAYFKNIGQRKTLIELIQQRDEIQKIASEEMKERFAHYNLELEEVLIGTPMSSPN
FT                   DNKIDAILEQLRDRQIALEQIETYSRQQKAAEKERELREAEARAAQQKLLTESEINIQI
FT                   QTNQGKAEYQRSIQEAQKIKALAEAEAEKEARIGIGRAIAIEEQVKAYGGPQYQVLQDV
FT                   MGKFTQALEKTGIDIVPETVVAMGEKASSASFNAFEMLLTLLLTKELGVEFKGKETEDE
FT                   NVKKIKQEILNSILLAKESDKKEKTEEISQDSQQQNAVS"
FT   gene            178089..180176
FT                   /locus_tag="COB47_0135"
FT   CDS_pept        178089..180176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0135"
FT                   /product="alpha amylase catalytic sub domain"
FT                   /note="SMART: alpha amylase catalytic sub domain; KEGG:
FT                   ate:Athe_0143 alpha amylase catalytic sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41501"
FT                   /db_xref="GOA:D9THD6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD6"
FT                   /inference="protein motif:SMART:SM00642"
FT                   /protein_id="ADL41501.1"
FT                   /translation="MSALKELVEILNNKAKEWDGKNDFRIPKLWDSFGYDGLEKKENND
FT                   GTISVNPYKFVARAVEKAILPYQKEGVDYLQSLSKILSQDRSVSKKPYSNWIEKSSVYG
FT                   MQIRTFSAWDHDCDRKLELENAFGLKDTGTFIKTIALLPLIKKMGFDAIYTLPITKNST
FT                   KYKKGEMGSPYAVKNFFELDPVLYDPMADQLSIDEQFKALIEACHILGIRFIIDIIPRT
FT                   SARDSDFILEHPDWFYWIKIDDLEDYGPPKLTLIKEFTKANEENIELIYKDPAVLKHIR
FT                   KFVQSPEKYAPEKWQSIKERCEKDKNLDFFELIEKEIGLTTAPAFSDCLNDPQPPWTDV
FT                   TYLRLYLDHPVQSAKYIDSDQPPYILFDIIRGNIFKGRKPNSELWEKISNIIVHYQKNF
FT                   GIDGARIDMGHALPKELEDMIISNARKEDPQFCFIAEELSMDAHKKAKKSGYDMIIGDL
FT                   WAREPRYYQGTMKKILDILVQLEVPVFAACEIPDSPRAASRLGGRDFSRFATVLNFFLP
FT                   NSVPFVTCGQEVYELQPMNLGLDPQPDGRFLLPKSDPLYGKLAFFDKYALHWTNQGADE
FT                   MINLIQTAADLKKRFSQFISKENFFKIPYNGKMILSFGYKLISESENEYFVIVANSDNL
FT                   RKKTAKLNLFKSGIFNAQRAENIDCLFSLKGEVDYHYSYPNLIVNLNPLDIKIFYFKIE
FT                   N"
FT   gene            180303..181049
FT                   /locus_tag="COB47_0136"
FT   CDS_pept        180303..181049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0136"
FT                   /product="polysaccharide deacetylase"
FT                   /note="KEGG: cac:CAC0358 xylanase/chitin deacetylase;
FT                   manually curated; PFAM: polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41502"
FT                   /db_xref="GOA:D9THD7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD7"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADL41502.1"
FT                   /translation="MSYDDGKKQDRKLVEIFNKYGIKATFNINAGLLGKDDRIAAEEIA
FT                   NLYQGHEVAAHTFNHPTIARCPHDQVVQQIIEDRKILEDIVGYPVRGLAYPNGSYSPDI
FT                   KSFLPYCGIEYARIVGNSNDFSIPVDFYEWKATCHHNHNLLKLAEQFLNFYKKQYLYLF
FT                   YVWGHSYEFDNDNNWDLIEEFCKMVGNHPDIWYATNIEIVDYINAFRNLKFSAKGDFVF
FT                   NPSAIDVWISVDDKIVKVDGGKITRL"
FT   gene            complement(181111..181743)
FT                   /locus_tag="COB47_0137"
FT   CDS_pept        complement(181111..181743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0137"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   csc:Csac_2402 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41503"
FT                   /db_xref="GOA:D9THD8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD8"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADL41503.1"
FT                   /translation="MKVVAFNGSPRKEGNTYHAIKIVANELEKEGIEVEIVHVGDKLIQ
FT                   GCLACGMCAKNKNEKCVIDDEVNEWIGLMKNADGIILGSPVHYSSISATLKAFLDRAFY
FT                   VSGANGNLLRHKVGAALVAVRRSGGTQAFLQLMQYLNYAEMLIASSNYWNIIHGTLPGE
FT                   VLQDEEGVQIMRVLGKNMAWLLKLIENGKGKIVAPEKEEKVRTNFIR"
FT   gene            182010..182762
FT                   /locus_tag="COB47_0138"
FT   CDS_pept        182010..182762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0138"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="manually curated; PFAM: regulatory protein DeoR;
FT                   KEGG: ate:Athe_0146 transcriptional regulator, DeoR family;
FT                   SMART: regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41504"
FT                   /db_xref="GOA:D9THD9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9THD9"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADL41504.1"
FT                   /translation="MFAEERKSKIAQMIKSGQSVKVSELAKLFGVSESTIRRDLAELET
FT                   LGVIKRTHGGAVNNFLTSFEPSFAEKEDKFAKEKEYIGKLAASFIHDGDTIILDSGTTT
FT                   QYIARNINAKNITIITNSVNIAYELSNNENVEVIVTGGVIRTKTKALVGDITQSILRQF
FT                   RVDKAFVAANGVSIEFGVTTPSHVEAAIKRAMIENAKEVFLVADSSKFGQVTFSLICPV
FT                   QRFDYIITDKMDEEKKSEYEKLGVKVIT"
FT   gene            182790..183725
FT                   /locus_tag="COB47_0139"
FT   CDS_pept        182790..183725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0139"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: ate:Athe_0147 1-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41505"
FT                   /db_xref="GOA:D9THE0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE0"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADL41505.1"
FT                   /translation="MIYTITLNPAMDMTVYIDVLKKGQVNRSHYCLMDAGGKGINVSKV
FT                   IKALGGQSIALGFLGNDNKDWFLKYLKDMQIDFDFIFVDGLTRTNIKIVETAQKVYTDL
FT                   NQNGFEVKKKDISLLFEKIDRIAKTDDIFVLSGSLPPGADEDVYVELIRMLKQKGAKVI
FT                   FDADGKALERGIIGKPDVIKPNIHEFKCLFDVDENDLNSIVNSARKLIENGIKKVLISM
FT                   GAKGAVFVTENLALFAKAAEAKVKSTTGAGDSMVAAISYGLSQNMDDISIFKLSLACAA
FT                   AKVSKEGVKPPEKNKIEEFLEKTKLERLGE"
FT   gene            183728..183996
FT                   /pseudo
FT                   /locus_tag="COB47_0140"
FT   gene            184083..185006
FT                   /locus_tag="COB47_0141"
FT   CDS_pept        184083..185006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41506"
FT                   /db_xref="GOA:D9THE1"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0153"
FT                   /protein_id="ADL41506.1"
FT                   /translation="MSLFKDFLKDSFLFTKKYYGYVFGIIALSFIFLLISFVILLIVGI
FT                   LLALIMGVDMSTISLLNDVEVFRFLSSKFVLYLILMVIIFIIWIFLILVFIQYPFMKTF
FT                   IEITRDRDANKSAFKIFFDTMKEKNFSIALKMIALGFLLALIFGAIFGIGILCIVFGIA
FT                   LKNLVGRILLLIVGVIGILLGIYILLRLMFANMILIDRDTGVVTSIKESARLTKGKVIF
FT                   VLAVLIYNSLISAVFQIPVYIFDTMFNQNYQYNIFFIVLSLAGFIFYLVAIPYLIVLNY
FT                   LPYNVLNVHSANIQNGSEKSDDYILG"
FT   gene            185494..186300
FT                   /locus_tag="COB47_0142"
FT   CDS_pept        185494..186300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0142"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ate:Athe_0154 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41507"
FT                   /db_xref="GOA:D9THE2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41507.1"
FT                   /translation="MSTEKFLKDELISVIIPCYNEAQNIEQTLKEIYEYFDESVPEYEV
FT                   IVVVEKSTDNTLEIVNLSKNQRTIVLENAKKFGKGYSLKKGIYFAKGQYILTCDADLPV
FT                   DIKKYFLPMLELLKKNEKVGAVFATALAIKTCRKERGFVRSIVSLIFFVLRQLFLQLPV
FT                   SDTQLGFKLFRADVLRKCCEKVNENGFLFDLLLTDLMLNAGYQIEEINVKVVERKIKSS
FT                   VSVAEIIKTTYKFCKYVLFTRSKLLRECTDKVMINDKNKSVKASSI"
FT   gene            186321..187457
FT                   /locus_tag="COB47_0143"
FT   CDS_pept        186321..187457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41508"
FT                   /db_xref="GOA:D9THE3"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0155"
FT                   /protein_id="ADL41508.1"
FT                   /translation="MNERKKEIVYIVLDLFIAAIPFLYITYLYRLGVANLESLKEVVFA
FT                   NSLLSTVFYISNIVMFLKIEYNVSFCTTFKVISIISLILGIILYILYPSYGWAISILLL
FT                   IDSFVIFLRGTMLIERNYIKGALINFLLHTSRFGILILFPLNGLLTRWIVSNIGGYLLV
FT                   LAAYSYLIKWILKGENKNSFANININEIRERAYYLFFVMMIFVIQNIDLLALKGMNFYN
FT                   SLVLTRPWGTVTYVVTVSIGNLVLINKKTYPYWIYLTVAWAGIFIGYISLGGYINYYLF
FT                   KIPYSFNLSILPILFYLLMATILFVNYSNYIKKKQLIIEPLCLFILIGSLKNKVSLVRE
FT                   LKFEVLILILIFLIIFHVFMTFLYSTYSKCKEKYKITS"
FT   gene            187476..188555
FT                   /locus_tag="COB47_0144"
FT   CDS_pept        187476..188555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0144"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ate:Athe_0156 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41509"
FT                   /db_xref="GOA:D9THE4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADL41509.1"
FT                   /translation="MKTILVLTQRDIYHKKAGGAERYLFNVLKGLSNHYKITCLCQNDG
FT                   TQKDYEVYDNITFIRFKTNLISLIFKAMFYYKKNKESIDLVIDHTNTHQFFTFLYVAKN
FT                   KRLLIVHQLALEIWEYYFPMCIGKVFKLLEKLLWRLSSGMAVTVSQSTKGDLQRFGFKE
FT                   EFIWVIKNSIRHKYISLPPAEKEDYLVSIGRLVPYKRFEDAIYLAKKLNRRIYIIGEGQ
FT                   ERYKRRLKNYTKKIKADVVFTGYVTEERKQEIVEKAYMHIFPSIREGWGLVISEAANLG
FT                   TPSLVYPVPGCLDATNYGKAGFVTKRIGKDYLLEKFLSIDREEYERMRICAFEFASQLN
FT                   YNKQCEEFLQVIQSIIENT"
FT   gene            188571..189656
FT                   /locus_tag="COB47_0145"
FT   CDS_pept        188571..189656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0145"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ate:Athe_0157 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41510"
FT                   /db_xref="GOA:D9THE5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41510.1"
FT                   /translation="MKLGILITTYNDGDIILRCLDSIYDQLDNLNFPVYVVCVDDGSDS
FT                   PLAYPHFDILRTEHRGRSYARIEGLKKILAENCTHFLFLDSDMVLPPGFLKKLQTVVEN
FT                   YDIDAFIIPEVAFSSYNNFWTKVKVFERNLYKVNYCKESGNIEAARLWKLFSFPGFVEG
FT                   LEAFEEIQPTILGIKKGLKIIKTEEIFIYHDEKKVTLRDLLRKKNSYFCCMLESGKCSK
FT                   WDIIKRYYFFRPHLYHKENLKKYIRHPVLTIGVILMYLVLTLNFLWVSISQNFIKKRND
FT                   EEMRRRERNILYKIKRKKFLTKTILVAIIIGSLILLGWNTVVKSSSWFKSIIIENMDYN
FT                   YGKDSNSIQPYAPKKTHPKGN"
FT   gene            189700..193923
FT                   /locus_tag="COB47_0146"
FT   CDS_pept        189700..193923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41511"
FT                   /db_xref="GOA:D9THE6"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0159"
FT                   /protein_id="ADL41511.1"
FT                   /translation="MKQEEVFQRQRKLAKAISLLAVIAIILIDTKNIWLNNGFIIFSDL
FT                   DFSGINDKRYIERIWGVFNRHFSSTNFFNLSRLFFIIPFYVLNFLLSFFYNQAMLKLII
FT                   LFCLLISGIGMFLLCEYLLIKTLKGFPDYVHYFGLIIPSVYYALNPWVIFRIQHIFLLS
FT                   GYSVFPLIIKEFLRLFEIKIFNFQKDIEEYQQRRRVTKEHIIIDEKINLRDFFKIVLYS
FT                   MIGSAAIHYFFFYIIFLTILFIGIILRIWKLNRYSKAILLFYTRKYFTMIILMIVGNLY
FT                   WFLTYSIALLFVNIEPQNVNVVDTLQLFSRNSSVQNVLYLISYWLPFFNLEMFLDNMFW
FT                   IAGGVFLLIIAYIIFYRFGWHFYVRLFTIVTSLVILLSLGTNVDPLADVYVKVVTNIPV
FT                   IGHLFRDPNKIVGILACFLAIILGFGVDRIVFFLLNAGFGRKFAVAFVLVMLLCFYYYQ
FT                   RPVKIFYIDNYYKGVPIPKEYKEISKYYTKDGKILWIPTMDNMVLLNGISAYKWNVNNE
FT                   MPGSMKAVGDFHVYASSKNTIFQHENNVGTVSYFYSYLQHLLDKGGTDKIGRLLELTGF
FT                   NQVAYHRDVQNQEERQKFNLFVLEKQKGVKLRKKLGFIYLYDVEKNPNNTKLDIYNTKG
FT                   LNHFIQLFDFENILGTKGYNIVWSQGKREEFDLRKVNLVVGDSRFDIFQQIIPEKYIIS
FT                   LFDKINTGNPYVGWAKSMCKESDWFWIHKVNSLNRLPWDYDYGKGFIFTYTPYTVELPP
FT                   YKLNKNVGEVILNSNDIVKTDFFEIDKEETNFKLEITKDVMGNSILAAEVAPKKFIGNV
FT                   FWKIARSKLMSIKPGFISLRAVVSGVNAGKVHFKLKFFNQNMNELGVVYGSVPGEVAEF
FT                   NKALITANAVVPPATKYMRVELWLLEDQKTPVYFWIHDFELRYFSSISSNELRIKVPSY
FT                   IKGEYHLYVRALVNENGGKVKINDTKINLKGDENQFKWLYVGKYTRDTIIIKPEEGFVL
FT                   LNLLCVLPDWLHKEIQNMDLKSKQAIVLFSNEFTLEKGYKIKNLENYYLHPNFVDSQLD
FT                   IITEGIYTKKIDILRNDHYKLYFIGNITNKVAITLKNKDNKVMRFGYLKFLKLINNNFN
FT                   GIRFYVSNKPYSYFLNIEKEGNPKWNSQLYYIDLGFLKKGQYILEIKVENGLKSLTEPN
FT                   DIHVLHPEEVKVNLKVDDTLYILISNILQEAVTTKKKENKIFSSKYSDIYSDRIKYWLI
FT                   YGTKQIESRKNELYYVDFDIKTKGMAEVSAKILFMDKNKVLYDSQYIDIFNNKGQSIFS
FT                   AKKDGFVQIVFFVRSNGKEDGMFELKQIRFIEISEMNKFSSVVILPSNIQKGSKLNILN
FT                   EAYNPLWENNGEKAKQVNIFLNGFYNQSNKYTFGQKTQMAYVFGLLVSIIYIAMNLWLL
FT                   LIRRK"
FT   gene            194092..194463
FT                   /pseudo
FT                   /locus_tag="COB47_0147"
FT   gene            194627..195409
FT                   /locus_tag="COB47_0148"
FT   CDS_pept        194627..195409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0148"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: csc:Csac_2435 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41512"
FT                   /db_xref="GOA:D9THE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41512.1"
FT                   /translation="MRYILSVKDLYMDYGQGNVLNGISFDVEPGQIVGYIGPNGAGKST
FT                   TIKIFLGIIPNYTGKVEIFGEDIRNKYLYKKRIGYVPEIIELYESLTAIEYLNFVGQLY
FT                   GLSERQITKRAMRLIEMFDLQEAINSRLSTYSKGMRQKLAIVASLIHNPDLLFFDEPLT
FT                   GLDANSATVFKELMKELKNEGKTIFYSSHIMEVVERVSDRIILLSQGTIVADGPFEELA
FT                   QKLKQRNLEELFNQLTGFTNHQDIAKEIVSIIKGERDE"
FT   gene            195402..197084
FT                   /locus_tag="COB47_0149"
FT   CDS_pept        195402..197084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41513"
FT                   /db_xref="GOA:D9THE8"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE8"
FT                   /inference="similar to AA sequence:KEGG:Csac_2434"
FT                   /protein_id="ADL41513.1"
FT                   /translation="MSNNNFLAIKILEMFSGMIRKWGINFDVAKTILVYKFLMSKRTLP
FT                   SFSRASQIDRVTRVFVVLIELILGVIPAMFLLIDAPIFIKFSLNIAVLMFLLVSTIISD
FT                   ISWFILDIAEKNIILSKPVDDKTYSFAKNYFIVVMIFSKTIRTFIPSLILVLFKYNVAF
FT                   FIVLVLIYFLLVIFSYCICHLLYAGILVYFDGEKLKDIIVSFQIVFMIVATAAYQLTGR
FT                   IVQIIGSVHFGKVQYFWVYLLPSSWFAAVFEVLFGKGKNLVYVALSIFSLIITLAVLLL
FT                   QIFYTGKILEKNLVKLNSGEAEVKPKIYKVGFLSNLFLRNGIQRASYIFAKAQLKRDRT
FT                   LKSIIYPTIATFLVVVIAPAIQFIFNKSDHQKSFNIQFFFLYSMYAFIIGVISTLPAIQ
FT                   ITSNKNASWIYNAMPIENPFDIKKGAYLAFVFTIVVRLFILLSFGMFIFLRNSLIDYLI
FT                   IFFVLIFFSTLMFPLATAQMPFSLDIKERGTGKKGSGLTYLMYMAIGIGLGFVHGLLPK
FT                   ESKPIFLAGLIVLDTILWILMFEMSGLFKSIDNSVAKQTYKRL"
FT   gene            197107..197880
FT                   /locus_tag="COB47_0150"
FT   CDS_pept        197107..197880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0150"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   csc:Csac_2433 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41514"
FT                   /db_xref="GOA:D9THE9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D9THE9"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADL41514.1"
FT                   /translation="MLKAMKEIFKYIGLLFLSMLIVSVVALIFTSTPPTALLYMGSAFL
FT                   FMVFALISLKRKKVNILELCSFHKITIKDIIFSVLLAISFLFVYGGISGLTGIDNLIPD
FT                   GNDYYNKYQKMKNNGIISMSISIALVAPFFEEFIFRGLIFGVMQKSRLNIFVAIVVQAL
FT                   LFGLIHLNLYQGIFAFFIGIFLALALYWTGSIWSSIVMHFTVNSLAVIVILFSDSVYLN
FT                   EKVPQKDFILPLIIGVVLMYIAIKHFLSIKIRASR"
FT   sig_peptide     197107..197187
FT                   /locus_tag="COB47_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.902) with cleavage site probability 0.434 at
FT                   residue 27"
FT   gene            complement(197906..198241)
FT                   /locus_tag="COB47_0151"
FT   CDS_pept        complement(197906..198241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41515"
FT                   /db_xref="GOA:D9THF0"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF0"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0308"
FT                   /protein_id="ADL41515.1"
FT                   /translation="MCLFRSIWGIPCPGCGMTRALLAVLKGNLLAAFYYHPLCVVVILY
FT                   PVIYIIFKVRKSKQIFDVWKNKALKTIIRLFLFVWIIRMIFFFPHIPPLDFEKNSLIGR
FT                   LLQHLFY"
FT   gene            complement(198246..198650)
FT                   /locus_tag="COB47_0152"
FT   CDS_pept        complement(198246..198650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41516"
FT                   /db_xref="GOA:D9THF1"
FT                   /db_xref="InterPro:IPR025328"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0160"
FT                   /protein_id="ADL41516.1"
FT                   /translation="MPGKKRSVVGLLIFSIITLGIYWLYWIYATSKETQEYSGKQTLSP
FT                   GLELLLCIITCGLYWFYWIYKYSKIAVECQQKAGLPPEDNAVINLILSILGLGIISSMI
FT                   LQASLNKVWEFESSKNDSVISTTDTSKNKE"
FT   gene            complement(198829..199998)
FT                   /locus_tag="COB47_0153"
FT   CDS_pept        complement(198829..199998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41517"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0161"
FT                   /protein_id="ADL41517.1"
FT                   /translation="MKLKRSVKLFFVFVVILSFVISSVAYSQTNSGLLIKAGSAYLQAQ
FT                   NAKTVDEEIRIDLRFSLGKNAKEEDKILEEFLKKMYIKTRVVSDIVKQEANMTLSFYYN
FT                   NKQIITGSIYANKELAVYNFPQIYSKPLYVKLSDAYKNMPVKIDVEKYTKLFDIKANKQ
FT                   LQDLVASYAPVLMPQLTAAAKFSDKKVDVVFSNGKKQSCDEIIFEFNKNSSIEILKTIL
FT                   TKAANDAKTKEFILQLTKLILEDYKASLQSNMQSQEELNIPDLDVNEVMGLINQNYTQT
FT                   INEAVYSIDELKPQIPPFTLQYRMMIDDKNNLKGERLYFYLKDSNDFKIMIDIKGVINS
FT                   LNANIKVQKIDISNGADMTKLTEKDFEIMQKNLENILKKLGLPMVGTKM"
FT   sig_peptide     complement(199915..199998)
FT                   /locus_tag="COB47_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.954 at
FT                   residue 28"
FT   gene            complement(200270..200806)
FT                   /locus_tag="COB47_0154"
FT   CDS_pept        complement(200270..200806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0154"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: ate:Athe_0163
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41518"
FT                   /db_xref="GOA:D9THF3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF3"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADL41518.1"
FT                   /translation="MKDLKGTQTEKNLWAAFAGESQARNKYTYFASQARKEGYEQIAAI
FT                   FEETAENEKEHAKLFFKFLNGIGNTQENLKAAAEGEHYEWSEMYKEFARVAREEGFEEI
FT                   AIAFEFVAKVEEKHEERYRKLLENVENGKVFVKDDVVVWKCRNCGYVHVGKEAPKVCPT
FT                   CKHPQSFFEIRAENY"
FT   gene            complement(200830..201252)
FT                   /locus_tag="COB47_0155"
FT   CDS_pept        complement(200830..201252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0155"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="KEGG: csc:Csac_2429 ferric uptake regulator family
FT                   protein; manually curated; PFAM: ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41519"
FT                   /db_xref="GOA:D9THF4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADL41519.1"
FT                   /translation="MNDLKLLKDQLEKKGIKPSLIRLKIYEYLTKHKTHPTAEEVYSTL
FT                   LKEIPTLSKTSVYNTLSLFVEKGLAQMITIEENIARFDADTSVHGHFQCKVCGKIYDFL
FT                   VEKDSIESSLDPSFDVEEIYVYYKGVCPYCKNKNLS"
FT   gene            complement(201406..203082)
FT                   /locus_tag="COB47_0156"
FT   CDS_pept        complement(201406..203082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0156"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: ate:Athe_0165 alpha amylase catalytic region;
FT                   PFAM: alpha amylase catalytic region; alpha amylase
FT                   all-beta; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41520"
FT                   /db_xref="GOA:D9THF5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF5"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADL41520.1"
FT                   /translation="MDLHKKWWKEAVVYQIYPRSFYDSNGDGIGDLPGIIEKLDYLQEL
FT                   GVDVIWLNPIYKSPNADNGYDISDYYDIMDEFGTMEDFDRLLNEAHKRGIKIVMDLVVN
FT                   HTSDEHKWFLESRKSKDSPYRNFYFWRPGKNGKPPNNWTSFFGGPAWEYDSQTGEYYLH
FT                   LFATKQPDLNWDNPQVRQEVYKMMKWWLDKGIDGFRMDVINLISKVEGLPDDREGEKKG
FT                   GLVGFKYYANGPRVHEYLQEMNREVLSKYDIMTVGETPFVTPEIAKLYVEYDRNELNML
FT                   FHFEHMDMDCEGSKWNVKCWKLTDLKKIMYKWYLALKDKGWNSLYLNNHDQPRMVSRFG
FT                   NDKEYRVESAKLLATLLHTWQGTPYIYQGEEIGMTNCKFKSIDEFRDIETLNFYREMKE
FT                   KGISDDSILEILNKRSRDHARTPMQWDDSENAGFTTGKPWIKVNPNYKEINVKKALADK
FT                   DSIFYYYKKLIQLRKTHPAVVYGDIQMLYENDEKIFAYTRSYGNEKLLVVMNFSEEEVE
FT                   FCAPKEIFFNKPELLISNYEVEDDIQQKIVLKPCESRVYKI"
FT   gene            complement(203215..203841)
FT                   /locus_tag="COB47_0157"
FT   CDS_pept        complement(203215..203841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0157"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   ate:Athe_0166 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41521"
FT                   /db_xref="GOA:D9THF6"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF6"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADL41521.1"
FT                   /translation="MLVFIVLLEFFCGSLMFSYWLGKLFKKDITAVGDGNPGAFNLIQA
FT                   VGFKIGILGVALDFLKGYFPLVYFVEKGYLPKSYIIAGAIAPILGHAFSPFLRFRGGKA
FT                   IATTFGVWSATTRFRVSLFYAVVLALLFLIAKKLKHGGPTTTQEDAFMVVLGFTIVGAY
FT                   LYLNSFSVYLLTLWFLNLIIMIYKNKEKLSSFYISLTDRQHEIKK"
FT   gene            complement(203843..204937)
FT                   /locus_tag="COB47_0158"
FT   CDS_pept        complement(203843..204937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0158"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   csc:Csac_2426 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41522"
FT                   /db_xref="GOA:D9THF7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41522.1"
FT                   /translation="MTFLFLLLICWAVGFILFAKISLDQEETTEMPDVKVSVIIPARNE
FT                   EKNLPFLLESLKRQSLKPYEVIVVNDFSEDKTKEIAKSFDVKVIDNPPIPVGWTGKNWA
FT                   LWNGYLHSSGQILIFLDADVRLSEDGIEKLTKALFKSKGAISVIPYHKTEKFYEKLCMI
FT                   VNILGVFAFTSPYERKSKQKGLYGSCIALFREDYQKIGGHKSICSKVTDDLSLGKRLSS
FT                   FNINIENYLGIDKVFFRMYPNGIKSQIHGIAKSAALSMQLLQRKTILLIALWVLGLTLS
FT                   GFLTPFLFFIRHPLLKIFLLAYLLYFVQILYLQRYIGNFGIVMPLFHFVSTAFFLFMVL
FT                   YSFYQLKFTGSVWWKGRQIEVGGK"
FT   sig_peptide     complement(204878..204937)
FT                   /locus_tag="COB47_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.672) with cleavage site probability 0.671 at
FT                   residue 20"
FT   gene            205261..205506
FT                   /locus_tag="COB47_0159"
FT   CDS_pept        205261..205506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0159"
FT                   /product="NikR nickel binding"
FT                   /note="PFAM: NikR nickel binding; KEGG: ate:Athe_0168
FT                   putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41523"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF8"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ADL41523.1"
FT                   /translation="MERRIGVIGIVVENRKEVSDKLNKILSDHGDIIVGRMGIPYKERG
FT                   LCVISLIVDGTTDEIGALTGKLGSLSGVKVKSALTK"
FT   gene            205530..206963
FT                   /locus_tag="COB47_0160"
FT   CDS_pept        205530..206963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0160"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; KEGG: ate:Athe_0169 biotin and
FT                   thiamin synthesis associated"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41524"
FT                   /db_xref="GOA:D9THF9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D9THF9"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ADL41524.1"
FT                   /translation="MFRKDEWERAEFINDQMVYDILEEGSKNVDRAEEIIEKALQLNGL
FT                   EPHEVATLLYIEDKDLLEKLFKAARQVKERIYGKRIVLFAPLYISNFCVNNCRYCGYHR
FT                   SNTKMKRRKLTMDEIRKEVEIIESLGHKRIALELGEDPKEAPIEYVVDSIKTIYSVYKE
FT                   KGNIRRVNVNIAATTIEEYRMLKEAKIGTYVLFQETYHRPTYEYMHPEGPKSDYDWHAM
FT                   AMDRAMQAGIDDVGLGVLFGLYDYKFEVVGLILHAKHLEERFGVGPHTISVPRIRPAEG
FT                   VEVTKERYPYIVSDDEFKKIVAIIRLAVPYTGMILSTRERPGFREEVIDLGISQISAGS
FT                   CTGVGGYTLEYEGKSTGDLDEDLAQFEVEDKRSPDEVIRTLCEAGYIPSYCTACYRKGR
FT                   TGDLFMQYAKTGDIQDFCTPNALLTFMEYLEDYSSEKTKEVGRRLIYESLNQIKDERMR
FT                   KETEKRLEMIKSGVRDLYF"
FT   gene            complement(206983..207369)
FT                   /locus_tag="COB47_0161"
FT   CDS_pept        complement(206983..207369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0161"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ate:Athe_0170 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41525"
FT                   /db_xref="GOA:D9THG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41525.1"
FT                   /translation="MKVCIVDDAQFIRIMLKDIFTSLGHQVVAEFPSASPLIEEIEDLK
FT                   PDIITLDITMPDIDGLTATRIIKNILPETHVIIISAISQPDIEKEVKKCGAFEFIRKPF
FT                   SKLAIEHVIKQIEKEQNSKNGAVR"
FT   gene            207528..208250
FT                   /locus_tag="COB47_0162"
FT   CDS_pept        207528..208250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0162"
FT                   /product="O-methyltransferase-like protein"
FT                   /note="KEGG: ate:Athe_0171 O-methyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41526"
FT                   /db_xref="GOA:D9THG1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0171"
FT                   /protein_id="ADL41526.1"
FT                   /translation="MLRKENLKIGNYSIYQDTDFFLYGTDAVVLSDFIQLKKNDIVVEF
FT                   GTGNLIIPILLWAKGKKFKKLYALEIQKEVCDLAILNRNINNLQDRIEVINADLKDALK
FT                   IFGSEFANVVFTNPPYRKVSSGTINPNIRKAIARHEIMCTIEDVVRSAMQILKFGGRFY
FT                   MVYRSDRLTDALYYLRLYKLEPSLIRFVHQNKEKESSLVLIEAKKGKQCLLKVDKPLFI
FT                   DEMEYYLERQNGSEGEII"
FT   gene            208247..209092
FT                   /locus_tag="COB47_0163"
FT   CDS_pept        208247..209092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0163"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: ate:Athe_0172
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41527"
FT                   /db_xref="GOA:D9THG2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG2"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADL41527.1"
FT                   /translation="MSGKLFIVGTPIGNLDDMSKRAIDTLNSVDFIACEDTRVTIKLLN
FT                   HFGIKKKLVSFHEFSPKEKEEKIIYELKSGKKIALVSDAGMPLISDPGYELVRRCIDEG
FT                   IEVTVVPGPSAFVCALVLSGQNTYSFVFEGFLPKNKRAKREKLESLKYEKRTLIFYEAP
FT                   HKLLDTLCQMAEIFGEEREISIVKEITKMHESVMLTTLGNAVEFFKQNSPKGEYVLVVK
FT                   GYEDVEEKMQDDVELIRKRLKEKLLRGFSKKEAAKMVADELNLPKNKVYKIVIENNEFK
FT                   "
FT   gene            complement(209166..209408)
FT                   /locus_tag="COB47_0164"
FT   CDS_pept        complement(209166..209408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0164"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: csc:Csac_2420 AbrB family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41528"
FT                   /db_xref="GOA:D9THG3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG3"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADL41528.1"
FT                   /translation="MKSTGVVRKVDELGRIVLPIELRRTLDIAEKDALEIFVDGDKIIL
FT                   RKYEPACIFCGNAKDVIYYKGKNICKDCMEELKKS"
FT   gene            210169..210729
FT                   /pseudo
FT                   /locus_tag="COB47_0165"
FT   gene            complement(210706..211939)
FT                   /pseudo
FT                   /locus_tag="COB47_0166"
FT   gene            212096..214756
FT                   /locus_tag="COB47_0167"
FT   CDS_pept        212096..214756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0167"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   tit:Thit_1727 pectate disaccharide-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41529"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015295"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG4"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADL41529.1"
FT                   /translation="MILIDNVRIKCISQNSEQGASQNPEQEQTVISKEDVVFDFEDPEK
FT                   GTMGWQNGWGSALEGQPQPQRTEDLKISGNSGSLKIFPNYKIGTDWTWEEAAVQVWIYG
FT                   QQDTKFDLTGYKYVEYDVYIPDPTQWLDGGKITIGSAFNSDWFEIKTVGYMIEDIKSYP
FT                   IVTINGKRYTVIHRSDAFNGNNLGRNHGQLVIRIACQNAIYKGPIYLDNISIRQNPTAY
FT                   VPPTSEGYDNPASQTSCSTSNTSSSTIIYWQWVAPTVTQQSNQENNTNIVFDFSKQDDL
FT                   MGFKEPWSGALKSAKNLRWSNDISENGLDGAIKLDAAFDPNNGWHDFNVGKWLGPTEGS
FT                   PVDLKNFEQLEFDVIVDKLLFEKSAGGIAIKAALNGDPGGWADIDEEFNITKDTTSSSK
FT                   VVLSSFKIKDKEYTKIHVTFKLKESLKTNTRGQLVIQIAGQNSNYTGPIYIDNVILVVS
FT                   GGKISTSTQQNETQQASDQKTATEQKSTVSSSQPVSVNKNDKVFDFSNKNDLMGFKEPW
FT                   SGALKAAKSIGWSSDVSTDGKNGALKLDVKFDPNNGWHDTNIGVWLGTKEGEVFDFSPY
FT                   KVVQFEMYLPKALFEKASGSLAVKVALNGEPGGWADVGEVFGIDKNKQNDDVVTLTTVK
FT                   VGANEYVKVLVNFTIKQELRNNKRGQIILQIAGQNSNYEGPIYIDNFKLISDSKPNTQD
FT                   TGIPQPKTPVEFKDISKHWAKNEILFVSSLSNVFRTTEMFEPDKKIRRSEMIDWLVNCL
FT                   GINGSISDVRFNDVSKLSKYYNSIAIAYNKGLIKGDGKGNIKPNDAMTREQVIVVLIRT
FT                   IELLKGKININENKIAQFQDANLVSEWAKESFEKALQIGLISGYRDNTIRPQNACSRAE
FT                   AAALIYRVYNYILQK"
FT   gene            214950..215969
FT                   /locus_tag="COB47_0168"
FT   CDS_pept        214950..215969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0168"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: cpy:Cphy_2278 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41530"
FT                   /db_xref="GOA:D9THG5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG5"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL41530.1"
FT                   /translation="MKRVTITDIARSLNISRNTVSKVLNGSSTVSEETTIKVIKKAIEL
FT                   GYPKIKPELIEKVRSARENKKVAILIKAALSEFWIDIINGISNELGKYGYSLFYNYISD
FT                   EDEKNLVIPLNIANHEVDGLIVLSVFEDEYMNRIKEYKLPTVYYDAPLNADLEDLQGDV
FT                   IFTECEASVYKLTKILIEKGLTPIGFIGDTNYCKSIYERWLGFEKALKDSGLDVQKEYC
FT                   ITEHVPFRYYVQEEIDMGLEKMKKYPRAFVCANDDIAIFAMRYLKEKGYKIPQDIAIVG
FT                   FDNLKRSVLVDPPLTTVNIDKEAVGRRLAQAIVRRIENNTPIFETVRLSTQIIIRGSC"
FT   gene            216019..218889
FT                   /locus_tag="COB47_0169"
FT   CDS_pept        216019..218889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0169"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_0174 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41531"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41531.1"
FT                   /translation="MVSLNGKFLTKKQMFARLLVVFVIQILFLWAVAFSQQGKVLSLQQ
FT                   YLNKYKDVPKPKRTIIIPAISFSSYGETTVKKKIELAGQKDVLAWEKEGGYVEWKVDIP
FT                   ESGLYNMAMLYLPLPGKGLGIELSVLIDGEFPFDQAQKITFPRVWKDTTGIRKDKKDND
FT                   LRPKTDEYPIWQEEDFKDTEGFYNRAYYFYFEKGEHTIRLVNIREPFAIKYIKIYNKDE
FT                   VPNYSEVSKNYSSLPKAKDILVKFQAEKTYLKSDPILYPMYDRTDPATEPFHVSKIRLN
FT                   TLGQWNWKYPGMWASWKFEVPQDGLYKIVIKARQNFQRGMSTHRILYIDGKIPFKEAQD
FT                   IEFPYSIRWYMKVVGSKDKPYLVYLTKGEHELKLEATLGELSPILTEVEELTVQLNNLY
FT                   RKIIMITGRDPDLYRDYNLDEQIPDLIDSLNSIRKGLLKQAQDFEKYTGQKGGEAELLK
FT                   RVAEQLKSMAQEPETIPARIKNLRDSLSGLSSWLVYRKEQPLEIDYILVASPDAKIPSP
FT                   TANFFQKIVKEIKAFLYSFVEDYTNVGETYQGQKVIKVWVGGGRDQAQIIRDLINDSFT
FT                   PRTNIKVNVSLVQTGVIEAILAGKGPDIVLTVSRGQPVNLAARGALVDLSKFKDFDEVK
FT                   KRFNLTALKPYEYNGGCFALPVTQDFYMMFYRKDIFDELNIKPPQTWDEMYAVIAKLQR
FT                   YNLEVGLPYQRIDAQEAIDAGLGTRNLFPTLLLQLGGSFYNKEKTRSMLDSSQAVAAFK
FT                   QWTDFYTKYGLELIYDFYNRFRTGEMPLGIAPYTTYNLLATAAPEIRNQWEMVPIPGIK
FT                   RPDGTIDRSTAASGTATIILSRAKNKQACWEFLKWWTSDEVQTQFGKELEMLMGTAARY
FT                   NTANINAFQKLPWSKKEMQNLMEQWKYVKEIEEIPGSYYVIRSLDSAFSAVIYDGMNPR
FT                   ESLWRYTKDINDELERKRKELAMYNK"
FT   gene            218918..219811
FT                   /locus_tag="COB47_0170"
FT   CDS_pept        218918..219811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0170"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2418
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41532"
FT                   /db_xref="GOA:D9THG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41532.1"
FT                   /translation="MGLIEDIKKNKASYLMIAPYMLLFTIFTLIPVISSIFLSFTNYNM
FT                   LQPPKWVGWANYIRLFLADKIFIKVLRNTFIFAFLTGPLSYFMSFFLAWFISEFNPKIR
FT                   AILTLIFYSPSLAGNVFFIWAFIFSGDAYGLINGWLMRLGILKEPINWLQDPNYVLWVI
FT                   IIVQLWLSLGAGFLAFVAGFQNLDKELFEAGAIDGIKNRFQELFYITIPQMAPQLMFGA
FT                   VMQIGASFGVSTVVIALGGLPTRQYSADTVVTYLIDYGTVRFEMGYASAIAVVLFIAML
FT                   ITNKVIAAILKRYSTE"
FT   gene            219861..220430
FT                   /locus_tag="COB47_0171"
FT   CDS_pept        219861..220430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2417 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41533"
FT                   /db_xref="GOA:D9THG8"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9THG8"
FT                   /inference="similar to AA sequence:KEGG:Csac_2417"
FT                   /protein_id="ADL41533.1"
FT                   /translation="MAKLNAPSHKKINRSVYGNAVIFVILFILGMFTALPLWYTLVSAF
FT                   KPFDEIFIFPPRLYVRRPTLDNFILMFQLATNMWVPFSRYLFNSLFICVVGTVGHILIA
FT                   SLAAYPLAKHSFAAKKAINEIIVLALLFTPQVTYIPLYIVMSRLHLSQYTFDFLKISFV
FT                   FFKFRSYKNLFSACYFYYCFILPHED"
FT   gene            complement(220883..222169)
FT                   /locus_tag="COB47_0172"
FT   CDS_pept        complement(220883..222169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0172"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: csc:Csac_2393 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41534"
FT                   /db_xref="GOA:D9TF85"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9TF85"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADL41534.1"
FT                   /translation="MKYTQNEKILQVTEKTLVVGVDIAKEIHVGRAFDFRGVELGKRIE
FT                   FENRKEGMGKFLDWANKIMKAHGKENVIVGIEPTGHYWLCFEQYLRENGIKVVLVNPFH
FT                   VKRSKELDDNTPTKSDIKDPKTIAMLVKDGRYTEPNIPAGIYAEMRVAMNIYERLQKRL
FT                   SVLKNQIINWLDIYFPEFLEVFSDWEGKVALLTLKEMPLPCDVVEKGVEGIIECWRDKV
FT                   DKRAISRKRAMELVEAAKRSIGKKEGRKLARQEMRYLLEEYELLRKQLEGIEDEMAKLL
FT                   KDVPNGEKLLEIKGVGVKTAVGFISEVGDIMRYEDAKQIQKLAGLNIVENSSGKHKGQT
FT                   CISKRGRGRLRSSLFKAMITIVAKNEEFKKLHMYYTMRQNNPLKKKQSLIALCCKLIRI
FT                   FYAILKKGIKYDGNKMLSDIKREALATTA"
FT   gene            222301..222720
FT                   /pseudo
FT                   /locus_tag="COB47_0173"
FT   gene            222778..224883
FT                   /locus_tag="COB47_0174"
FT   CDS_pept        222778..224883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0174"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   csc:Csac_2416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41535"
FT                   /db_xref="GOA:D9THH0"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH0"
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /protein_id="ADL41535.1"
FT                   /translation="MRIKKVKRIIGFALMTLLMVAIPGYSFANMIEVPYYQYNYDIYNW
FT                   DIPSAAGYYPYEVLSGKDLGVGNFSSPRDMFVDSNDNIYILDAGNNRIVKLNKDFKFIS
FT                   EINTFTQNGKVFKFSDPSGICVDKNGVIYIADKGAKCVYVINQNGQLLRKITKPKSDLV
FT                   AANKDFVPLKVAVDNAGVVYVLSLGSYEGAFMFDSQNNFLGFFGSNKVVLTLQLLIDRI
FT                   WKKILSKQQSASMVRYLPTEVTSIDIGDDGFIYTCSNYASVSVGELKKLNFLGKNILWY
FT                   KKKDQTRDFGDLPKYYGKRLEDSYFVDINVTKDGFINALDYERGRVFQYDQNANLLFIM
FT                   GGKADQAGTFREPAAVESIGNTILVLDQQKATITVFKETKFGELVHRATVLYNDGKYDD
FT                   ARKLWEQVNKMDVNFALAHVGLGKALLRMNKYSEALYHFRLANDKEGYSEAKEVLRNDF
FT                   LKRNFGVIATALVLAIIVIYILQRRLKKQKGVDEEYTRKISKEKYPLYVMLHPFKGYEE
FT                   LKDEKKGSVLIATIIVLLFFVVSILHRQYTGFIFNPYRQDRINVISIFSATVVMFFLWV
FT                   LSNWSVSTLTEGEGTFQEIWIFSAYALLPYIICRLLYVILSNVLIMEEGMFLAFINIIG
FT                   LIWLIIGMLCAIKAVHQFSFGKTVATMVASLIGIVVILFIMILVFTLFAQLFGFIQSIY
FT                   NELILRM"
FT   sig_peptide     222778..222864
FT                   /locus_tag="COB47_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            224911..227124
FT                   /locus_tag="COB47_0175"
FT   CDS_pept        224911..227124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41536"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH1"
FT                   /inference="similar to AA sequence:KEGG:Csac_2415"
FT                   /protein_id="ADL41536.1"
FT                   /translation="MSFNKLLKKAVLFLLAMSMLLEQMMFLQGNTALADTNSYQLVAKN
FT                   GILELYVNPKYGYFKVVDKRSGSVWFSNPEKWREDKIAAGNTRMQMASQLSIRFTDVTS
FT                   TIQIANAYVNSVLKKGLKIRRIKDGFIATYTFKKEGFVIPVACTIKDDYLNVDILVNQI
FT                   KETKKDKYKLVSIMLLPFFGAAAIGENGYMVVPDGCGALINFNNNKGQETYTQRIYGAD
FT                   FGIVPDFQGYVTQAARLPVFGVKKENSGFLAVITKGDGKAILNANTSGSKSSYNNIFAE
FT                   FIMREYDMVTLKEKQWDERSFNIFEEKLPNVDKFSIRYYFLDSKNVDYVAMAKKYREYL
FT                   IKERGFKKEVSEKSVPVYIEFYGSMKKPKYILGIPVNATIPLTTFEDAQKIVKQVKSMG
FT                   VSDVVVKFVGWMKNGVYYNLPLLATPERVLGGKKQLENVLEYFQRANVKTYLDVDFVLF
FT                   RTGTLTYLRNKVATKSMKKVPAQLWRYSPPIFYKDDSYPVLYLISPRYTNEIVQRFLAS
FT                   SNINYFNNISLSSMSTMLYSDFGTKPVNRYQTEDVFLQAIGSLSKRFRNILLTNPNGYL
FT                   LQKASEIVDVPIYSSKFLIEDAEIPFYQMVIRGYVPYSMPSVNFYTNEWMWKLKALETG
FT                   SAIKFTWTARNEDELKETLLENLYSSNYRMWIGDLKEYYKELYPTLRLIKDKEIVEHKI
FT                   IKKGVVKVVYDGGVEILLNYTSNPQKIENLEVAAQSYQVVVKR"
FT   sig_peptide     224911..225015
FT                   /locus_tag="COB47_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.706) with cleavage site probability 0.658 at
FT                   residue 35"
FT   gene            227132..228049
FT                   /locus_tag="COB47_0176"
FT   CDS_pept        227132..228049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0176"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0179
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41537"
FT                   /db_xref="GOA:D9THH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41537.1"
FT                   /translation="MSFSGAFKKVFRKRRLTLREKEAMYGRLFILPWLIGLLYFFIIPF
FT                   ITAVYYTFTKIKIGDSGLEFSFVGFENYLYAFTKDPNYIRTLTSSIGSMLYQVPVVVFF
FT                   SMFVAYVLRDEFKGRTFARTIFFFPVIIASGVVITILKENVMGDVSQAASNTTLFRVEN
FT                   IRMILINSGVPMWLGQFIVNTISQLFDLTWRSGVQILLLMAALHNIPKSFYEAAVIEGA
FT                   TEWEKFWKITFPMVSPTLLVAVIYSIIDYFTDYGNQVMRMVVTQLNNGRFEYSTTIAIV
FT                   YFAIIMVIILIVNRVIGRRVVYLT"
FT   gene            228112..229125
FT                   /locus_tag="COB47_0177"
FT   CDS_pept        228112..229125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0177"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0180
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41538"
FT                   /db_xref="GOA:D9THH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41538.1"
FT                   /translation="MEVATKSKSSKVARNFELSGFGMAIFKKRLFAFLKNLFRYLFIIG
FT                   MSYVLLYPVLFLISNAFRDKVDLLDPSVVWIPKHFSIESFKLANEILGYVQSIKNTLII
FT                   LIPSVIIQTFICMMVGYGFARFRFKEREILFGILLFTIIVPMQTIIVPLYVKFRHFDFF
FT                   YFGRLIGLFTGKPLTVNLLDTPWTFYILNTFGMGIRSSLYIFIFRQFFRNMPTELEEAA
FT                   KIDGCGPFSTFLRVMVPNATGAIITVLLFTIVWHWNDYYLSAMFFTDNLPLSVMLTILN
FT                   ERMNLLNNLVNANDIYLLRSSVLEAGCLLVILPLIAIYIIGQRYFTESIERTGIVG"
FT   gene            229206..231011
FT                   /locus_tag="COB47_0178"
FT   CDS_pept        229206..231011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0178"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_0181 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41539"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41539.1"
FT                   /translation="MFASKLFKKVLAFVVSISMVLGLFVVLNKSQNPAQAATKLGDISF
FT                   FRPGLTQESFKNTSDLFAQAVKKAIDTYQKNYGGKIKLVYSDWNNWDTKIITRMAAGDP
FT                   IDVVFGGSGNFPRFYTKGYLQPINNYVDLKAPYLNLRAMDQIFKYEGKYYLASQYGSNH
FT                   FWVVLYNKDLMLEEGIDESEMPLALYKNGKWNWDTFVALAKKLTTDTNGDGKVDRYGVG
FT                   CWYPQIFVYSNGVTYVNVDKSGNAKLNFDDPRVQKGLNIAQKGIKEGWMITDWNTASTG
FT                   LAQRKIAMYIERWYNYDDQKFNQKVEDEIEVAPIPLGPDNKNKLYPFECDGYGISKGAR
FT                   NPKGAGKFINILLESIQKYCDDPGIKRRPKYLQDFHTQLAKYSFYPGSPDSVLGNLVWD
FT                   INGALSNAASVSSALAGLKPQAQQAVSEANAKPEKPVFRPFKPFTIDFENGKMDMFTVL
FT                   DTTKKSVKLSIVSGKEAIKGKSLKVACDSKKDGEWIDALYSVPSKVKIYGWHDYKVSFD
FT                   VKLLKAPPKPGDTYIYAQIINSNKSGYKSYGWITFKLDKANTVYHVEGTIAGIPDNSTT
FT                   MGLKIGIHWGTDFVIDNIKVEEVIQ"
FT   gene            231124..233835
FT                   /locus_tag="COB47_0179"
FT   CDS_pept        231124..233835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0179"
FT                   /product="Mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /note="KEGG: dth:DICTH_0009 mannan
FT                   endo-1,4-beta-mannosidase; PFAM: Carbohydrate binding
FT                   family 6"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41540"
FT                   /db_xref="GOA:D9THH5"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015295"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH5"
FT                   /inference="protein motif:PRIAM:3.2.1.78"
FT                   /protein_id="ADL41540.1"
FT                   /translation="MRKGLKIASLIVSLVFLLGLLPTGIFGAVETSVQSYVFDFEDGTT
FT                   MTFGEAWGDSLKCIKKVSVSTDLQRPGNKYALRLDVEFNENNGWDQGDLGAWIGGVAEG
FT                   QFDFTNYKSVEFEMFVPYDEFAKAKGGFAYKVVLNDGWKELGSEFSITVNAGKKVKING
FT                   KDYMVIHKAFAIPDDFRTKKRAQLVFQFAGQNCNYKGPIYLDNIRVRPEDASNLSKEDY
FT                   GSSEEEEIKEDFFTGVTLVYPVEGKNFVYNFEKDTMGFYKYSGDGFAKKTKSMEFSQDL
FT                   KTSTNAGSLKLNANFQGTAFEEMNIAVKLTDKEGKLFDLGKYSALEYTIYIPNPDKVAG
FT                   KIMSASAVDSPWKIIKDFTALNFKDKTTWKEINGKTYAVIKCKDNLYNVKEKAGVLVLR
FT                   IAGSYVKYTGPIYIDNVALIAGKKVTPKVERISLPNPKTYYKVKIEAESASDGWAYSVE
FT                   KENAKFSGKGYVLLFGNNMGNTLYNIKVPKTGHYIFTLAISTLGLVKDGSIDIWIDGDL
FT                   KGGARVPNIKGKFQEVVVRKKIYLTEGEHTISLQKSGGYTIAVDYFVIEELVAANKSKL
FT                   SVSSKLVTPNPHPNAQRLMNYLASIYGEKILSGQQSSGEGKEVQMIFDVTKRYPAVRSF
FT                   DFMDYSPSRMQRGTKGTDVDEAIKWWKSGGIVAFCWHWNAPTGLIDQPGKEWWRGFYTE
FT                   ATTFDLKKAMDNPNSEEYKLILRDIDAIAQQLKKLQAEGVPVLFRPLHEASGGWFWWGA
FT                   KGPEPYIKLWKLMFDRLVNYHKINNLIWVWNGQDAAWYPGDQYVDIIAEDIYEEKAQYS
FT                   PYTERFVKALKYTNANKMIALSECGTIPDPAVLKQEGVSWLWFSVWAGGYVMTGSKYND
FT                   EWNDNHMLRKIYNSDYVITKDELPDIKSIPLK"
FT   gene            234081..235829
FT                   /locus_tag="COB47_0180"
FT   CDS_pept        234081..235829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0180"
FT                   /product="Peptidase M23"
FT                   /note="KEGG: ate:Athe_0190 peptidase M23; PFAM: Peptidase
FT                   M23; Peptidoglycan-binding lysin domain; G5 domain protein;
FT                   SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41541"
FT                   /db_xref="GOA:D9THH7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADL41541.1"
FT                   /translation="MAKNISKSKSSATATVLDQEKARFVSKNTNDNEFKQSLKEPSKKP
FT                   EKPLVRADAKKEKKKSKGKKTTDRENNSYLHRFWRAISSKIKPAIIKKSHVFRNKPEGS
FT                   IFSYKHFRKNHLGSILDEILKIVIGLRFIGNIRNSKEGVLKLKISVTLAFMIFIIFAIN
FT                   KIPTTYQKAYAVLLNGSIVGYVKDKTEAQKLFSSLKKEISSKHGTDEFVFQNSPQLKEI
FT                   PPGQYKSTSLDSIKNTIIEKGVVLVKRYALFVNSKAYLIFENSEMPKNILNKLKAIYYK
FT                   GEARSARFLEKVEIKPIYVKPDMKVVTEQQALNKIMFGKDEVVEYTIKEGDTLWDLARK
FT                   YNISVDDIFASNPGLTEKIMPGQKIKLTQMTPLVNVVLEKEVEFVDTLPKEVKTIKSDK
FT                   YYTTQTIVKQEGKDGKARIRAKIVYLNGLEYDRQVISQEILDKPVERIVVVGTKKPPRY
FT                   FATGRFSYPTWGVLTSRFGYRGREFHEGIDIAVPWGSNVYAADGGIVEFVGWLGGYGKL
FT                   IIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGIPQN
FT                   PLRYLN"
FT   gene            complement(235913..236566)
FT                   /locus_tag="COB47_0181"
FT   CDS_pept        complement(235913..236566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0181"
FT                   /product="exsB protein"
FT                   /note="KEGG: ate:Athe_0191 ExsB protein; TIGRFAM: exsB
FT                   protein; PFAM: Queuosine synthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41542"
FT                   /db_xref="GOA:D9THH6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH6"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADL41542.1"
FT                   /translation="MVLSGGMDSTTLLYDVKNQGYEVFAISFLYGQKHSKELEFAKKTC
FT                   SLLLVPHKIVDISFFAELAPSALTMPDWNVPEGYYTDSTMKQTVVPNRNMVLLSISAAY
FT                   AISLGAKKLFYGAHAGDHPIYPDCRKEFVEAMKKALYLADYIGLELEAPYVDMKKEDIL
FT                   KRGLELGVDYSLTWSCYKGGQKACGRCGTCTERIEAFKKAGVKDPIEYEIEIDW"
FT   gene            complement(236592..236969)
FT                   /locus_tag="COB47_0182"
FT   CDS_pept        complement(236592..236969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0182"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: ate:Athe_0192 endoribonuclease L-PSP; TIGRFAM:
FT                   endoribonuclease L-PSP; PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41543"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH8"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADL41543.1"
FT                   /translation="MKKCIVSNDAPKPVGPYSHAVQAGNFLFVSGQLAVNPMSGKIEGE
FT                   DIKAQTQLVFKNIEAILKEAGFSFEDVVKVNVYLATLEDFAKFNEVYSTIFTQNFPART
FT                   TVEAKLLPGALIEVDVIAVKE"
FT   gene            complement(236997..237398)
FT                   /locus_tag="COB47_0183"
FT   CDS_pept        complement(236997..237398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41544"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:D9THH9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0193"
FT                   /protein_id="ADL41544.1"
FT                   /translation="MFFIGIFGIEEKAKAIRQIDVTICPFCSRKGNHTLLKVYNYFHFF
FT                   FIPLFRWNVRYFLQTSCCNRIYIITNQKLAHDLEHGIDTPITLADVELFRKFEPSYGFE
FT                   DERSDFCPNCQRRVSKTFLYCPYCGNKLE"
FT   gene            237540..237734
FT                   /locus_tag="COB47_0184"
FT   CDS_pept        237540..237734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0184"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: ate:Athe_0194
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41545"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI0"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADL41545.1"
FT                   /translation="MKVIFVGKNKELEVKGPKTVVNLAKELNITLEANVFIRNGEIVAP
FT                   DDILNDEDTIEVISAVSGG"
FT   gene            237763..238674
FT                   /locus_tag="COB47_0185"
FT   CDS_pept        237763..238674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0185"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: ate:Athe_0195
FT                   PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41546"
FT                   /db_xref="GOA:D9THI1"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI1"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADL41546.1"
FT                   /translation="MKCVRCKGKGIIYLKRHNAAFCQDCFLYYYKNQVKKNIKRHKMFD
FT                   KKDKILVVISGGKDSMALWHILASEEYNVTGMYINLGIGEYSDKSQQVVESFAQKNNLE
FT                   VIIKDIKKEYGLDIYKLSKLLKRSTCSVCGSIKRYLFNKVAYDGGFSAVATGHNLDDEA
FT                   ATLLGNVLSWEEGYLARQSPVLDSTHPKLVKKVKPLYTLTERENLFYVLINKIEFLHDE
FT                   CPHAVGARSIMYKEVLNRLEEESPGTKQRFITSFLEKGRKHFQDVYEKVELKECSICGQ
FT                   VTTTDVCSFCRFVRLSNQNTEH"
FT   gene            complement(238738..238893)
FT                   /pseudo
FT                   /locus_tag="COB47_0186"
FT   gene            239030..239467
FT                   /locus_tag="COB47_0187"
FT   CDS_pept        239030..239467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0187"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   ate:Athe_0204 protein of unknown function DUF296"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41547"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI2"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADL41547.1"
FT                   /translation="MKTFRIKECKEKSLFILNLEPGDLLLESIKKFVQENFIKHGCVIS
FT                   GIGTLKKLRYHRVLNTNYVPENEYLTIEGAIELSALQGLIINYEPHLHFVASDLEKTYS
FT                   GHLEDGCEVLYLSEILLLPLEDIKLKRIPDKRNVTYITLEE"
FT   gene            239536..240231
FT                   /locus_tag="COB47_0188"
FT   CDS_pept        239536..240231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0188"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   ate:Athe_0205 FldZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41548"
FT                   /db_xref="GOA:D9THI3"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI3"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ADL41548.1"
FT                   /translation="MFSQSENQELIEMFSQLRVADVRDGLDAILLHHYCSLPSTIRPLF
FT                   RTKAVGIAKTVRYIPYRGEIPKLSPEEYSEWCGYYYQKICPYPWMSEIQKGDFIVIDQS
FT                   EIDAGLMGSNNSLEGYAKGAVGYLTNGGPRDTDELIIQKIPFWSKFVSQKTVIGRLQFD
FT                   AMNVPVNIEGVLIKPGDIIVADGDGVVVVPRERAAEVYEFAKKELDADKASRRKLYDML
FT                   EWEYDDTVK"
FT   gene            240444..240882
FT                   /pseudo
FT                   /locus_tag="COB47_0189"
FT   gene            240958..241113
FT                   /locus_tag="COB47_0190"
FT   CDS_pept        240958..241113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41549"
FT                   /db_xref="GOA:D9THI4"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL41549.1"
FT                   /translation="MKVPASRREAGIYWQLISYTVVIIVKFLFPVPFKKVLHLILQFRF
FT                   FDFHLK"
FT   gene            complement(241085..243466)
FT                   /locus_tag="COB47_0191"
FT   CDS_pept        complement(241085..243466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0191"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: ate:Athe_2329 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41550"
FT                   /db_xref="GOA:D9THI5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL41550.1"
FT                   /translation="MNKFFQKDIYLRIVLSYLAIFALIFLIGLYTYFITYKISVKNLNR
FT                   YTTSLLNHLPLRVYDEIVKPLDLIQQSINRNPFYLSLFLNSDPLTNKNEIIFEIRDFCN
FT                   TLKLYYTNPFITEIGVYIPKDNIIISPAFFESAELFFRYFVTPISINQREWLKLLSSSN
FT                   YNYFSPPITFNLNKYIGNNRKDCIVYLHSLDNWQFDGANAKLFILIDKDKLAEYLKDIS
FT                   LYKESNIFILNPKGEILVSYAPNSELFLTVSKLNFKEDNINVISEINYKKKNWKCFYTI
FT                   DQNAWKYIVFIPSSSFFSSLSYFRVYFILFFLISTLVGVPLIIILSQKSYHPVDEIKKI
FT                   LFKKINIHTNSKTCPENCSHSFNKKESIMLKEIAQILLREEEKLKQQLTSMLPIVQNSF
FT                   IENLLKGNILLLNKEEYEKYQINFISDTFCVILIEICNINKISEELSLKHDLLRVIVFN
FT                   VFDEVLSTDNSKCFNVILSANILAIVLNIGSNNLNITDIIKNLEHAKSFLEQNFCLYIT
FT                   VGLSSIKTGIESISDCYYEAETALNYKFISGNLKVNAFENLPNQYYRRKNVYVPPEIEN
FT                   KIYNAIFEGNKFLVENLLELIYERNIKKSEITTIEAKVLCIQLVVIFENACRLINYTPS
FT                   EDLINYLEKTVISHINNETIQDFFYKIKQMFAQLAQYVEKNNLSLNRRVSIEKIIEYIN
FT                   KNYSDPNLSLVSIADEFKVTPQYLSLFFKEMTGQKLSDYIINLRIEKAKYLLINSTLSI
FT                   SEISQHVGYNYPTNFINAFKKRVGISPAKFRIISNENQKI"
FT   gene            243697..245289
FT                   /locus_tag="COB47_0192"
FT   CDS_pept        243697..245289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0192"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2032 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41551"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41551.1"
FT                   /translation="MRKKRLALKCVVSLVTVCFFLLTILPNLISVNAASSSKPTLTYWC
FT                   NLSGRIGAHYQNYAQLPLYQIIMKKFNVNLKFIHPPVGGESEQFNLLIATRQLPDMIEY
FT                   SWEGYPGGVQKAIEDKIIIRLNPYLDRYAPNLKKFLDSRPDIKKMMTTDDGTVYNFPFI
FT                   RSDKTICIFYGPMIRKDWLKKLNLQTPETIDDWYKMLVTFKNRKNELPGVKTPFYPFSI
FT                   LAYGSNNGNPRRTFDYCGFLCGAWGFKTDFYVENGKVKFGALHPNFKDFVALLQKWWKE
FT                   GLIDPDIVTTNNSGIEAKVLNNQIASFLGLIGGNMGTFLSNKKGTDFDLVGVPYPVLKK
FT                   GQTPEFSQMDFLYKKYGTAITTACKNIPLAMKILDWAYSKEGYMAYNFGILNKTYVIKD
FT                   GKPYYTDLILKDPLGPVSAISKYTRSQVDGPFIGAKEFAEQTRLPQQVEAAENYAKSKN
FT                   DKWLPPVSLTKEEAQKLSNIMNTIDTYYDEAFSKLITGKSNNIEGLVKTLKKMRIEEAI
FT                   KIYQTAYNRYIKR"
FT   sig_peptide     243697..243798
FT                   /locus_tag="COB47_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.659) with cleavage site probability 0.474 at
FT                   residue 34"
FT   gene            245386..246330
FT                   /locus_tag="COB47_0193"
FT   CDS_pept        245386..246330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0193"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2331
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41552"
FT                   /db_xref="GOA:D9THI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41552.1"
FT                   /translation="MSIFKGIMTNIYDIVKDLKRNKSLYFMILPILLYYFIFHYIPMYG
FT                   LQIAFKDFSPAKGISGSPWVGLEKFKEFFVYDSYYVWRIIRNTILINVYDIIFGFPAPI
FT                   IFALLLNEIKNNFYKRTLQTISYMPHFISTVVIVGIILDFFSRDGLINYILKSLGIIPE
FT                   PIAFMTEPGWFRPLYVGSGIWQHLGWGSIIYLAAISNIDPQLYEAAIIDGAGRFKQALY
FT                   ITLPGIMPTIIIMFILRVGSIMNVGFEKVFLMYNPLVYETADVISTYVYRKGLLEMDYG
FT                   YGTAVGLFNSLVNFLFVVLTNYISKKFTETSLW"
FT   gene            246357..247238
FT                   /locus_tag="COB47_0194"
FT   CDS_pept        246357..247238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0194"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2332
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41553"
FT                   /db_xref="GOA:D9THI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41553.1"
FT                   /translation="MKKRSIGEVLFDTINYIFLGLICFTMLYPMVYVIFASLSDPLKLM
FT                   AYRGPLLKPIDFTIKAYKLLLNYPMIWIGYRNTIIYVVLGTTLNIFLTTMGGYVLSRKY
FT                   LKLKNLIMFFIVFTMYFSGGMIPTYVVVQSLGMIDTIWAMIIPGAISTMNLIIMRTGFL
FT                   SVPDSLEESARMDGAGDWTILFRIMIPLAMPTIAVMILFYAVGHWNAFFNAILYLRRRE
FT                   LYPLQLVLREILIMGDTTYMETGVSDADDRLALTRLIKYAAIVVSTVPILCIYPFLQKY
FT                   FVKGVMIGAIKE"
FT   gene            247289..248989
FT                   /locus_tag="COB47_0195"
FT   CDS_pept        247289..248989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0195"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="KEGG: pjd:Pjdr2_2995 beta-galactosidase; PFAM:
FT                   glycoside hydrolase family 2 TIM barrel; glycoside
FT                   hydrolase family 2 sugar binding; glycoside hydrolase
FT                   family 2 immunoglobulin domain protein beta-sandwich"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41554"
FT                   /db_xref="GOA:D9THI9"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D9THI9"
FT                   /inference="protein motif:PRIAM:3.2.1.31"
FT                   /protein_id="ADL41554.1"
FT                   /translation="MIRLFTQHKVRKQKELEGLWDFTILSDNENIFQKKFTHKMWVPGC
FT                   WETHPEFSKFRGKALYKTTIECDRKTNLRFVFKGVSHTAEVFFDNFKITQHYNAYTPFD
FT                   AIVKSVEKGKHELLVMVDNSFSEDSALHIPNDYFTYGGIIRPIVMEEINDIFIKRLEFS
FT                   PALIDDNTWTAEISVYVRNISDKAANVKIDGNLDNWHLDFGVWCVREEQELKISKKFTF
FT                   DGIRAWSSENPQLYLLNIRLWKDDSNECIDDLIERVGFREIKVSSSKIYINGKPVFFKG
FT                   FNRHEDHPDYGCAIPFQMMVKDIELIKQSGANMIRTSHYPNDERFLDLCDEYGIYVWEE
FT                   NHARGLTLQQMQNPNFDIQCENCNREMVLNHYNHPSIVIWGILNECASHTPEGREKYKK
FT                   QIEQIRKMDKTRPITFASCMHFSDLCLDLVDIISMNIYSGWYEDRDANEFFDKLYCWIQ
FT                   QAGGAGKPIIISEFGAEGLYGFRDPFARVKWSEERQADILEDNLKVYLNREEISGALIW
FT                   QFCDCKVTEEGKVFLGRARTKNNKGVFDEYRRPKLAYDIVKKFFMYKNG"
FT   gene            249228..249446
FT                   /locus_tag="COB47_0196"
FT   CDS_pept        249228..249446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41555"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ0"
FT                   /inference="similar to AA sequence:KEGG:Csac_2522"
FT                   /protein_id="ADL41555.1"
FT                   /translation="MKYIQNEKILQVTEKTLVVGIDIAKKRHVGRAFDFRGVELGKRIE
FT                   FENRKEGMEKFLDWANKISICQELGVF"
FT   gene            complement(249793..250263)
FT                   /pseudo
FT                   /locus_tag="COB47_0197"
FT   gene            complement(250427..251101)
FT                   /locus_tag="COB47_0198"
FT   CDS_pept        complement(250427..251101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0198"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ate:Athe_0196 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41556"
FT                   /db_xref="GOA:D9THJ1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023868"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL41556.1"
FT                   /translation="MLNLYNNEELIKFNVVEKFVSIEGEGIRSGYPAVFVRFAGCNLSC
FT                   SWCDTKYATENPKYEQIDIDTLLNFIASTGIKRVTLTGGEPLIQPYIYILIDRLIYEGF
FT                   EVNIETNGSVSIKCVPRDAIITMDYKCPSSGMEDRMIVDNINFLGQKDVLKFVVATHED
FT                   LKSAERIIKTFNPKCNIFFSPVFGKIEPAEIVKFLLENGLFDARVQLQLHKIIWSENSR
FT                   GV"
FT   gene            251418..251852
FT                   /locus_tag="COB47_0199"
FT   CDS_pept        251418..251852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0199"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: ate:Athe_0201 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41557"
FT                   /db_xref="GOA:D9THJ2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL41557.1"
FT                   /translation="MELREKKIKLLKLLKEVSIKVKDALRYRDDNVKIPASHWMLMNVL
FT                   DKNGEMKVGDLSKFLGLSNSTVSGIIDKLEEQGYLERRRSTEDRRVVWVKTTQKFKDSL
FT                   KQHFKEAEKQFEGVLSKATEEELDKIIEGFETLKKVLEKQ"
FT   gene            251887..254148
FT                   /locus_tag="COB47_0200"
FT   CDS_pept        251887..254148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0200"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0202 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41558"
FT                   /db_xref="GOA:D9THJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41558.1"
FT                   /translation="MKKVLRYVKPYTLLVLAAVLFVFIQAMSELTLPDYMSKIVNVGIQ
FT                   QSGIENAVPEAISSSTMEKVLLFVPQDKKDDILNMYKLLTKSSDDYSSYLKKYPLLSKE
FT                   DIYVLKKKDRDSLDRVNVQMGKAILAAFGIEKMKKEAKGGIINFNGRQIPASIDLFAIL
FT                   KQLPQEQINQIQQEINKKFSSLGDSMIVQAAAVAIKDEYKKIGIDIGKMQNAYIIKMGL
FT                   LMLLLTLVSAISTILVAFFAARVAAGVARDLRKDVFSKVESFSIEEFDKFSTASLITRT
FT                   TNDIMQIQMLLVIGIRMIFFAPVMGFGGVIKALSKSVSMSWIIALAVIVLLGLIMILYA
FT                   IAMPKFMIMQKLIDKLNLVARENLSGIMVVRAFNAQKFEEQRFDEANRDLTKVGLFVNR
FT                   AMAVLFPSMLFIMNGTTLLIVWVGAHYIENSSMQVGDMLAFMQYAIQIIFSFLMLSMLF
FT                   ILVPRAAVSAGRIEEVLSTEPSIKNPEKPEKFREDMKGMVEFKNVFFKYPGAEEYVLEN
FT                   INFKVMPGQTVGIIGRTGSGKSTLVNLIMRFYDATEGQVLVNGVDVRSVKVEDLRERIG
FT                   YVPQKSWLFSGTIKSNLKIGNDFATDEDLRQAAEIAQALEFIEEKPQKFDTEIAQGGTN
FT                   VSGGQKQRLSIARALVKNPDIYIFDESFSALDFRTELKLRRALKEKLKDKTVIIVSQRI
FT                   ATLIHADQIIVLEDGKIAGIGKHEELLKTCETYREIALSQLPEEVTTVENNNAKRCNFN
FT                   "
FT   gene            254159..254755
FT                   /pseudo
FT                   /locus_tag="COB47_0201"
FT   gene            254742..256280
FT                   /locus_tag="COB47_0202"
FT   CDS_pept        254742..256280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0202"
FT                   /product="transposase"
FT                   /note="KEGG: ate:Athe_0076 transposase; TIGRFAM:
FT                   transposase ; transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41559"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ4"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADL41559.1"
FT                   /translation="MVTVQTKLIFEGSEDKQKVLDLMRRWSSCMRYAYKRLLEGHKRNE
FT                   LKKQLQGIFNLNSRYVDDAIMKAKSILTSCKERGENPNKVVFGGRQLFEKLQKRHINGK
FT                   AYRKLQLKWQEKRKGNLYSRGDRSKKGNLNTRIEIDEDCTKLRINVGEREYVYAIIQPG
FT                   WKIKDRTYTDRNQLLQAIGTCGEPYSVELKLKNGKIYAYFTVEEVFPRPAMTRTSGVIG
FT                   IDTNAYPRHVAWTETDKSGQLLEYGRIPMPELESGSSSKREYYRWQYAYMIVEMAKDNQ
FT                   KALVIEKLNIKDKGKRGDFSGRKSRRIRHYFGYRSLLEKVKLLAKREGVEVIEVNPAYT
FT                   SVIGMLKYAPQFMVSKDVAAAYVIARRGLGLRERIPHNYMMFLSRLDVNELEELKEYVR
FT                   KVVKNTYVRKKQLREIDRAKKFLQSLGSEAERLSVPLDGTSAGSRGKNHNLWRVLRVAV
FT                   VTPLSPDRVLRDMSVLKSLLVSGQVGKTYKGVSSCFLGQGLWLSQIPPAGAGKA"
FT   gene            256355..258241
FT                   /locus_tag="COB47_0203"
FT   CDS_pept        256355..258241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0203"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ate:Athe_0203 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41560"
FT                   /db_xref="GOA:D9THJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41560.1"
FT                   /translation="MSERQSTSSTMNIQRPRRRGPGGPMGPAFVGEKPKDFKTAMKKLI
FT                   RYLSSYKLSLTAVIVLAMLSAAFSIAGPKILSKAITKIFEGLMSKVSGTGSGIDFEYVG
FT                   KIILILLGLYIVSAIFGYLQGWIMSGISMKLTYRLRKEISQKINRLPLKYFESTNQGEI
FT                   LSRITNDVDTLTQTLNQSLTQVITSTTLVIGALVMMLSINLLMTVVALLIIPLSFSVVM
FT                   LIISKSQKFFMQQQEYLGHVNGQVEEAYGGHIVIKAFNAERKTIEKFNIYNEKLYNAAW
FT                   KSQFLTGVMMPLMNIIGNLGYVVVTVLGSYLTIKRTIEVGDIQAFIQYIRSFTQPIAQI
FT                   ANISNILQQTAACSERVFEFLEEEEEVPDTPNPEINLESIKGDVEFRNVRFGYRPDRIV
FT                   IKNFSARVNAGQKIAIVGPTGAGKTTIVKLLMRYYDVNDGAILIDGHDIREFNRNDLRS
FT                   LFGMVLQDTWLYNGTIKDNIRYGKPDATDEEVIRAAKLAHADHFIRTLPQGYDTVLNEE
FT                   TTNISQGQKQLLTIARAILKDPKILILDEATSSVDTLTEIQIQKAMDNLMKGRTSFIIA
FT                   HRLSTIRNADLILVMDHGDIVEQGTHKELLRKGGFYAQLYYSQFEKEEELAG"
FT   gene            complement(258300..259574)
FT                   /locus_tag="COB47_0204"
FT   CDS_pept        complement(258300..259574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0204"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ate:Athe_0206 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41561"
FT                   /db_xref="GOA:D9THJ6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL41561.1"
FT                   /translation="MPPKNQQNGVVKKGVLSLTYVAVAFIIVLDILLGIAMPPKFKLYS
FT                   ILVATITFILTLSLTAFMIRYEMNKMITKLEDVLEKIKNGDYSKLISSKEFGNIQRVAS
FT                   SVNIVLSDIKTLIESFFDLSNAIVGASKKVTKTSEEAAAAIEEIAKTIEEIAKGASQQA
FT                   EEAQHGVLLVNNLSEQINAVSESYNAVIDEANKIDSLNKEGIEKMSALREKAEIAVTTA
FT                   ENVINTITSFIERIKNISNFVEVINTIAEQTNLLALNAAIEAARAGEAGRGFAVVADEV
FT                   RKLADQSKKAADEINSIVDVILGETENTIKIIDEIKSAAFGQKDAVIESQQSFAKISDE
FT                   INAIVEKTYIVKDALVRMEDARNAVIKAIESISSVSEETAAASQEVAATVENQLNSINE
FT                   MKYSAQSLQKLVDELEKKLKKYKIR"
FT   gene            259763..261007
FT                   /locus_tag="COB47_0205"
FT   CDS_pept        259763..261007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0205"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; KEGG: ate:Athe_0207
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41562"
FT                   /db_xref="GOA:D9THJ7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ7"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADL41562.1"
FT                   /translation="MSKFVIEGANKISGCIKVHSSKNAILPLLAASLLSSEPIEILDLP
FT                   LLEDIKVLLQILSHCGCDVKIEGNKLQITPDIKNGDIDVDGVNKLRASILLLGSLIAQG
FT                   KKVVIGMPGGCNIGTRPIDLHVKGLSQLGAEIKLNQGYIEAKVKKLKGAKVYLDFPSVG
FT                   ATENIMIAAVLAEGETIIENAATEPEVVCLANFLNSMGAKVMGAGTDTIIILGVKKLSG
FT                   CSFIPIPDRIEAGTYMAMAAMCGGELELTNVICEHIRPVIAKFKESGVKIYEGENTVRV
FT                   EAPDRILATDIKTLPYPGFPTDMQAPMMSMLSIAKGTSVVIETIFENRFLHVGELVKMG
FT                   ANIKVEGRVAVIEGVKKLKGAKVEAKDLRGGAALVLAALAAEGVTEIDGACHIDRGYFE
FT                   FEKNITSLGGKIKRV"
FT   gene            261098..261511
FT                   /locus_tag="COB47_0206"
FT   CDS_pept        261098..261511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0206"
FT                   /product="protein of unknown function DUF1284"
FT                   /note="PFAM: protein of unknown function DUF1284; KEGG:
FT                   ate:Athe_0208 protein of unknown function DUF1284"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41563"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ8"
FT                   /inference="protein motif:PFAM:PF06935"
FT                   /protein_id="ADL41563.1"
FT                   /translation="MPIILRAHHLLCFLGFRGAGYSKEFVENFERVYKSVYLENLPIKI
FT                   VSFPDEICRCCPNLAATECKFEQKVKKYDAKVVELLKFYGLSDLENVLPSEAYSALKKV
FT                   LPHQLESICRTCEWFALGFCKESFYRKDLWKNG"
FT   gene            261504..262448
FT                   /locus_tag="COB47_0207"
FT   CDS_pept        261504..262448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0207"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="KEGG: ate:Athe_0209 biotin/acetyl-CoA-carboxylase
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41564"
FT                   /db_xref="GOA:D9THJ9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9THJ9"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADL41564.1"
FT                   /translation="MDEKDICILKKLYENEYISGEELASLLHVSRMAINKRIKSLRALG
FT                   YRIESAKKKGYMLVDKDVIRIWEIEGYIQSSNLFKEFIYLNEVDSTNAYVKQNQQYLPN
FT                   ATVVYAERQTQGRGRFSRRWVDLDKGIKMSILLKLLLLDLEKIVPFTLFTGLVINRVLR
FT                   KHGVESFIKWSNDIYLNGKKVCGILSELSGEVEGFGSIIIGIGINVNAKSVPEEIKDIA
FT                   TTLKAETLHDFDRTRLIIDILKEFERELSNFEKYGFSYFRDEYKSFCINLGKEILVNGE
FT                   RMLCKDIGKNGELVCEKDGKIVEISSGEVTIRF"
FT   gene            262465..263589
FT                   /locus_tag="COB47_0208"
FT   CDS_pept        262465..263589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0208"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   ate:Athe_0210 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41565"
FT                   /db_xref="GOA:D9THK0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK0"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADL41565.1"
FT                   /translation="MRLISKDANLKRILYQKGFDEKDILEFEKKANSIILRFDDVKNPS
FT                   RFVQLLSNLGYFTITNGNICFATTSLYNFEKTRCILAEAGIDCNFDGDFTISQRCLLAK
FT                   DKQISLLKTNVMGIINVTPDSFYEGSRVQVDKVTQRALQMIQDGADVIDIGGESTRPFS
FT                   DPVCEEEELKRVIPAIEAIRKVDKNIPISIDTYKSRVAQKAIEAGADIINDISGGTFDK
FT                   DMFYVAAQYNVPIIIMHIKGTPKDMQKNPYYEDVIEEILQFFEERIEQALKAGVKLENI
FT                   ILDPGIGFGKRPEDNLEILRRCEEFKVLGRPILIGASRKSVIGYVLGNLGPEERLEGTV
FT                   AVSVICAQKKIEFVRVHDVKENKRAILMTQAIFC"
FT   gene            263623..263835
FT                   /locus_tag="COB47_0209"
FT   CDS_pept        263623..263835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41566"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0211"
FT                   /protein_id="ADL41566.1"
FT                   /translation="MTKKAIIDRFEGDFAIIELQNRKMVSVPREILPECAKEGDVILIS
FT                   VDDKETQKRNESIRNLFESLKEEGE"
FT   gene            263842..264303
FT                   /locus_tag="COB47_0210"
FT   CDS_pept        263842..264303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0210"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: ate:Athe_0212
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41567"
FT                   /db_xref="GOA:D9THK2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK2"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADL41567.1"
FT                   /translation="MAENVVFLGLGSNLGDRGENIKKAIEHLKDKIRIEKVSSIIETEP
FT                   YGFVDQPKFLNCVLKGTTVLSPLELLEFVLDIENKMGRKRLFKWGPRNIDIDILFYDDC
FT                   VIDTENLKIPHPELHKRLFVLEPLCEIEKDFVHPVLKKSVYELYTQLIS"
FT   gene            264322..265116
FT                   /locus_tag="COB47_0211"
FT   CDS_pept        264322..265116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0211"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ate:Athe_0213 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41568"
FT                   /db_xref="GOA:D9THK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL41568.1"
FT                   /translation="MGNSPFLSITEFEGKNVVVTGAAQGIGLVTALSFLENGAKVFAID
FT                   KDREAIEDASQDFFDKFKDRITFFECDLADAKEIELVCQKIGDVAGKIDVLVNNAGIGS
FT                   TKWIEERSVDEWDEVINVNLRAPYLMVKFLLPYLKEGASIVNIASTRALMSEPNTEPYS
FT                   ASKGGILALTHSLAISLSSRKIRVNAISPGWIETSRYKKRKYRREPELREVDHLQHPAG
FT                   RVGVPEDIANAILFLSSEKSSFITGTNLIVDGGMTVKMIYEE"
FT   gene            265133..265387
FT                   /pseudo
FT                   /locus_tag="COB47_0212"
FT   gene            265413..266744
FT                   /locus_tag="COB47_0213"
FT   CDS_pept        265413..266744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41569"
FT                   /db_xref="GOA:D9THK4"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0215"
FT                   /protein_id="ADL41569.1"
FT                   /translation="MWGGFYKVEIDFSKLLWAQLLWFLLGLFFIVAVIVVAVAIKRKKA
FT                   EKMRRLENLQKVEEYFETISNRILNLEDKAKFFKLLDDGQKLESKFEEVTINFKNLKEY
FT                   YEGIKKSYSDSEFKTFLTIYNILKSDLDFLEKVLKDSEKALQEQIEYIKKVEIAVDGVK
FT                   NKEVLKQKINDLLTRRLSDDDLKSAVEGIKRIDEKIEYFKSLGDDKKNEYINTMIQLLT
FT                   KRFEEKYPLILSKSSSKALELQKEFDDLLLKLQVSSDFKKIVLAEDFLGKLMQIENEIS
FT                   QDFQKKMRPQKELVDRFEKIVSIYDNVGFRFYKIDLEIERVKSLLESCDSNEELEKEIS
FT                   ELENTIFTFSREFSECRGLLENFKRFLEEAKNRLKISLSSNLFDSYYKNLKELLYECNF
FT                   NEFKKRYIEYQNAVSDALFKSSSLSSSSDTIKKVIKDLFDEFFG"
FT   gene            266782..267450
FT                   /locus_tag="COB47_0214"
FT   CDS_pept        266782..267450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0214"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: ate:Athe_0216
FT                   phage shock protein A, PspA"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41570"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK5"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADL41570.1"
FT                   /translation="MGIFQKIAQLLKANINDLIEKAADPEKMLNQLIEDMEDQLQKARA
FT                   EVANALADEKILQKKVEENKKAAEEWQKKAELAVSKGEDELAVEALRRKREYERLANEY
FT                   QKQYEAQHEAVEKLKSGLKMLEDKIEEAKRRRDLLIAKSKRADAQVTITQTMSKLTDTS
FT                   AFESFEKYAQKIEQKEARAQAHEELLNASKTLEDRFKELENGDEDILNELKVLKEKMGK
FT                   "
FT   gene            267667..269973
FT                   /locus_tag="COB47_0215"
FT   CDS_pept        267667..269973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0215"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: Stage II sporulation protein E; KEGG:
FT                   ate:Athe_0217 protein serine/threonine phosphatase; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41571"
FT                   /db_xref="GOA:D9THK6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK6"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADL41571.1"
FT                   /translation="MERLEVLQFKRDQVKTSRNSISDRFLVFGTEQFFVLILAFLLGRC
FT                   SLFSRSFFSCAYVASFKKRDYMYYLASIFSIFGIISCSDKSSILKYVLSILLITTINHF
FT                   FDLNLYSKALFCALSVGSSGSISIFLFSKAPIEFLYLVLEMIGCFWAVIMFERFFAAIY
FT                   SKKAYTADQTVVMVVVLALSFLGLSSGLDSLLSIQNILFFILLFSVSLFHGMIMSTAMG
FT                   FVIGLLESIKECRSIEMACVFAFSSLLAGLMKGFGKFGIALGGFCGYIISMFYISSNPT
FT                   LRFREILISAVLFCLFPLEKIVKLQSTDEREVQRMIKEKIFGVASVLENIEQNACGKPA
FT                   VLICKEEAKNIVQSTCQKLCLDCSNSNVCWNIDYYRINHSLNEIKNMILKKGRVEEEDL
FT                   KEFKFLCVRWKEFIIVINGFLESLKYSKLVQKASSPKENVFKTHIEILKDIVMDAAKMA
FT                   ENEMKKDRGTSKEIELELVRFGYEVEKVDYVVYDHYFQIDIDLKDGFKAPRKMEIEEIV
FT                   KGVVGCDIEIISEVPKISGGYTISIIKKPNVQIDYSIYSKSKENINGDRVCFLQLKNGK
FT                   FLACISDGMGTGKTASENSFIVIDALKKFSSLGFDRKVAIKFINSLLSIRNGEQFASVD
FT                   VVCIDRFTIASEFLKAGAMPTFIKRGDEVLTVESHSLPVGIEAETQFDFSTCKLQKGDM
FT                   IFMFSDGLFELLGEDGDRILKEFIAKNQFVSTQSASKQIFEWATSNSFLIKDDVTIIVL
FT                   KIGGALEKRSEEKKF"
FT   gene            269942..270979
FT                   /locus_tag="COB47_0216"
FT   CDS_pept        269942..270979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0216"
FT                   /product="stage II sporulation protein D"
FT                   /note="KEGG: ate:Athe_0218 stage II sporulation protein D;
FT                   TIGRFAM: stage II sporulation protein D; SpoIID/LytB domain
FT                   protein; PFAM: Stage II sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41572"
FT                   /db_xref="GOA:D9THK7"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK7"
FT                   /inference="protein motif:TFAM:TIGR02870"
FT                   /protein_id="ADL41572.1"
FT                   /translation="MKKEVKKRNFETFWLDTTLMLLATLVFLIANVVARPSKDDFKNVP
FT                   SAFTLPQNKNQKDDIYINLLRKNKNRIERISLEEYVIGVVAAEMPAEFNLEALKAQAVA
FT                   SRTYAARKIVGKALHKGYEEKKVYLCDDFSHCQAYIDRDEMKRRWGKNFERYYKKIRMA
FT                   VEETKGQVLVYEGQIIDSLFHAASGGKTEDAKEVFGEAIPYLKSVVSRGEESCPKFSGE
FT                   FYFTYDEFVKRLKSYFPGLRIDSSNISSQIKVVERTKAGRVKSVKVGNTVLSGNQFRSI
FT                   FGLYSTEFWIYPDKRGVRIHTRGYGHGLGMSQWGANYLARQGKNYKQILLYYYQNVKIC
FT                   RLKYR"
FT   sig_peptide     269942..270046
FT                   /locus_tag="COB47_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.895) with cleavage site probability 0.882 at
FT                   residue 35"
FT   gene            271022..271423
FT                   /locus_tag="COB47_0217"
FT   CDS_pept        271022..271423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41573"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0219"
FT                   /protein_id="ADL41573.1"
FT                   /translation="MNCYLVENNIEKLKKYIEKVGPDMYAKEYLLRKMVYLHIYIEDLT
FT                   PTQANIIKQTMLSIGSDAVVNKGSIDHSVQKSDCLVFGNVLQLKMLCEKLKKQPFKLKE
FT                   LAEKIQKIVEGFERDYLCSGRPEQEKDDT"
FT   gene            271374..271970
FT                   /locus_tag="COB47_0218"
FT   CDS_pept        271374..271970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41574"
FT                   /db_xref="UniProtKB/TrEMBL:D9THK9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0220"
FT                   /protein_id="ADL41574.1"
FT                   /translation="MIIYVPVDLNKKKMILENGMNIEKDYNKKIGLWGVYVKCISGFLT
FT                   PKHIAADCIAVNVDTQRAYIANHDLWIAYKLSKNEVFNKMYIASIVNIKKYRFGEYRVP
FT                   EVLIVSHVKKEDIVDVKETTSLCDKILYQNDQIYIDCLVEKISQNTNVAKHLIVDYFTK
FT                   LSLKDGDITTEVVEKGNSKLYVFIHKNEYAWTVEI"
FT   gene            272109..273044
FT                   /locus_tag="COB47_0219"
FT   CDS_pept        272109..273044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41575"
FT                   /db_xref="UniProtKB/TrEMBL:D9THL0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0221"
FT                   /protein_id="ADL41575.1"
FT                   /translation="MKFKLITILLAILFMLVSCTPQKPKTREYSQSGRWVVLDYKGKAF
FT                   VLDCDSSSIIIRGKVTSDITVRYVKKVIWTYNETSSNTGEPNEKEVQKIFDDMDASIEN
FT                   EFDRVYVKARAYGSTEAVLANKVSNPKREFEFEVFLPQDCKVVVQNNSGNVSVSDIKGG
FT                   SVYIVNGVGNIAVTNTDAPLDIKNGEGDIKLDYVSGDFQVTNGKGNINLKIENTGSFKV
FT                   LQTKGNVVLKINRTSGYGNSSFINVGEGDITFDVGKDVRAQVKVLTQGKIKSDFDFTKT
FT                   GNSYYIDLDSGRNTIDITNLKGFVRIYKNY"
FT   gene            complement(273100..274722)
FT                   /locus_tag="COB47_0220"
FT   CDS_pept        complement(273100..274722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0220"
FT                   /product="NAD+ synthetase"
FT                   /note="KEGG: ate:Athe_0223 NAD+ synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41576"
FT                   /db_xref="GOA:D9THL1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D9THL1"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADL41576.1"
FT                   /translation="MKILLCQINPIVGDIEGNTKKIIEIIKSHADAKILIFPELSICGY
FT                   PPKDLLFQKDFIDAVEKAIEKIAKVVEDSFVIVGSPTKSHHVSKLFNSAIILHQGKIEK
FT                   VIHKTLLPSYDVFDENRYFIPSLAREVVTIEGINFGISICEDIWNINNDENALYDINVL
FT                   DELYQKGAKVFINLSASPYHYTKLETQRLKVLKEAATKYGIPVIYVNQVGGNDELIFDG
FT                   NSVVLSSSGKVVAKTKEFEEDILEIELEKIDKMPEVEIHEDISWIKKALVLGIRDYFEK
FT                   TGITKKAVVGLSGGIDSSVVCCLATEALGKENVLGVAMPSRYSSEHSLKDAKQLAENLG
FT                   IEFRVYSIEEPFKSYLKMFNGSEVALQDLAEENIQARIRGNILMFISNRENRLVLTTGN
FT                   KSELAVGYCTLYGDMAGGLAVISDLPKMLVYELARYINREREIIPHNVLVKPPSAELRP
FT                   NQKDQDTLPPYEVLDPILVAYIEEQKSIDEIVEMGYPKDLVLKVIKMVERAEYKRKQAA
FT                   PGLKVTSKAFGFGRRMPIVQRWV"
FT   gene            complement(274754..274900)
FT                   /pseudo
FT                   /locus_tag="COB47_0221"
FT   gene            275196..277637
FT                   /locus_tag="COB47_0222"
FT   CDS_pept        275196..277637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0222"
FT                   /product="Beta-mannosidase"
FT                   /EC_number="3.2.1.25"
FT                   /note="KEGG: csc:Csac_0129 glycoside hydrolase family
FT                   protein; PFAM: glycoside hydrolase family 2 sugar binding"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41577"
FT                   /db_xref="GOA:D9THU5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="UniProtKB/TrEMBL:D9THU5"
FT                   /inference="protein motif:PRIAM:3.2.1.25"
FT                   /protein_id="ADL41577.1"
FT                   /translation="MRINLDGKWKFREVGQNEYYEASVPGCVQLDLINLGKLPDPFYAT
FT                   NEVLFYQLEEKDFEYVKEFVVDNIDFQVKKLVFEGIDTVSEVYLNDHYLGKTDNMFLKY
FT                   EFDVSFALRKGKNILKVVLLSPIKEAERLKSIYQSSYSYPQRSWIRKAQYSYGWDWGPR
FT                   ILQIGIWKSVYLDLNNGLEITDEFIKTEHLSENLAVVKVFAKINSFEKPRSVEIEISDG
FT                   GYVKKVIPDVYKSKEGYFIEERVEIENPKLWFPNDYGEPNLYTFKIVAQTSNEEATKIV
FT                   TTGLRTVRIIKEKDRYGESFIFEINGIKVFAKGANWIPADSILPRLTEDDYKQLIRMAK
FT                   DANMNMLRVWGGGIYEYDWFYSECDKNGIMVWQDFMFACAIYPDEFDFFVENFKKEAEY
FT                   QIKRLRNHPCIVLWCGNNENNWGFVDWWHIGDPEFLGNRIYKKVLPEILAKLDPTRPYH
FT                   ISSPYGGEHPNSSTAGDKHTWDIWAGWKDYIYYKHDDARFVSEFGFQAAAHLDTMKRYI
FT                   PLKDQTIFSRTLRMHEKQEEGLERLIRYMAGSVGLPKDFDSFVYLSQFIQKEAIKLAVE
FT                   HYRKNKFKTAGALYWQLNDCWPVISWSSIDYLKRRKALYYESKRIFTKFLPVVEYENGK
FT                   LQVYVVSDELVPKQGQLNIAIWNFDGQKLYEKNLAIEIPENGVVEAFSEEVENLNILKG
FT                   RFTYIPKQFEATVVGKKVDESLLESIVFVSLFVDGVEYENYFVFEKPVNLELKPCQFEY
FT                   EIKDDYIIIKPKTPTICLIVEADKDIEENFIFARPDKEYKIRLNGAQVGRVYDLIEMVI
FT                   R"
FT   gene            277872..279707
FT                   /locus_tag="COB47_0223"
FT   CDS_pept        277872..279707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0223"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   ate:Athe_0228 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41578"
FT                   /db_xref="GOA:D9THU6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D9THU6"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ADL41578.1"
FT                   /translation="MKKAHVIEAIIGNTKVLGQLDSNGILQRFYWPAVDYYQQLKLFLA
FT                   AIFLDGLVFFENESFKIKSGFVDDFAYFFEYKIADKTIFQLDFVDFETDSLVRLWETDF
FT                   EDFYVFLEPMINSSSLFNAAKVDKENEIIYAYFKGIYIGLAFEDKVKSFTVKHGIDDAN
FT                   DNQLEGWLEATNPQIAVKLKNTGRIVCFLTFGNSKDEVYQKLSYLKQKGYDQIFRQNKT
FT                   FWEKKFSKVKLICTQDPKDMQLQKRSAYLFYVLQNSKTGGILAASEVDEKFFHCGGYGF
FT                   VWGRDAAFITNAMDAMGLSAEVEKFFGFKFSCQEKEGFWDQRYYTDGTLAPSWGIQIDE
FT                   TASVVWGFLNHCEKQNSLHLIEEYRGQLKKALLFLTAAVDSEKGVIFRSFDLWEEREGI
FT                   HLYSNASIYAALKRAKKYFPELESEIEKKLKAIKNQMATRFYSPKLSRYVRSTDVRISH
FT                   EEFLKLPEENRYAEKDEKYEITYYFKKQDEIVDISMLGVYYPFEMIDAEDKAFKATILA
FT                   IERECQNKIVGGYKRYSDDKYIGGNPWILTTLWLAIYYKKTGQVNEAEKLFEWAKEHSL
FT                   SNGLFPEQVDRLTGKPAWVVPLAWSHAMYVLYLYE"
FT   gene            279856..281073
FT                   /locus_tag="COB47_0224"
FT   CDS_pept        279856..281073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0224"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: csc:Csac_2480 IS605 family transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB; transposase IS891/IS1136/IS1341 family"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41579"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9THU7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADL41579.1"
FT                   /translation="MYKTQKNHIRCDKQTYKLLRMLCHFSKNLYNYALYHIRQHYFKTQ
FT                   EYLPYESIYHLVKENENYRLLPSQVAQQTLISVDEAFKSFLSLLKAKKEGRIDKKISIP
FT                   TYLPKEGMYQIVFPKDQFKVEGNKLRLSLGRNFYKEFGVRYLYFDLPQNIRGKKIKEVR
FT                   IVPRFHGKWFEIEYVYEEEEQNYNLDKSRYLSIDLGLDNFAAVVDTIGTAFLIEGRYIK
FT                   SVNRWYNKQKARLQSIYSKQNIKYGKKLARICLRRQHIIDNFLNQAVNYIIKHCLNNQI
FT                   GTVVIGEMKDIKQKINLGAVNNQNFVNIPYERFKRKLEAKCEYYGLEYVEVEESYTSQR
FT                   CNRCGTVKKSNRKQRGLYVCKDCGYVVNADINGALNILAKVAGESAKKQIVSSGCVNHP
FT                   VRIRVA"
FT   gene            complement(281130..281729)
FT                   /locus_tag="COB47_0225"
FT   CDS_pept        complement(281130..281729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41580"
FT                   /db_xref="UniProtKB/TrEMBL:D9THU8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0229"
FT                   /protein_id="ADL41580.1"
FT                   /translation="MNLYLPLDTFQEIKIITGNNVIECKRNSDFINISTFLKENEPFII
FT                   VCNEQLIFSTTTKKLKRLKEELKIEKVKIGLETFKTEDGFLKLLHETYVLFGNDKKFVV
FT                   YIELINPVDTCPIIIEIKKDSEKCYFSLANIPPGEENNNYLIKYAEHIILDFSQLEEAT
FT                   YDVEIKFIDGEMIGKTTFRYQPSKMRLEKYLPYNPV"
FT   gene            complement(281799..282356)
FT                   /locus_tag="COB47_0226"
FT   CDS_pept        complement(281799..282356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41581"
FT                   /db_xref="GOA:D9THU9"
FT                   /db_xref="UniProtKB/TrEMBL:D9THU9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0230"
FT                   /protein_id="ADL41581.1"
FT                   /translation="MNMANKTKYHFLNWALSGIIFSLLVLILFYLNRNSSISKGNIENR
FT                   IAQLFIVVGIVVDSILDLSAEQNPNGYSKKILIKPVVFFITFSCVFNIGLLLLRIISSL
FT                   KLLVMLIIFEFLFSFFTIRFFHLEKVKFCKYKNFGKIVVFFILAAIIFFVIFIPSLEGI
FT                   GLYIAICVAGIVFFEILNMVLK"
FT   gene            complement(282528..283076)
FT                   /locus_tag="COB47_0227"
FT   CDS_pept        complement(282528..283076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41582"
FT                   /db_xref="GOA:D9THV0"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV0"
FT                   /inference="similar to AA sequence:KEGG:Csac_0132"
FT                   /protein_id="ADL41582.1"
FT                   /translation="MENKKSYFSWIVAGCITSILLVYAVYYLKDSSYFKENPLNRIIQL
FT                   LIVVGIVVGAIIDAKCIENSNKVHLRILLNNFLLFLVFFFLPLNIGLLVLKIIPSIKDL
FT                   GAFILLEIFFTYSVLRSNYLYILKFKNYKNYAKIIILSALLLGIFLGIIFPEIEGMYRY
FT                   LLIFVFVTILFEVLNFTLR"
FT   gene            complement(283066..283428)
FT                   /locus_tag="COB47_0228"
FT   CDS_pept        complement(283066..283428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41583"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV1"
FT                   /inference="similar to AA sequence:KEGG:Csac_0133"
FT                   /protein_id="ADL41583.1"
FT                   /translation="MQVYVVRKSPIQELKEFGGRVLNGVKEGVKEIINDIERTAIASGL
FT                   ENGIKGGISGYKQIREFNAVMKNGYTLRGIGQAGMSGAVSGFAKGVIKSPGIAGWISIG
FT                   WSFGEGFVRGWREYGK"
FT   gene            283730..284923
FT                   /locus_tag="COB47_0229"
FT   CDS_pept        283730..284923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0229"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ate:Athe_0232 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41584"
FT                   /db_xref="GOA:D9THV2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADL41584.1"
FT                   /translation="MRILQLTWEYPPRIVGGISRVVRSISQKLSEKDTVYVVTISEDYE
FT                   RTEDYGNLKVFRVPVYPLNSLNFIDWVMMMNMALAEKAIYIAQKEGKFDIIHAHDWLCA
FT                   FAARIVKYALRIPLITTIHATEHGRNGGIYTDMQRFIHNVEWWLTFEAWKVIVNSEYMK
FT                   NECERIFSLTPDKCIVIPNGIDFEEFAQVPFDWDFRRKYALDSEKIIFFIGRHVYEKGI
FT                   HILIDAFRKVLDNFYDVKLVIAGNGPMTGELYSKAHFLGLSHKVLFTGFVTDDERKKLF
FT                   KIADIAVFPSLYEPFGIVALEAMASGCVPVVSDIGGFSEIVKHLHNGLTFYCANPNSLA
FT                   DMILLLLKDDLLRQKLSRQAQSDAREIYSWDKIVKRLKSVYEMIVTEAKKMEWFSAL"
FT   gene            284964..287096
FT                   /locus_tag="COB47_0230"
FT   CDS_pept        284964..287096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0230"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: ate:Athe_0233 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41585"
FT                   /db_xref="GOA:D9THV3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV3"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADL41585.1"
FT                   /translation="MKGVIMAGGSGTRLRPLTVSLPKPMIPFFGRPVMEYAVKLLKAHG
FT                   IFEIATTLQYHPDKIINYFEDGQKWGVRIQHFVEDRPLGTAGSVRNAKKFLDETFVVLS
FT                   GDGITNADLTRAIEFHKQKRSKVTIVLKEVEIPIEYGIVLTDEEGRIQRFFEKPSWSEV
FT                   FSNLANTGIYIIEPEILDYIEDGRPFDFSKDLFPKLLKENVPMFGFRMDGYWCDIGDVG
FT                   SYIKAHRDVFRLGGILDLDLKSPRISKESNISPNAKISQSVFIGSECEIEDDVEIGEFC
FT                   VIGDGVKIAKGSKLERAILWNGSFIGKNCELKGCVICSRSILKDYVRVSEKAVVGEKNL
FT                   LKDFVEVKAEAKIWPEKTIESGTVIDENIYWGTEVIKSVFWVRGITGDFNQEITPQFAI
FT                   KLGNSIGSVFDKNARILIGDDYTEKSSVIRKAIETGCQVTGTRLYRTRGIILPIFRYIV
FT                   KDYYDAGIYVRSRGNSIRIEIFDQNGMNIDKSLERKIENLFVTCDFRTSSNINFVNELI
FT                   SSPLEMYFARLEETFESSKFKGLKVCIVSEDKSIISLFDKISERYGLKTTLISGGSKQC
FT                   IENLKNMCVQNEYDAGFLIDRQGEHFIMMLGDCTVYGEKLKMLLAWLEMKKFKNDHMIL
FT                   PEFFKAFINDVDRLLDVPVKYTGNEIRDYMKAVLEQGINYFFYYDAVSSIVLILERLSE
FT                   VKDLIDKVKKLEEVHV"
FT   gene            287170..288165
FT                   /pseudo
FT                   /locus_tag="COB47_0231"
FT   gene            288363..288836
FT                   /locus_tag="COB47_0232"
FT   CDS_pept        288363..288836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0232"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: csc:Csac_0138 VanZ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41586"
FT                   /db_xref="GOA:D9THV4"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV4"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADL41586.1"
FT                   /translation="MNSNIKLYIRWVLVFLWMAVIFYFSSQEGVISHQKSFSVAALCER
FT                   IVEFFAGKDIITDANRKSFEFCVRKLAHVTEYFVLCMLFYRAFLAGGNGHKKSAAKSFI
FT                   FSFLYAVTDEIHQIFVAGRGPSPVDVGVDTIGMFLYLFQRMLKEKIKKGLSDV"
FT   gene            complement(288862..289353)
FT                   /locus_tag="COB47_0233"
FT   CDS_pept        complement(288862..289353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41587"
FT                   /db_xref="GOA:D9THV5"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV5"
FT                   /inference="similar to AA sequence:KEGG:Csac_0148"
FT                   /protein_id="ADL41587.1"
FT                   /translation="MILRKILLLTILIFVNLICLFYYAFAKPVDSITLLNNSFKYDGKI
FT                   VEFQGEAIGEVMKREKYAWVNIHDGQNAIGVFMKYEDAKKIRYLGRYLVKGDIVLVKGI
FT                   FNRSCKVHGGDTDIHALQVQIVKRGYKMQEQINKTKAAFAILIFSLGSFLMWVVFKNKW
FT                   "
FT   sig_peptide     complement(289273..289353)
FT                   /locus_tag="COB47_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.791 at
FT                   residue 27"
FT   gene            complement(289359..290870)
FT                   /locus_tag="COB47_0234"
FT   CDS_pept        complement(289359..290870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0234"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: ate:Athe_0240 cation
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41588"
FT                   /db_xref="GOA:D9THV6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV6"
FT                   /inference="protein motif:PFAM:PF02386"
FT                   /protein_id="ADL41588.1"
FT                   /translation="MYKTKFKEGHIELRHVLYMTGKTLSAIGMVEIVAAITSLLYREWN
FT                   MLFNLMIGIGLFFIVSFIFIFIGRDTKEERFSWGAGMSMVALTWALSALISAVPPYLSG
FT                   HFASYLDACFEVMSGYTTTGLVLIQDLDHAPMGLNMWRHLICYIGGQGMVLMTLSFLAS
FT                   GMRGLLKVYMGEARDEQIFPNVMHTARIIWSVSLLYLVLGTLALTINGVLIGLPLDMAF
FT                   FRGLWMFLGGWDTAGFAPQSQNAMYFHSLSYEIISMTIMILGTINFALHYFILTGNYRE
FT                   GIKNAEIKSLFTTITILSLLGAFALRGVYSSSEISFRKTFYHFISAHTGTGFATLYSQQ
FT                   FFYEWSDAAIILLVIAMLAGGSVCSTAGGIKALRIAILANALVNDIKKMIKPDSAVVVE
FT                   KFHHLKEVTLQDRHVRNVSIITLLYIATFAFGTLVGTFFGYPLKAAMFESASALGNVGL
FT                   SIGITQPSMPDALKIIYIFMMWVGRLEFMSVIALFAFLFKEAKEG"
FT   gene            complement(290901..291032)
FT                   /locus_tag="COB47_0235"
FT   CDS_pept        complement(290901..291032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41589"
FT                   /db_xref="GOA:D9THV7"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0241"
FT                   /protein_id="ADL41589.1"
FT                   /translation="MLKKKEKSFRTIFIGVVVEVGLALSFIVAGAIVTLLPYILSGK"
FT   gene            complement(291052..291717)
FT                   /locus_tag="COB47_0236"
FT   CDS_pept        complement(291052..291717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0236"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: ate:Athe_0242 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41590"
FT                   /db_xref="GOA:D9THV8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV8"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADL41590.1"
FT                   /translation="MRVVIVGGGKVGYFLTKLLAERGRYHITVIEQQPELCRKVAEEFS
FT                   NVTVIEGDGTSLDILSDAKVHRCDFFIAVTGKDEDNLISCQLAKKVFEVKRTIARANNP
FT                   KNINVMKRLGVDNVISSTDIIAKIIEHEVEIEPLSVLATLKNGEIIVFQAVVQQNSPAA
FT                   NKKIAEVPFPKESIIGAIMRENETFVPSGDSIILPGDTLLVIVSEKDKREFKRLITSK"
FT   gene            complement(291714..292334)
FT                   /locus_tag="COB47_0237"
FT   CDS_pept        complement(291714..292334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0237"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: ate:Athe_0243
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41591"
FT                   /db_xref="GOA:D9THV9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D9THV9"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADL41591.1"
FT                   /translation="MYIIVVGCGKVGSTLAKSLSDEGHDVVVIDSDAKNFERLGPDFNG
FT                   MKIQGVVIDEDVLKQAGIEKADALAAVTPDDSTNIMAAQIAEEIYNVPKVIARIYDPLR
FT                   EDIFHSLGLETICPTTLAVEYIKSILLSREIRHKHRFGKDDVFFKYVTPKRDDIGKGLD
FT                   KIILPENCYLFGIIRNEHFYFKNKNIRLQENDILVIAEKKVNQ"
FT   gene            292475..294217
FT                   /locus_tag="COB47_0238"
FT   CDS_pept        292475..294217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0238"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="KEGG: ate:Athe_0244 SpoIID/LytB domain protein;
FT                   TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41592"
FT                   /db_xref="GOA:D9THW0"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW0"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ADL41592.1"
FT                   /translation="MVKKLLCGAIAIVLFVVFSSINILPAFSQTQIPEWIRIGVFYADT
FT                   YKKSSPVDSVKIEAKGSLFLAISDDKNFITIADTQKNSLTVSKDVYKKNGQEGSNYHVA
FT                   VGRYISYKTAENSLKSFSSFKDAFVGFVNGGYSILIGCFDNINDAKELVSKLSGATIYS
FT                   SETMVLVKDDSGKILFGFDGQNTKFLMLIPQKQNGIERIKIGDRWFRGRTEFKRIKGSD
FT                   MTVINVTKLEEYLYGVIRMEIDPLWPMEAVKAFAVIARTYAVRNLGKHQSIGFDLCPTD
FT                   HCQVYGGAVDGTYGEKQAIAAVDSTRGEIITYKGNPIDAVYFSSTGGIPTEDSENVWRY
FT                   PVEYLRSVDNSKEAKNSKSSWLFQFTKDEIKNMLKKRNIDIGDILDVQAVEYTKAGRVL
FT                   RLKIIGTKGEYECQKEATRLLFGLYSQAYTIATDADVAVVDSNGKVKKVRISGQKILFE
FT                   DGSVKKAVVAGQKQNFEETEKLLPQTAESVYLSIYDEVYQSEDVGGFETEGQTYSQHYI
FT                   DVVNPEGSIDKVPLVPTTYTFNGKGWGHGVGMSQWGAKGLAESGYNYKQIIKHYYTGVE
FT                   IEKG"
FT   sig_peptide     292475..292561
FT                   /locus_tag="COB47_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.835) with cleavage site probability 0.800 at
FT                   residue 29"
FT   gene            294214..295254
FT                   /locus_tag="COB47_0239"
FT   CDS_pept        294214..295254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0239"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="KEGG: ate:Athe_0245
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41593"
FT                   /db_xref="GOA:D9THW1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW1"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ADL41593.1"
FT                   /translation="MRKWKLSDFHYDLPDELIAQKPVEPRDNSRLMVILPDGTIEHRIF
FT                   RDIVEYLNEGDCLVLNNSKVIPARLIGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKA
FT                   RRGRKFVFGNGELKAEVLHVNQDEGTRIVRFYYEGVFEEVLEKLGKIPLPPYIKEELED
FT                   LSRYQTVYSKVPGSAAAPTAGLHFTEELLEKISKKGVEILYVTLHVGLGTFKPVKVENV
FT                   EEHKMHEEYYEISQDVADRINRAKELGKRVIAVGTTSCRVLESCSDEAGRVKAQKGWTN
FT                   IFIYPGYNFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDA
FT                   MLILRR"
FT   gene            295349..295966
FT                   /locus_tag="COB47_0240"
FT   CDS_pept        295349..295966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41594"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0246"
FT                   /protein_id="ADL41594.1"
FT                   /translation="MDEIKQMLTLVLEKVDSIDKGLEEVKQRLDRVEERLDRVEERLNR
FT                   VEERLDMVEQRLDAVERRLDAVEQRLDAVEQRLDAVEQRLDTVEQRLGNLEKRVDRLEV
FT                   ETTKNSVMLEDLKRKLELMAEIQQSHFEQDRREHEELRKYVDGRFVVLEFAVRQISSNL
FT                   EEMKKDLKELKENRVKVEVFYEILGRHEVEISNLKKAVFSTN"
FT   gene            296068..297528
FT                   /locus_tag="COB47_0241"
FT   CDS_pept        296068..297528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0241"
FT                   /product="Conserved hypothetical protein CHP02677"
FT                   /note="PFAM: Conserved hypothetical protein CHP02677; KEGG:
FT                   ate:Athe_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41595"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW3"
FT                   /inference="protein motif:PFAM:PF09660"
FT                   /protein_id="ADL41595.1"
FT                   /translation="MINFQAPLLGKLKYFEYLTAPNSERYRTIMRYCFLCHLEYKNRLT
FT                   KEEIFTFLKSFPQFADYTEQMCEQDLKNLVEWGNLNSIQDTSKTRTVEEFRNKRFLYEL
FT                   TPIGLRIERFLFELETQEDTKAELNPKHVEKIYFLLQHVDSILQDPQKRAVDWWDELTR
FT                   SFEEIEKSYSEYISMLKSYEAENLMLKEKFLDYKSKLVQYLYNFYVIFQNYLPRIRSTF
FT                   LSLEESKIEKLLNYIIAQEKEHPKNIFRDPESIERNIKARFDNIKLWFVASHGQAEKLS
FT                   DQIQGLIRRVSDLAARLSELSSVKVNRQEEFKHLAKIFSSLDLATCHKLSAVVFGVLLP
FT                   RYIAAEEKRQSELASLSILDVPPMKSLLRSRGRLVREKSRVLPASEFSEDKKKRFEEYK
FT                   KKIEEEEKLVAELIKDGRIEFESLPVLTPHVRKKLLVWLSRGLSSGFGNTDSGKRFKVV
FT                   RPKDDRRCVLRSTDGELEMPAYVIEFVE"
FT   gene            297551..298774
FT                   /locus_tag="COB47_0242"
FT   CDS_pept        297551..298774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0242"
FT                   /product="Conserved hypothetical protein CHP02678"
FT                   /note="PFAM: Conserved hypothetical protein CHP02678; KEGG:
FT                   ate:Athe_0248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41596"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW4"
FT                   /inference="protein motif:PFAM:PF09661"
FT                   /protein_id="ADL41596.1"
FT                   /translation="MKSTLLKLLSNFWILKENDVESYYECKNIDKELKDFIVSKLGLKF
FT                   YATSDMVRLEKVPLVPREYMGILDFEEPKDYVFFCLVLAFLEDKGKDTQFLLEDITQYI
FT                   RSNFPGEEIDWTMYSDRRSLIRVLKFCEKMGLIKIDDGNQELFVERADVDVLYESTGLS
FT                   KYFMRIFPKSLVEYSSVEEILNSEFEFTNGLSDQITDIKRIKAYRGLLIDGIVDFESEA
FT                   PLYYIKKQKTTILQDLEKFVPELELHLFKSFAYLSVEGNYKYTYPDDSNLCDVLLLCSR
FT                   ELLERVEKGELRFLSAHEMLEISLDHFKLIVEDVKKKYGHFWNKEWREKSTEKIFEELL
FT                   EFLQLHNFAKTNDDGYLVISPIFFRIVGEYQDYETNSQLSEKDNSNEKVFEDINVDGGF
FT                   HFEDEQGK"
FT   gene            298758..302810
FT                   /locus_tag="COB47_0243"
FT   CDS_pept        298758..302810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0243"
FT                   /product="chromosome segregation ATPase-like protein"
FT                   /note="KEGG: ate:Athe_0249 chromosome segregation
FT                   ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41597"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0249"
FT                   /protein_id="ADL41597.1"
FT                   /translation="MSKENRWVLSRAGVFNYWYYDEEYFDFYDGRMLIRGPNASGKSVT
FT                   MQSFITLLLDGNYHPSRLDSFGSNARKLEDYVLGEQGPGQKNEAIAYLFLEFKRQNVFV
FT                   SVGMGIRAKRGTSTDTWYFVLTDGRRFGIDIFFYEKIGDQKIPLTKKKFENLIGDGGKV
FT                   FSSRKDYMEEVNKILFGFENIEDFENLIDLIVRIRTPKLSRDIKPDTVCRMLQESLPAL
FT                   SESDLRSLSDSIENMDKIQTELKNLEIIKDVLEKLKKVYDEYNQLLLAQSIFRVVESSK
FT                   EYYSLKKELENTQTELEKNSKLKAQIEEKIEDLKKEQESLSFRLENIKESDVFKLQTEL
FT                   STIEEELKNIESQKTKKISQLNAASQKLEKERQELKALEEDLEKCRKRIKDYIDEGKLL
FT                   VEFIGFQRFLETLDMYLLQNGSLDILKEELSSFLSQVEIVLKNYEKLSEIKKDLDDLYR
FT                   NLDRNRTEAQKVEEEIQNLLFQLEDVKNSLKNAISIYFEQNEVFKAQDEQKTVIFQAIN
FT                   SCEKKGDYGRIYSILDDIYNFHYLAISDTIRRLEFEIETLNSQIKAKKEEIEKIKSQKD
FT                   DEIILSPQQKKVRDRLLQKGVPFIPFYMAVDFKDGVDERKKAIIEDALSSLGILNALIV
FT                   PEKYKDVLSDLMDDEKEMILISKPAYFSHLLNQFLEVANFDGPIELKQEVAAVIDSIFA
FT                   TEKDDGIYICEDGRFGSGILKGRTTTCENARFIGIENRRRYRQMLISQLEDEIQKISLE
FT                   LEGKKQEKNVQKTLLEKLKEERNSFPSMVDLDTAFEMIEERENHKSKLQKEIEFLEKKI
FT                   RELLGRENSLKHEISVIATKLSVTATRDNFLKLRQEAQKLERLLFVLEKETEMEKVVSN
FT                   SATTKKKLILQIEESLQSLSLDLQNLKARWENLDVRRTEIVRRLSSDDAQKLFEEEKRA
FT                   IQRLNSIPKEIEDFNKSLQETIAKISQLETLIEIKGLHLEKAKEEYSNSLEILKIELGF
FT                   GFVFREENLEDEKRLLEFAKEKSSFASEFKSKDLNQVLQRLISAHYAAQVQLAEFGANL
FT                   YLKEDDKTGYARYLWTAKKDGRLLSFYEFLEKIESEIIEKKNLITQQERELFEEVLIKD
FT                   IGRRISSKIMLAQDWVKRMNALMDGMDLSGALKFRLSWEQKKQELEDELSTAELIGLMS
FT                   KDLSIATDEDKQKVVRHFRARIERAKRLQDSPDSFRSLYEIMKEILDYRQWFEFRLYYQ
FT                   RGMENKRELTNNAYDKFSGGEKALSIYVPLLAALCAKYQSAASFAPRIIALDEAFAGVD
FT                   ENNIEKMFELIENLEFDYIMNSQILWGDYKTVPGLCIYELISDRSKGCVLKVKYIWNGY
FT                   KKVLVEI"
FT   gene            302807..304069
FT                   /locus_tag="COB47_0244"
FT   CDS_pept        302807..304069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41598"
FT                   /db_xref="GOA:D9THW5"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0250"
FT                   /protein_id="ADL41598.1"
FT                   /translation="MSDKKLLQECIEYFSHKGFSRVLELIYDKYRSLGRFSGRVVLEKP
FT                   DPVEKEMLSRYLGRIISGDKVVINVKEFAQKRFEQTKFSSLDFKDVLSHVLKKDVLTKK
FT                   EEKESRQKQLSSFLEKLEKQLANGTDSECVFQAVKENFKWFEGYFKKYSEEKLLSILSH
FT                   SIKAAATKPEKIESLAVFATRIAHDPHFFDEDRDSGKIFLKILSLLKNVEYPKSSEEKA
FT                   ELLYMHNIVIDELSNWCLVYGIGAITENEKEDEALKIFALQKKPVILPLYTIKDYKQFF
FT                   GYSNKIVVVENPAVFSMLMQACSDISLICTNGQLRLSTKILLESLCKGGFTIFYSGDFD
FT                   PEGLLIADRIVQNYGAIPLCLDEESYLLSLSNNRISQKRLVMLRNVKSPELFDVCSKMK
FT                   ELKLSGYQERIVDRIVEKLKS"
FT   gene            complement(304179..305531)
FT                   /locus_tag="COB47_0245"
FT   CDS_pept        complement(304179..305531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0245"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: integral membrane sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41599"
FT                   /db_xref="GOA:D9THW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL41599.1"
FT                   /translation="MRRISFKLLIYTLILLFCMLALSFFLQGNIVTSGFKANLKNRIIQ
FT                   YAKDISDKYRNNLDYSSEADNIANIINGSVSIYDANGNLIESHGRFMFGRTRNIERQVI
FT                   LDVLSGKTIYRTDQKTFQGSTLITLGIPVINNNKIVGAIFIHTPLHDIQNDLQNVKNQI
FT                   FMLFIIAILVSIIGAYVLSSLFTKPILKIIDAAKAITSGDYNIKIDIKNKDEIGELAKT
FT                   ITFMAQNLSKTEKLRRDFIANTTHELRTPLSIIKSYAEAIYDDILNKDQIKEYAYSIMV
FT                   EADHLNNLINEILELSKLQSGTIQLNIQPINLKSLFNEIISEVNIIKGNRKFWLFEDDI
FT                   VTKADSKLLKRAFSNIIINAVNHTNDTGNVYIKAEKENDFIKVSIKDDGEGIDEADLPY
FT                   IFNRFYSKSAKKGIGGLGLAIAKEIIQMHNGEISVFSKKGEGAEFVVKLKY"
FT   sig_peptide     complement(305445..305531)
FT                   /locus_tag="COB47_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            complement(305528..306181)
FT                   /locus_tag="COB47_0246"
FT   CDS_pept        complement(305528..306181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0246"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: amt:Amet_3209 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41600"
FT                   /db_xref="GOA:D9THW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41600.1"
FT                   /translation="MKILLIEDEEKLRKIMKLYLEKEGFEVEEASDGNEAIEKFQPSMY
FT                   SVVILDVMLPQKDGWSVLREIRKKDDTPVIMLTARGEDDDKIFGFELGADDYVVKPVSP
FT                   KEIVARVKAILKRTKKPSSNDILFIDKAAREVYVKGQKLNLTQKEYELLLYLYERQNIA
FT                   LSREQILNSVWGYEYYGDLRTVDTHIKNLREKLGELRDCIKTVRGYGYKFEVKK"
FT   gene            306200..306388
FT                   /pseudo
FT                   /locus_tag="COB47_0247"
FT   gene            complement(306761..308047)
FT                   /locus_tag="COB47_0248"
FT   CDS_pept        complement(306761..308047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0248"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: csc:Csac_2393 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41601"
FT                   /db_xref="GOA:D9THW9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9THW9"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADL41601.1"
FT                   /translation="MKYTQNEKILQVTEKTLVVGVDIAKERHVGRAFDFRGVELGKRIE
FT                   FENRKEGMEKFLDWANKIMKANGKDNMIVGIEPTGHYWLCFEQYLRENGIKVVLVNPFH
FT                   VKRSKELDDNTQTKSDIKDPKTIAMLVKDGRYTEPNIPEGIYAEMRVAMNIYERLQKQL
FT                   NVLKNQIINWLDIYFPEFLEVFSDWEGKVALLTLKEMPLPSDVIEKEVEGIIEYWRDKV
FT                   DKRAISRRRAMDLVETAKRSIGKKEGRKLARQEIKYLLEEYELLKKQVEEIEGEMAELL
FT                   KDVPNGDRLLEIKGVGVKTAVGFISEVGDIRRYEDARQIQKLAGLNIIENSSGKYKGQT
FT                   CISKRGRGRLRSSLFRAMITIVAKNEEFKQLHMYYTTRQNNPLKKKQSLIALCCKLIRI
FT                   FYAILKKGIRYDGNKMLSDIKRETLARTA"
FT   gene            308381..308932
FT                   /locus_tag="COB47_0249"
FT   CDS_pept        308381..308932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tex:Teth514_2214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41602"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX0"
FT                   /inference="similar to AA sequence:KEGG:Teth514_2214"
FT                   /protein_id="ADL41602.1"
FT                   /translation="MKRRIGFVVAVALLVLALNLAAFAATSVSNTNPASATNTTVLHMA
FT                   RGYGAQFMASIVAKLTGLTVDEVVYLRSQGQTFYQIALSKGVTAEKFKDAIYQEKVALV
FT                   DQKVKDGVITKEQADAIKAQMKARIDSCNGQGYANRPQTGYGLFGGGNGQKQGIWQGRG
FT                   IGYGRGMRGFVNGNSSNQSK"
FT   sig_peptide     308381..308455
FT                   /locus_tag="COB47_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            309161..310012
FT                   /locus_tag="COB47_0250"
FT   CDS_pept        309161..310012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41603"
FT                   /db_xref="GOA:D9THX1"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0290"
FT                   /protein_id="ADL41603.1"
FT                   /translation="MPTPTIDIEPKIKRILALIVCISFILTFLPINSVSFAKPRYDVWK
FT                   DKIKVYDADEKFKRAEAEYEGYKYIATFDEDTNEIKLKVKPIATKKFDKSLDSSSLNEE
FT                   RNFSVKVEYFDGENLKAKLIDEKTKEEYNIGDSDTVSAQYVIALPTVLGLLEELLYILL
FT                   GAAGIVFVGGATYYLAEKLADKIRNSSYDYFLAYISNDKKLYVGPAVDFSTAKAIVLDR
FT                   GDIFARRQDLAYKLAKAVSEYAHAGIRHDDKPHDSDDPNYFPHYHIIFNPYSRQPHIFY
FT                   PY"
FT   sig_peptide     309161..309274
FT                   /locus_tag="COB47_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.609) with cleavage site probability 0.590 at
FT                   residue 38"
FT   gene            310208..311572
FT                   /locus_tag="COB47_0251"
FT   CDS_pept        310208..311572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41604"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0289"
FT                   /protein_id="ADL41604.1"
FT                   /translation="MALKVIYLQDICEDYYKFIKNLYSSNNSDNRKYLFGREKYGNIFL
FT                   VKIMENPYISESNFNNIIGISFLDIATLESKLYFFEDKIEKIIFVDDVNYILYCYRYIT
FT                   ENKELKIVISEVNLRELSERNILEVPLISMDTFNDFLNIELYVEMLNHQYIAIFCYNTS
FT                   GTSKNKIKIILADIIKNTYYTYIPKNCCGDYLLYTFSSMKQILLDNKNSYIFIKTGRIS
FT                   PDEKETLWDKNNIKHIVDSLETFILYPQDKFIQDMISQKLYFDTYLIDCSLRDSSFNFY
FT                   HYTEGNYYFYTKYHFDTNKTELIRIDLRDLLKKSLFEISDIVYSIFRDKEGNFVLFNYS
FT                   IEKYDFNLKKIVISNDFILSGEKQIVEIYISDDENLFLNYAIDLIFENFLNKYLITFSP
FT                   FIDFDNPKYYRIKIYSTTTKKPIYDFQTKYPIYIGCAYGLINNPSNREESLLILC"
FT   gene            complement(311674..311904)
FT                   /pseudo
FT                   /locus_tag="COB47_0252"
FT   gene            complement(312025..313386)
FT                   /locus_tag="COB47_0253"
FT   CDS_pept        complement(312025..313386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41605"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0263"
FT                   /protein_id="ADL41605.1"
FT                   /translation="MSEIVIYNLNELFNNFGNPTNFDVSSLLAKNINNVSVIYQSKSYV
FT                   LFTISDCYDTYNIQSIIIVALENNNIKATFTHITKNEISEIIYFDEEKLSLLGYSVKAI
FT                   SSNLAELKIFQIDIIKNEEKIVYRYTLDYYEENINLINHIPIYVCAINNRYIIAITPNI
FT                   SYFRNKIALVFDIIGEQQIFIDPHIIGEHYIYELLDMSFVSINGKKNILIKTGQICSFD
FT                   KRKFFYAKNQYFANSTEAIIIIPCEELIQNLVNGKFKFNKYIVDKAEYCETLDFPIKAR
FT                   IYNPYYLNGKSYSIIYYKENFITKKTDIISYNLETKKSSYIGSLPFPLEKIPPIYKEKG
FT                   KHFIMYIPFYPFAIGGIPSKYFIKHYIESNQLFFIELPIPISSNEILNDVKFFNNETIV
FT                   ETKNIESGQNLIYSVNNDMIIAKIGYGENYLFVVNPKTNDLNAIMIYPRFLKKS"
FT   gene            complement(313478..313624)
FT                   /pseudo
FT                   /locus_tag="COB47_0254"
FT   gene            313770..314709
FT                   /pseudo
FT                   /locus_tag="COB47_0255"
FT   gene            314759..315271
FT                   /pseudo
FT                   /locus_tag="COB47_0256"
FT   gene            315392..315622
FT                   /pseudo
FT                   /locus_tag="COB47_0257"
FT   gene            complement(315628..317001)
FT                   /locus_tag="COB47_0258"
FT   CDS_pept        complement(315628..317001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41606"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0263"
FT                   /protein_id="ADL41606.1"
FT                   /translation="MREISIINIYNLCKEILEYKPDETIIIPPSLQSTINALVLKPVIT
FT                   PKADILFEIAQYFPKVGVESICFVKGKDLNCTFYRFLNNVQQILLFDHENCILYGYTMK
FT                   KVNRDLIEIKIVQVDLCHAQERIIFNFSIGYLDQSPESDSIEPLYLSALNQRYFLIITP
FT                   IIPNYPTKIAKIIDTESKEEIQINPYLFENHNIFEIADFKVIQTHENKKYLLIKTGRIC
FT                   SFEKRDFYNSNSAQYTDKIETLIVAPIEELIDEAISQKKIDFSKYIIAMADQSQTIEFE
FT                   PFLHFDKMFAPIIAKNLPFILYSKESFNKNSIDIFKFDLEKRVACKIASFEGETPFINC
FT                   DDKGYFVVEASYSNLPDSNLQKLILEKIYLENCQRMKEELMIEKDEIFEKLYSYSSKVS
FT                   YIVTKNTLKGEFKVYFLDDKKSYLTIKFDEGFVPVLDIAKNEINAFIIYPNFVKKLTC"
FT   gene            complement(317155..317982)
FT                   /locus_tag="COB47_0259"
FT   CDS_pept        complement(317155..317982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41607"
FT                   /db_xref="GOA:D9THX5"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0264"
FT                   /protein_id="ADL41607.1"
FT                   /translation="MKNKMKRILALIVCISFILTFLPINSVSFAKPRYDVWKDKIKVYD
FT                   ADKKIKRAEAEYEGYKYIATFDKDTNEIKLKVKPIATKKFDKSLDSSSLNEERNFSVKV
FT                   EYFDGENLKAKLIDEKTKEEYNIGDSDTVSAQFVIALPIAVGLIEALISALLAIGEAIV
FT                   IVGITYIAASRILEKIKNSSYDYYMAIIRNNNVYIGPAIDYETAYNRVSLFEGDVFCRT
FT                   ESKAKTLALNVAYSKRGTIIGPERHKDYANYYPHYHVKDAYGYKLASHIFFPY"
FT   sig_peptide     complement(317890..317982)
FT                   /locus_tag="COB47_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.964 at
FT                   residue 31"
FT   gene            complement(318007..318969)
FT                   /locus_tag="COB47_0260"
FT   CDS_pept        complement(318007..318969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0260"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: ate:Athe_0298 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41608"
FT                   /db_xref="GOA:D9THX6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX6"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADL41608.1"
FT                   /translation="MHKHKKLFLLSGAIFAILSSILAANLYMSNNPPTQNLQQAYKKQI
FT                   VPWSYKKLGITKMWKFTKGKNVKIAILDSGIDLNHPDLKGANIIKTINFIDPNKPAFDE
FT                   TGHGTFIAGIIAAQNNNFGIVGIAPDAEIFILKILNKKLEGKVDLVIRALDWCIKNKIN
FT                   IVNMSFSTSSDNPKLRKAVSKAAKHGIIIVASARNSFGSKAGFPASYPEVISVASVNYK
FT                   NQISLFSSQGKIDFCSYGENILSTTKNQSYKLSSGNSVAAAHLTGMIALILSKPEKWGL
FT                   NPKNSMNKDKICNVLIKLSKDLGEKGKDNIFGYGLVRFK"
FT   sig_peptide     complement(318898..318969)
FT                   /locus_tag="COB47_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.654 at
FT                   residue 24"
FT   gene            319156..319713
FT                   /locus_tag="COB47_0261"
FT   CDS_pept        319156..319713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0261"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ate:Athe_0272 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41609"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX7"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADL41609.1"
FT                   /translation="MYFYTCYKIFVEFMVGKAAILANKKIIKNQVIFIFYKWGKNSQLD
FT                   TNLFIYLIEKNRTYFPLVKSLFEKIQKGQLYGVTSSLVYTELLSKPFQEENIVLVNKYK
FT                   VLLATFPNLIIKEVDKDIATLAAKLCAKYKIKTPDAIFIATGIAEKAQIFITNDTRLKI
FT                   VNEISIIILDELLNQTDRVIID"
FT   gene            319921..321074
FT                   /pseudo
FT                   /locus_tag="COB47_0262"
FT   gene            321108..322169
FT                   /locus_tag="COB47_0263"
FT   CDS_pept        321108..322169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0263"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   csc:Csac_0174 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41610"
FT                   /db_xref="GOA:D9THX8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADL41610.1"
FT                   /translation="MKSNTIQNEYKKLVARKIIFLIILISLTVILAIYAIVIGSSNLSF
FT                   SDVFKTLIGKGDERTRLIVFNIRLVRVLAAILAGIGLAIGGSATQTLLHNPLASPFTLG
FT                   VSQGAAFGAAIGIILLGGGTTSSSASDSVVILNPSIVVTCAFLGSMISSIVVILLAQVK
FT                   KFLPESVVLSGVALSSLFSAATTIIQYFASDVKIAALVFWTFGDIGRASWNDLKILCVF
FT                   VLLSWLYFFKNAWDYNAIESGEDVAKSLGVNVEKKRIAGIFISSFVTSVIVAFLGIIGF
FT                   ICLLGPHIAKRFVGNDQRFLVAASGLVGGFLLLLSDTVARLIISPIVLPVGAVTSFLGA
FT                   PLFLYLLIRRKKT"
FT   gene            322172..322936
FT                   /locus_tag="COB47_0264"
FT   CDS_pept        322172..322936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0264"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: csc:Csac_0175 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41611"
FT                   /db_xref="GOA:D9THX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9THX9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41611.1"
FT                   /translation="MLEVKNLSFAFKDFEVLKEIELKAQKGQFVSILGNNGAGKSTFLK
FT                   CIARILKPQSGVIMVDGKDISRFSSNDLAKVVGYVPQRYASTRLTVFESILIGRKPHFS
FT                   GIIPSKEDLQVVESVIEKFGLKPLAFKYLDELSGGEMQKVVIARAVAQQPKILLLDEPI
FT                   NNLDLKNQVEVLSILKKLSKENSILVISVLHDLNLAIRFSDHFVFIKDKSVFASGGREI
FT                   ITPEIISNVYGIEVKVETSHDQLFVVPIVPTI"
FT   gene            322960..323400
FT                   /locus_tag="COB47_0265"
FT   CDS_pept        322960..323400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0265"
FT                   /product="uncharacterized protein family UPF0066"
FT                   /note="PFAM: uncharacterized protein family UPF0066; KEGG:
FT                   ate:Athe_0276 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41612"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY0"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ADL41612.1"
FT                   /translation="MELVPIGIFHTSYKTKDEAPRQGRGSEDIAYIEVFEKYIDGLKDI
FT                   EEAKYLIILYWAHEAKRDVLVTKTPFSDVPKGVFACRSPNRPNPILLDVAELVDRKGNV
FT                   LVVKGIDAIDSSPVLDIKPFYAEIDVPKEILFSSVVRKESET"
FT   gene            323402..323932
FT                   /locus_tag="COB47_0266"
FT   CDS_pept        323402..323932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0266"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: csc:Csac_0177 formylmethanofuran
FT                   dehydrogenase, subunit E region"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41613"
FT                   /db_xref="GOA:D9THY1"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR026328"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY1"
FT                   /inference="protein motif:PFAM:PF02663"
FT                   /protein_id="ADL41613.1"
FT                   /translation="MDSALWQKCIEFHGHICPGLAIGFRACEVAIEKLDLTFSKDEEVV
FT                   CITETDACGVDAIQVILGTTIGKGNLILKDRGKHAFTFFRRDTNEGIRVVFKGFEKDVP
FT                   REERLKIILSAPLSQLFELKQPKDNIPPSARIFKSVECTGCGEKTAENKIRVLDGKFYC
FT                   LDCFEEYSRGWSR"
FT   gene            complement(323912..324361)
FT                   /locus_tag="COB47_0267"
FT   CDS_pept        complement(323912..324361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41614"
FT                   /db_xref="InterPro:IPR024208"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY2"
FT                   /inference="similar to AA sequence:KEGG:Csac_0178"
FT                   /protein_id="ADL41614.1"
FT                   /translation="MTIAVLDGQGAGLGREFIKRLKKEFEDKIKVVALGTNKVAMQNML
FT                   KNGADVGYCGEDEIVYFLSNFVPDAIVGPIGILTCGGINGEITAKIAQMVFSLECKKYI
FT                   IPLNLHGIFIPGTINLSIKEIFNYIIEDIAVSIEKEDRSLSAPSS"
FT   gene            324600..325676
FT                   /locus_tag="COB47_0268"
FT   CDS_pept        324600..325676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0268"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: ate:Athe_0301 response regulator receiver
FT                   modulated CheB methylesterase; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41615"
FT                   /db_xref="GOA:D9THY3"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY3"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ADL41615.1"
FT                   /translation="MKRILIVDDSELMCEVIRGALRGLEEDNVIFVATNPLIAIRKANL
FT                   FKIDLALIDYEMPYMNGILLIDYLKDINPLTKILMVSAYTEPGAQITLEALNRGAIDYI
FT                   LKPANKDEFNEFKKDLLEKVKGIIFQKDYAFVNIKRTTTSEKSEKKVFPVTCGIDNNRS
FT                   HLINKLKESKVIAIGISTGGPPVLEKIFTSLNKDFSIPILVVQHMPPTFTKALAERLSK
FT                   VAQRQVKEAEDREKIENGVIYIAKGGTHLAVEKILGKYYVRLLDNIEKVNNHKPSCDIL
FT                   FSSVAEWYGENATGIIMTGMGSDGANGLFEMKKQGALTIAQSKESCVVFGMPRVAIEKG
FT                   AAEVVLSVEEIIDLLNRV"
FT   gene            complement(325748..327130)
FT                   /locus_tag="COB47_0269"
FT   CDS_pept        complement(325748..327130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0269"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ate:Athe_0279 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41616"
FT                   /db_xref="GOA:D9THY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL41616.1"
FT                   /translation="MKKNFLKCLNIRLKLTIWYSIMLMVIVALFSLFLYLLMFQTLEIS
FT                   ERSFLQDFAYEVALRINISKDSKITISESHRIISSGAQIVVYSKNKKMIYSTSNLFAKS
FT                   IKNIPLDTKVRMFELNGKEWLVYDQRIYDMKNNLIGWLRIGRPSSTRRIMNNLKNVIFL
FT                   SIPIPFLIAVAGGYILAKKALKPIDDITTMARTIGHTDLSKRLNFPNTNDEIGRLALTF
FT                   DEMLERLENAFKRERRFLSDASHELRTPLATIKALVEEALERNLTKDRYHQQLHYIYRE
FT                   ILKMNKIISQLFMLSRCEEGNWPVDFEKINLKNMVEDVIEEMKEFALQKEVKLYHDCNK
FT                   EIFIEGDQTLLTRLFINLIENAIKYNKKGGWVKTKVEELEHQIKITIEDSGIGIPEEDL
FT                   PFIFNRFYRVDKARTTEGIGLGLSIVDWIVKIHKGRINVTSKIGIGSCFEIILPKEQKS
FT                   TT"
FT   gene            complement(327127..327801)
FT                   /locus_tag="COB47_0270"
FT   CDS_pept        complement(327127..327801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0270"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ate:Athe_0280 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41617"
FT                   /db_xref="GOA:D9THY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41617.1"
FT                   /translation="MRILIVEDQESLAHTIARRLQEVGYSTDITFDGQEGLHFATSTSY
FT                   DLIILDIMLPKIDGINLLKLIRLKGIQTPVLCLTAKDSIEDRVIGLDAGADDYLVKPFS
FT                   FDELLARIRALLRRYAQTREPIIKVKDLVIDTNSHKVTRAGKLIELTSKEYSILEYLAR
FT                   NKGRVLTRSQIAEHVWNYDFEGTSNIVDVYIRYLRRKIDDGFPEKLIYTIRGVGYMLRD
FT                   EK"
FT   gene            327972..328277
FT                   /locus_tag="COB47_0271"
FT   CDS_pept        327972..328277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41618"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0281"
FT                   /protein_id="ADL41618.1"
FT                   /translation="MKRKSKLMKRLIAIGILAAFILTGVFSFAATTSTSSSKSHVKKVS
FT                   TVATKTPVKAGKISTKLAKYSKSSKSSKTETKKSSTKTNKVYSSKNQKTAKTSTSK"
FT   sig_peptide     327972..328061
FT                   /locus_tag="COB47_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.951 at
FT                   residue 30"
FT   gene            328696..329436
FT                   /locus_tag="COB47_0272"
FT   CDS_pept        328696..329436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0272"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /note="PFAM: 2-phosphosulfolactate phosphatase; KEGG:
FT                   ate:Athe_0305 2-phosphosulfolactate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41619"
FT                   /db_xref="GOA:D9THY7"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY7"
FT                   /inference="protein motif:PFAM:PF04029"
FT                   /protein_id="ADL41619.1"
FT                   /translation="MKIVTFSHYKDVDEKEIKDSVAVVIDLLRATSVMIWAISNGAEKI
FT                   IPVESIEEARLFKSVEETFILGGERGGLKIEGFDLDNSPLSYKKEVVCGRKIIMTTTNG
FT                   TRALKRAVMAKRIFLGSFINAQKTAEYILKEALKKDIQKITIVCAGTEEKFTLEDILCA
FT                   GYFVDMFKNGLGDVEIDDLSLASFELYKKFENDPHKILKYSYHYNRLKQLGFEKDLEFC
FT                   LRKDFVDCICEYKNLVVEKVFVDV"
FT   gene            329429..329989
FT                   /locus_tag="COB47_0273"
FT   CDS_pept        329429..329989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41620"
FT                   /db_xref="GOA:D9THY8"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0306"
FT                   /protein_id="ADL41620.1"
FT                   /translation="MFEIYLSSYSKRIYRKRAKITSFVGMIFILLISSLLHFGFEFFGR
FT                   IKWTAIVFAVNESVWEHLKIGFFGGFIFYIIEYIIYGRRFENFIVGKSVALFLIPFLTA
FT                   IFYFLYTAFLADNLFLDILTLVLAIIIAQLVSLKITLSQKKIKKAPFVILIILLLIIFP
FT                   LFTYFPPKIPQLFYDFAHKRYGI"
FT   gene            330016..331977
FT                   /locus_tag="COB47_0274"
FT   CDS_pept        330016..331977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0274"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: ate:Athe_0307 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41621"
FT                   /db_xref="GOA:D9THY9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D9THY9"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADL41621.1"
FT                   /translation="MEKPKFYITTPIYYPSDKLHVGHTYCTVAADTIARYKRLRGYDVF
FT                   FLTGTDEHGQKIERKAQEAGKTPQQYVDEIVASIKELWKLMNISYDDFIRTTEERHKKV
FT                   VQKIFTKLYEQGDIYKSEYEGWYCTPCESFWLDRQLVDGKCPDCGRPVERAREESYFFR
FT                   LSKYQDALMKYIEEHPEFIVPQSRANEMINNFIKPGLEDVCVSRTTIKWGIEVPFDPKH
FT                   VIYVWIDALSNYITALGYMSEDDSRFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLP
FT                   LPKTVFGHGWLLLEGGKMSKSKGNVVDPVILAQKYGVDSLRYFLLREIPFGADGYFSED
FT                   ALKNRHNSDLANDLGNLLSRTVAMIEKYFDGVIYHPEEEEEIDNELKRLAKEVYENVCK
FT                   LLDEFQFSNALIEIWKLISRANKYIDQTMPWVLGKDKSKYPRLKTVLYNLAEVLRVVAV
FT                   LIEPFMPQTTPKILQQLGISKDENLDITTWESASQYGLIPEGTKVKRGEPIFPRIIEKE
FT                   ENAVEDTNKQEVKRPEGAVPADDKNEEQKEYITINDFAKLELRVAKILEAHRIEGADKL
FT                   LKLIIDLGDEKRQIVAGIAKHYSPEELVGKKIVVVANLKPAKLRGVESQGMLLAASIGD
FT                   ELTLITPEKDIKEGAKVK"
FT   gene            331974..332738
FT                   /locus_tag="COB47_0275"
FT   CDS_pept        331974..332738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0275"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: ate:Athe_0308 hydrolase, TatD family; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41622"
FT                   /db_xref="GOA:D9THZ0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ0"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADL41622.1"
FT                   /translation="MIIDVHAHYDDEAFDADLEDVMAKLKEEDIIAISSSSSVESSKEN
FT                   IEIAKKYDNIYITVGIHPHEAKDAPKDFEQELFGLARFEKNVAIGEIGLDYHYDFSPRD
FT                   VQRDVFVRQIEVAKELNLPIVVHSREAHKDTLDVLFERAVGKIPVLIHCYSGSVEMSRI
FT                   LRKHGIYISVGGVITFQNAKKLVEVVKEYPLELLMLETDSPYLTPHPYRGKRNDSTYLK
FT                   YVIQKIAQIKDVSEDEVIEKTTQNAKNFFGIK"
FT   gene            332766..333359
FT                   /locus_tag="COB47_0276"
FT   CDS_pept        332766..333359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0276"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ate:Athe_0309 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41623"
FT                   /db_xref="GOA:D9THZ1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL41623.1"
FT                   /translation="MGMITYTIDNRLYINVTNKCTNSCIFCIRNSEKGLGEGYDLWLEK
FT                   DPTAEEILNEIKDPQKYDEIVFCGYGEPLIKLDVVIEVAKRLKERTSVPLRVNTNGHAS
FT                   YIHKKNVPQLLSGLIDRISISLNAPNKERYNEICRPFDKDIYDHVIEFIKESRKYIKEV
FT                   WVSCVDIISKEEVEECKKIAQELGVNFKLRAYEQ"
FT   gene            333805..335268
FT                   /locus_tag="COB47_0277"
FT   CDS_pept        333805..335268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0277"
FT                   /product="LmbE family protein"
FT                   /note="KEGG: ate:Athe_0312 LmbE family protein; manually
FT                   curated; PFAM: LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41624"
FT                   /db_xref="GOA:D9THZ2"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ2"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADL41624.1"
FT                   /translation="MPRFKVKSAEGYVYKKPQRERRIRFKRKYILYTFIIWIVANVFLF
FT                   LAREYISNYFFSAQLPLLRVENYKKILIFAPHCDDETLSSAGVIQKALLYGRKVKVVVM
FT                   TNGDGFTRAAGQNFGKIRLKPDDYIRFGYLRQNETVHALEDLGVKREDIIFLGYPDRGL
FT                   RFLWEKYFDSKVSYFNPLTRTFKSPYSNSYQRGVEYKGINVVKNIQSIIKSFEPDLIIY
FT                   PYSHDQHPDHWATSAFVKFSILTLNYSCEEWQYLVHRGDWPTPFGKHPQMYLVPPFKLA
FT                   FTNTEWYQVPLEENMIEKKLNSISDYHSQMKVMRGFLEAFVRQNELFAKLNNEYAKKYE
FT                   GDNLFSDKYLISKEPTHDIWSLIFEKGADIEAIFAAHDSKNIYIGIEMVGSAKKLISYY
FT                   LHIRAFENYKYLGRMYVLISGSKMNVIKTMTSPAFSAQNAKMRRKKNQIEIVFPKKDLQ
FT                   NPNMLYLSVRTEFLGRQLDRSAWKVIELK"
FT   gene            complement(335274..335690)
FT                   /locus_tag="COB47_0278"
FT   CDS_pept        complement(335274..335690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0278"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   ate:Athe_0313 protein of unknown function DUF151"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41625"
FT                   /db_xref="GOA:D9THZ3"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ3"
FT                   /inference="protein motif:PFAM:PF02577"
FT                   /protein_id="ADL41625.1"
FT                   /translation="MIEMYVKNVAFFEEGGGFAVLLCDKNNKMVLPIFIGPLEAQSIAL
FT                   ALEKQKFPRPLTHDLMVEIMQKFSISIQKAVITDIKDGTYFAQLHLRDYNNVISVIDSR
FT                   PSDAIALALRVNCPIYMAPKLIEFTYKYEELIPQ"
FT   gene            complement(335764..337842)
FT                   /locus_tag="COB47_0279"
FT   CDS_pept        complement(335764..337842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0279"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: ate:Athe_0314 heavy metal translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41626"
FT                   /db_xref="GOA:D9THZ4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ4"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADL41626.1"
FT                   /translation="MNVELILENLSCANCAQKIEEKVAKLPFAESVSLNFVTKKLSAKV
FT                   DQKSYSAFVEAVKKIVNEIEPEVSVLEAPKEKPMISIGEILLVLISAMFFVVGLFTRKE
FT                   GFALIFFLVSYLLSGKNVILSFFKNIRKLQLFDENFLMTVATLSAIFLKEYPEAASVML
FT                   LYKIGQILEDVAVNKSRKTIQALKHLEIDYANLKIGNIIRKVNPKDIVPGDIVVVKPGE
FT                   RVPVDGTVVSGKSFLDTSAITGESKLFVAQPNDKVFAGSAVVDGFLEVKAQSFYKDSSL
FT                   HRIIEIVENASANKSKMERFITRFAKVYTPAVVALAVIFAILPPLLFDQPFKLWIYRAA
FT                   IFLIISCPCSLVISVPLSYFASISKLSSKGILVKGSQFIDILASKIGSFLFDKTGTITN
FT                   GVLSVEKIVPVQISEQEFLKILISIESLSNHPVAKSILKGIGENSISFSSVQDLKEHPG
FT                   RGIEGIVDGKKVLIGTKEFLQESGVEINHSSEVSSELSYIFVSCDMKFCGYVALKDSLK
FT                   DDVKKVLNALKSFGAKIYLLTGDKKEVAEKIAKDLPIDGIFSELLPEEKVKVAEKIKLE
FT                   NKGLGYVVFVGDGTNDSPALSVCDVGISFAGSASYLATVAADIVLLDGKLSKIVELIKD
FT                   SRFTRRIVIQNIVLSLGIKFAVMLLGVFGVANLWEAVVADTGAMLLAVLNSLRVLKK"
FT   gene            complement(337871..338248)
FT                   /locus_tag="COB47_0280"
FT   CDS_pept        complement(337871..338248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0280"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: ate:Athe_0315 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41627"
FT                   /db_xref="GOA:D9THZ5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL41627.1"
FT                   /translation="MEKQDGFEKIDLCSCNVIHNDIVKKVKESLPAEETIFDLAEFFKV
FT                   FSDSTRIKILSSLLVSEMCVCDLAAVLGTSQSAISHQLRLLKVFRLVKSRKAGKVVYYS
FT                   LLDDHVKSIIELGLAHLSENQ"
FT   gene            338442..339695
FT                   /locus_tag="COB47_0281"
FT   CDS_pept        338442..339695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0281"
FT                   /product="glycosyl transferase group 1"
FT                   /note="KEGG: ate:Athe_0316 glycosyl transferase group 1;
FT                   manually curated; PFAM: glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41628"
FT                   /db_xref="GOA:D9THZ6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADL41628.1"
FT                   /translation="MNLILLTIGYPHPKRDVFVGNEIDILSQFFNKIYIVPIWPGKVLP
FT                   KKLKNLKQYIQNPKVEVADISFGLIDILLLNPKLIGLMIKEAIKAVFSPKPFSYRLLNL
FT                   WMVFRWTFLTNITLRNIKKLIKKYNIPAEDTILYSYWFHFLALSVSLYNQPFALKVSRA
FT                   HRGDLYEESYPQPCKKFIIKNIDKIFACSKMGAEYINNSYQTNKAEVSYLGTFNKHNVN
FT                   IDKKKDEIFKIVSCARVVPVKRIDRIVDSLEKIDSVKISWTHIGDGELLEKIKLYAQEK
FT                   LGRKSNIEFKFLGFMKNEDILNLYATENFNLFVNVSQSEGLPVSIMEAMSYAIPVVATD
FT                   VGGTKEIVKNGINGFLLDKNFSDNDLANLIEKFATMSQEEYKKFCLAARRIWEENFNAQ
FT                   KCYEDFAKRLLALSASKK"
FT   gene            339714..340541
FT                   /locus_tag="COB47_0282"
FT   CDS_pept        339714..340541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0282"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="KEGG: ate:Athe_0317 HAD-superfamily hydrolase,
FT                   subfamily IIA; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIA; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41629"
FT                   /db_xref="GOA:D9THZ7"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ADL41629.1"
FT                   /translation="MKHSSILKNIDLFLLDLDGTVYLGERVFEGAREFIKLLKENQKDF
FT                   LFLTNNSSKSSEDYYSKLLNMGFEITKENVFTSGQAMGIYIKTIHKEKRSPKVYVVGTS
FT                   SLKRELKSMGIFVVDSPNYNIDYLVVGFDTQLTYKKLLDACELIRRGVPFLATNPDLVC
FT                   PLDGGRYIPDCGSICIMLENATKKKPVFVGKPSSIMVDIISNFKKVEKNKIAMIGDRLY
FT                   TDIKMAKDSGMVAVLVLSGETRMEDVEASSLKPDLIYGSIKDIYEELKLVFGG"
FT   gene            340547..341179
FT                   /locus_tag="COB47_0283"
FT   CDS_pept        340547..341179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0283"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   ate:Athe_0318 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41630"
FT                   /db_xref="GOA:D9THZ8"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ8"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ADL41630.1"
FT                   /translation="MCGRYFLNLDENIEEIKKILDEIYQKYEKSPILQKVKSGEIFPTE
FT                   FVPSIVSKDFQREAEILRWGLPLQNKKEVIINARAETILEKPLFSSIISNRCLIPAQGF
FT                   FEWKKDGSKKQKFFIKPKDCNVFYMAGLYKRVELEGGILVDSFVILTTEPAEEIKHIHN
FT                   RMPVILKKEYEDLWLFEKGSTKALKSLFSVLLKPWEGEIEAVEVKNN"
FT   gene            341240..342175
FT                   /locus_tag="COB47_0284"
FT   CDS_pept        341240..342175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0284"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.1.1.158"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; KEGG: ate:Athe_0319
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain-containing protein; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41631"
FT                   /db_xref="GOA:D9THZ9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D9THZ9"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADL41631.1"
FT                   /translation="MEFEMYLKNLGIEFLKDHPLKEFTTFKIGGKARYIVFPQNTEQFI
FT                   GILTLIKEKKINYIVVGNCSNVLVSDKGFNGAVITTVKIDSFKIDGNLIEADCGAMLSV
FT                   IAKKACEKGLKGLEFAVGIPGTVGGAVYMNAGAYDSEIKDVFEWAEVLDKNLNILKLSK
FT                   SEMKFSYRHSRLKEEKMVLLRAAFSLEFAAKEDILPLQKASEFSKRRREKQPLSYPSAG
FT                   SVFKRPPNNFAGKLIEDAGLKGYRMGGACISEKHAGFIVNVEDAKAEDVRKLIYLAQKT
FT                   VYEKFGILLEPEIQFIGDFETPLFAPEYPK"
FT   gene            342211..343083
FT                   /locus_tag="COB47_0285"
FT   CDS_pept        342211..343083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41632"
FT                   /db_xref="GOA:D9TI00"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI00"
FT                   /inference="similar to AA sequence:KEGG:Athe_0320"
FT                   /protein_id="ADL41632.1"
FT                   /translation="MEIVIITGMSGAGKSLAIRAFEDMGFFCIDNLPPQFLPKIAELAS
FT                   ATKEKISRIAAVVDIRGGELFDDFKDVLQELKKDDRNFKLLFLDAHDEVLIKRYKETRR
FT                   KHPLSFEGDGSILEAIQKEREKLEDIKRYADFVIDTSTLLPRDLKEKLFEIFVQQKSKE
FT                   AMLITIMSFGFKYGLPLDADLVFDVRFIPNPFYVDTLKYKTGKEPEVKEYVLKWDVTKK
FT                   FLQKLFDLILFLIPNYAEEGKGQLVIAIGCTGGKHRSVTVAEELFKAVENQGYKVSIFH
FT                   RDIEKDKKG"
FT   gene            343085..344407
FT                   /locus_tag="COB47_0286"
FT   CDS_pept        343085..344407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0286"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: ate:Athe_0321 protein of unknown function UPF0052 and
FT                   CofD"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41633"
FT                   /db_xref="GOA:D9TI01"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI01"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADL41633.1"
FT                   /translation="MPMIFDFLKPGIYIKRWIVLMLFSIILISASLTKSIDIFNVSVEL
FT                   RTSLRIGLFALGIGVFLISLMGLIKGFIRLLNKSLPYRISQKTIFDAIYSKGFLEKGPR
FT                   VVAIGGGTGLSTMLRGIKNLTANITAVVTVADDGGGSGKLREDLGMLPPGDIRNCILAL
FT                   ANTEEIMQKLLSYRFKEGSLKGQSFGNLFLAAMTGIAGSFEKAVKLMSEVLAVRGKVLP
FT                   VTLDNINLCAELEDGRVVVGESKIPEEVKNSKTPIKRVFITPSDAKPYAEVLDEIEKAD
FT                   VIIIGPGSLYTSIMPNLVFKEVVESIKKSRAKKIYIANIMTQPGETDGYQLYDHIEAIE
FT                   RHCGGRIFDIVIVNNQPIPPEVLERYREDGAQPVWSDKKTVEKGYTVVEEGLLNISNGL
FT                   IRHNSAKLARVVSNIIYGKDVIHEYRLGYLRLKNFGKPFKS"
FT   gene            344448..345425
FT                   /locus_tag="COB47_0287"
FT   CDS_pept        344448..345425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0287"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199;
FT                   Sporulation regulator WhiA-like; KEGG: ate:Athe_0322
FT                   protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41634"
FT                   /db_xref="GOA:D9TI02"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI02"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ADL41634.1"
FT                   /translation="MSFSSTAKSEVSRKLSQNSCCVKAAVAAFLKFAGSIYELDGTFSF
FT                   KTSFENAQTARSFFLLMKNGFSKHCEVSIKKNSKLQKNYVYTIFLPPSSDNIGVLKDLH
FT                   FVRKGAKEYHLSFSLKEELVKKKCCRKAFLQATFLSCGSITNPEKMYHLEFDVKTKDDA
FT                   EFLQKVLKSFEFEAKIVERKSHYVVYLKEGEQIVDFLNIIGAHSSLLELENIRIVKELR
FT                   NNVNRLVNCETANLEKTINASMRHIENIEFIERTIGIDSLPQNLQEIARLRIKYKDASL
FT                   KELGSMLKNPLGKSGVNHRLRKIDKIAEELRKGGIVYAKPSHED"
FT   gene            345400..345738
FT                   /locus_tag="COB47_0288"
FT   CDS_pept        345400..345738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0288"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: ate:Athe_0323 phosphocarrier, HPr family;
FT                   TIGRFAM: phosphocarrier, HPr family; PFAM: phosphoryl
FT                   transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41635"
FT                   /db_xref="GOA:D9TI03"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI03"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADL41635.1"
FT                   /translation="MQSLHMKIENSQGISSRAAALLVQVASKFKSLILIEKDEKRANAK
FT                   SIMGLMSLMVDCGDEVTIITDGEDEKEALEAVLKLIQSDFSEQVADEITQQETKKENNK
FT                   ENSENDNE"
FT   gene            345806..347047
FT                   /locus_tag="COB47_0289"
FT   CDS_pept        345806..347047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0289"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ate:Athe_0324 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41636"
FT                   /db_xref="GOA:D9TI04"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI04"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADL41636.1"
FT                   /translation="MALLKDELYRRVLIFDGAMGTQLIQNGLKEDECPDLWSVTRQDVV
FT                   SSIHRQYFEAGSDCVETNTFGANREKLKKYGLENEVENINKWAVCLAKEVAKEYGGYVG
FT                   LSVGPTGRLFVPSGDLSFDEAERIFYEQILSGIQAGADFVSIETMSDIKEAKAAFFAYK
FT                   KVKEVLKKDIPCLVSFTFEQNKRLLMGTPPEVAAYYFSLIGCDIVGANCSGGAIQLLEV
FT                   IKQMQGFSSVPLSVKPNAGLPKVVDGKTVYESCIPEFVNLADEFIENGVRLYGGCCGTN
FT                   PEYISAISKVLKGKEVSFESGIQKKFITSIYSLLDISQKFSFYEFKLTNDFSSEAVFEL
FT                   AGLEEDAIFVDIDENVEPEVLKEFLIESQDFSKKPYVFDIKTKSHADVIERYYFGVYGT
FT                   VSSIHGKSAVKVQI"
FT   gene            347071..348888
FT                   /locus_tag="COB47_0290"
FT   CDS_pept        347071..348888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0290"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase;
FT                   methylenetetrahydrofolate reductase; KEGG: ate:Athe_0325
FT                   homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41637"
FT                   /db_xref="GOA:D9TI05"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI05"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADL41637.1"
FT                   /translation="MKKSFREFLKEQSTVIFDGAMGTELLNRGFSLDFPLEWANIANPE
FT                   LVKEIHTDYILAGAQCIETNTFGANECKLKIFGFENEVERINRSAVKIAKEVADDKVFV
FT                   IGSVGPLGKPVGSGFEIDTRRAREVYKRQLYFLLDEGVDAIIFETAASTHEVQIAIEAL
FT                   KELNDKIPYIIQFSFTKELSTIYGEDIYMVTEFLKVTDADVVGLNCGNGPQKTLEALKV
FT                   FSQHLKGPFSVQPNAGYPQLVQGRLIYSTSAKYFASFVPEYIKLGAKVVGGCCGTTPEH
FT                   IKAIKEKVKEFLPSIEVEVVERKEEQKTVLKDTPSELSQKLGKKFIFTVEISPPKGIEL
FT                   EKTKEGVKLLKDAGADTVNIADSPMARVRISPIALAHILKEELGMESILHFTCRDRNLI
FT                   SLQSELLGAAALGVKNVLALTGDPPSIGDHPQAKPVFDVNSEGLVLILSRLNSGTDYMG
FT                   NPIGKATNFTIGVALNLNADDLEKEIEKLKHKIENGAHFIETQPIYKPETLERFLEKVN
FT                   FSLPPILGGILPLRSSRHAEFLHNEVPGITIPDKIRERMRSSKEPAKEGVEIACEIVEK
FT                   IKHMVSGIYIMPPFEKYEMAVEIIKNFKH"
FT   gene            349027..351654
FT                   /locus_tag="COB47_0291"
FT   CDS_pept        349027..351654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41638"
FT                   /db_xref="GOA:D9TI06"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI06"
FT                   /inference="similar to AA sequence:KEGG:Athe_0339"
FT                   /protein_id="ADL41638.1"
FT                   /translation="MKKAYLLKKLNLSLLDDAQPNELIILPRRFVINKLKERLVEKNRV
FT                   LFDTDIFTFDDLITPAKNEVLKTRKVITREQEVLVVFQLLKSIFKGKTNFENVLTYEFT
FT                   NQVIYLLNLMFLESKDYSQNNFESAENYGFLIKLFEKYKEYLDQNNLVNFSYLQDLAIK
FT                   LFEENRLEFKDYSCAKIAFFTDFRCDQKRILKLIAEEITDIEVFMPFFDDIEICIETAK
FT                   FLESLGFDIVFSTNKEYSLGNLDSPSCQLKVYSYPNIILEINSLVKEIKKDISERKAGF
FT                   DRIAVVVPSVERYKDALVQTFSEEMLPVNLSCQKSLIEFGFIRFVLELLEFLGGEFDKK
FT                   NFERIVSHKFLNTEKADFEILFSKMKNMSILELEQIEFVLEELEFFANLYAFDDVIENL
FT                   IKVRRVFNRLKRIKNEYDKLPKPFVSWLENTRKVFERLGITKHAEFVNDIEFIKAFYHL
FT                   NEIFKKGQEDFKEFDSDFTFEEFLGIFKTILSQKMVDVSINILSGIDVLSIQDVLGSNY
FT                   QKVYLIGLSDDILPRSNSEGFLRNMRLKEELMLDEIKNFDYIFQKDLVHFRTVLNSYDV
FT                   YMSYPRYYQTETNKSPFLELEGIEEVPVLKSYIPSDDKVTYREYKFIKNVNKKDDGKTY
FT                   TCAEVPEINQIKDRELIEYQSCPLKFAFKKFDVDEKEREEKHFLSNLQLLFSCIQKILS
FT                   SKDPQETLDFLLSNIRYTHNEPVKKLAALDIMQISLEIVERMNEYGVEEFTPQNMKDKV
FT                   FVVRKMFEGVELQLFPNFVVKIDDQEICGFVKAKISSEKEIDKIWIANYIFELDKVAAI
FT                   YLFEKPRFVIYENTNGSLDKLTQEILSGIKEGINKLGEIETYKKAKSVKNCFSCEYSHV
FT                   CLLF"
FT   gene            351673..354540
FT                   /locus_tag="COB47_0292"
FT   CDS_pept        351673..354540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0292"
FT                   /product="UvrD/REP helicase"
FT                   /note="KEGG: ate:Athe_0340 UvrD/REP helicase; manually
FT                   curated; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41639"
FT                   /db_xref="GOA:D9TI07"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI07"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADL41639.1"
FT                   /translation="MVVKMSDIIIYSASAGCGKTENIANLYIDLISQKKILPTEIVCIT
FT                   YTEKAARELKNRIISKAKQRRLDLLTISKIQNSHIKTIHSFCMYLLRFYWAWAKVDANF
FT                   KIVPEIDRLILELIDDYLSVFPATLGKLPQERFFIEEYFHFAESIAQEYSNSAKYVGKT
FT                   CHLESETFYIFEHLSDRLNDQFLKELTYDLVLQRTFELLSVPEVNRDVKNRFKFLIVDE
FT                   FQDSNFLQKSIFENIAENIYYVGDKKQSIYRFQGAEPEVFDEAMENCSQVLELCENFRT
FT                   NSELGKKIDKIATILFPDYKPLSYKHQADGFLKVVEIVNKAREEIIQNEAIYVAKKIKE
FT                   MVESGFEISVGGKPKRKVKYSDFAVLSRKIQNIAHIYKRVFEDYDVPLDINFKRGLLEQ
FT                   KEIVPLLGLLEILQYPDKKSGYLRLLANDIFKVDKFTLLFYEMSKIECYVPEDVLKFIA
FT                   KQRDNLFVQKISEILYEFEDMFEYSYKVYKFFGKGAYENVRLFYDLAEESKSFSIEELY
FT                   NFINYQGERFSSFSSLDDSAVLISIHSAKGLSFPIVFLVGLCESTGYFPGRSPKLRGSY
FT                   DTSTREYRIAPFWMEKEYTRIKNISKQQEKEEGKRLFYVAITRPMAGLFLINSSLREAI
FT                   KKRGGVKSFGEEVGLNYILAKAEEIGIEKEVVEIKDTEEDLSNDFTCKQKNTIESTLPL
FT                   MILPDEFENRFKFLSPSHIMDFKRCPAMFSLKYIMGLPVFDELSSKEEIQQNAKVLGTT
FT                   VHRVLELTSLKDIKSLDTNIALAVLENDFESEKIVRELILNFFESQFVKEIKDKVIKEE
FT                   SEIRFYFKLGNQMIYGIIDKVYHLEDKIFLVDFKTNLHFDDTKFNIYIPQLFIYTMAMK
FT                   ERFPQKNIFSSIFWLREGRKFDYELKEEHLEDVMDVIRRIRSIKSRKDVLAIIEDCVKK
FT                   DCCGCEYEFYCKDEQNIKLIRKKLE"
FT   gene            354672..355367
FT                   /locus_tag="COB47_0293"
FT   CDS_pept        354672..355367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0293"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: csc:Csac_1169 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41640"
FT                   /db_xref="GOA:D9TI08"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI08"
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /protein_id="ADL41640.1"
FT                   /translation="MLVDFMKISTVDYPKKIAATCFFGGCNFSCPFCYNSQLVNFKGEF
FT                   MDDNIFFEYLDKRKGIVDAVCITGGEPTLNEEYLTEFIKKIKNRSLLVKLDTNGSRPEV
FT                   LQRLLDAGLLDYVAMDVKAPLEKYPQITGFSDVDKIRRSIEILKNSNIDYEFRTTVNKH
FT                   LHTVEDILNIARLLKDAKLYVIKPYKYTPEVLNEKISGTEDLEIEYLQEIYNRAKQEGI
FT                   DNIKIGGKV"
FT   gene            355443..356678
FT                   /locus_tag="COB47_0294"
FT   CDS_pept        355443..356678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0294"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ate:Athe_0342 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41641"
FT                   /db_xref="GOA:D9TI09"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI09"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL41641.1"
FT                   /translation="MVLAFKEINPNAKKILFFEPIFTIPYAMYIIYSSLYMTRVGVKDY
FT                   QIGLLSTVLNLVMLITSPFAGLLVNRFGRKKVLLIGDFLSWCVYAYIFFFAKDFTWFLI
FT                   ATIFNGLMRIPELAWRLLLMEDATENERVAIYSVTVFVWNMGNLFAPVMGVLVARFGLI
FT                   PATKWTVLAFGILVNILIVVRHLVTSESSVGQKLAQENSDSNNNGFSEWFDSLKYMFRN
FT                   RQLLLIVLVTIFGNVALIFRDTYKNIYLSEALHYPDSIISVFPTLWSTVALIFVIFLIP
FT                   NLKEQKHDSVLFWGMLSITVSNALILVAPPGTFGFILMIIVTVLGSIGAAVYYSFVDAI
FT                   LANSVDDSRRAHVLSITMFLISLFSMPVGAIAGQCYTFSKSLPFVLATIFTLLCTVLIF
FT                   FKVRIKRAQERQ"
FT   gene            356785..357768
FT                   /locus_tag="COB47_0295"
FT   CDS_pept        356785..357768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0295"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: csc:Csac_1171 alanine racemase; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41642"
FT                   /db_xref="GOA:D9TI10"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI10"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL41642.1"
FT                   /translation="MPTVKDVAKRAGVSVATVSRVLNNSEKVSEQTRQKVLKAIEELGF
FT                   KPNLLARNFRKDKSNLILVILPTIANAYFARVVKGIEDTARKNGYGILLCTTQNSPEIA
FT                   AEYLKLIERKQVDGAIIASAKIEIDFCKELDTKRIVQACEFYPFLDTSFVTIDHKRAFY
FT                   DVVDYLIKKGKKNILCAIGNEEIPSEFERKEGYRKALEENGLEFREENVIRCSYGWAEL
FT                   YEKLKNLCCLKKYDAIACSSDLMAVGAIKAAKALGLKVPDEFSVTGFDNIMMSRLYEPS
FT                   ITTVAQPMYSIGEKAAQILIDTLETPGTLKQQRIILPHELKTRESA"
FT   gene            357863..358906
FT                   /locus_tag="COB47_0296"
FT   CDS_pept        357863..358906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0296"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: ate:Athe_0344 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41643"
FT                   /db_xref="GOA:D9TI11"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR008354"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI11"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADL41643.1"
FT                   /translation="MTKVRLAIIGCGSITKHRHAPEAKQNPNVELVAVCDRNLDHAKAI
FT                   AEKFKVGNVYDDYEKMLKEIKPDAVIVATPNYLHADATIKALKEGAHVLCEKPMATTED
FT                   ECRMMVETAKETGRFLMIAHNQRFNSAHKKAKEIIQSGELGKVLSFKTTFGHGGPESWS
FT                   SDKPDTWFFHKDLAVFGAMGDLGVHKIDLMRFLLGEEFVEAAAFVTTLSKKYPNGQLID
FT                   VDDNAVCILKTQSGAIGTLTASWTYPGSEDNSTVIYCEKGSITLYADPKFSMIIRYANG
FT                   QKAYFELDTMQTNERQTKSGVVDEFIDCILTNTPPKISGEEGLKTMKVVFACFESAKTG
FT                   KIVRIDY"
FT   gene            358952..359890
FT                   /locus_tag="COB47_0297"
FT   CDS_pept        358952..359890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0297"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; AP endonuclease 2 domain protein; KEGG:
FT                   ate:Athe_0345 xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41644"
FT                   /db_xref="GOA:D9TI12"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI12"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADL41644.1"
FT                   /translation="MKLGFLTACLPKQSLENLVVWAKSVGFEMLEVACWPVKNTRDYSS
FT                   TTLDVVRLTRDEAERIKKLFEQNNMQISSLAYYDNNLHPDLVIRKSYHDHLKKVIDAAN
FT                   LLGVKYVGTFVGRNYNKTIKENFDEFEIVFKEILEYAKEKGVSIIIENCPMPGWNSNGG
FT                   WTGTISYSPELWEEMFSRLPYDNFGLNLDPSHLIWLGIDPVSVIKEFKDKIFHVHAKDT
FT                   QILKDKLNKYSIFGSQIQRKDEWDMGYWVYRMPGRGEIDWKAFLKELKQNGYSFVVSIE
FT                   HEDPEYEGTEEKVKEGLRLGFEYLKDVITKI"
FT   gene            360088..367598
FT                   /pseudo
FT                   /locus_tag="COB47_0298"
FT   gene            complement(364948..366177)
FT                   /locus_tag="COB47_0299"
FT   CDS_pept        complement(364948..366177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0299"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: tit:Thit_2342
FT                   transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41645"
FT                   /db_xref="GOA:D9TI13"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI13"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADL41645.1"
FT                   /translation="MNKNEIYETAKNMAVEQVLNMYCSKDDPNRPALKQLLENLLDCFM
FT                   LSERAVYLAKNDNDKGNGFYDRKLATPVGSLEISVPRTRTGNFRPSILPDRYKRVDSSY
FT                   TDLLMSLVVNGYSESSLVQTLKALNLPYSENEILKIKEDLKNELQLFKQRELPTSTFAL
FT                   IIDGYHCEVKDNSKVKQATCYVVLGIDLEGKKDIFGIYTFFGKENKADWMKVFDDLITR
FT                   GLKEVLIVISDDFPGIIDAVKLAYPLADHQLCFVHLQRNVRKHMTKEDASAFNKSLDRL
FT                   RISSSDFDEAVLKFKELCNGYLSKYPRFIKAISEKAEFYLAHMKYPEELRKHIYTTNAV
FT                   ESVNSMIEKIRVNSGGYFQSVEVLEINIYLQRENLRRTKWKNGVPSIRKCINNITQLYN
FT                   LRYKLETQNS"
FT   gene            368109..369023
FT                   /locus_tag="COB47_0300"
FT   CDS_pept        368109..369023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41646"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI14"
FT                   /inference="similar to AA sequence:KEGG:Athe_0354"
FT                   /protein_id="ADL41646.1"
FT                   /translation="MSWIDMGVRCETIKFEGSQGFFIRLIKGQKKFEILESGYPYSVLF
FT                   CATENRKRLMEMLETEDPVVLEEELYMYIGRNTGYVNWLIRDSYPDSVDKIHYIIPTKN
FT                   YVIEFISNFVPPEIIYPFCKKMTEIDEEKLIEGLELTDMSWEYDKEEYIEFVDDKFLEK
FT                   MDISKGLFIGDLIYKEGKLVILLDQGIRKNEEGKYYMGEQFVVKFESGIEAVRFADEGR
FT                   RLLLWLIFWDIKKYKFKNGYFLKVENSEFIRWLEKERGKKFEEEVNHYCFLSDMLVVDV
FT                   VSKCEPTIEKLKRNNSEISNRDN"
FT   gene            369355..370215
FT                   /locus_tag="COB47_0301"
FT   CDS_pept        369355..370215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41647"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI15"
FT                   /inference="similar to AA sequence:KEGG:Athe_0355"
FT                   /protein_id="ADL41647.1"
FT                   /translation="MKWLDNEVRFSAFKFEYGKGILMTLIYEKNKFEIWASLPYSILYC
FT                   ATQNRKRLIEILESKASNKCKKDLSMYVGRNTGYINWLIQESYPFPDDIEHWIIPTSNY
FT                   VLEYLGSSLDVIDPLNKSIIEVDIEKVIEGLELTDMSWEYVKEEYKEFIDSKYLQEISL
FT                   EKVIYDEGGVSILLNGELRKNKHGKNYKDKILITFNDSIEALRITETGRRLLLDVMFLN
FT                   TKKYEPERKCFFKVKNSEFIRWLEKEGRGKFKENIFHYCFITSNMIVDAISRHSPKIEK
FT                   LREYK"
FT   gene            370288..370419
FT                   /locus_tag="COB47_0302"
FT   CDS_pept        370288..370419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41648"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI16"
FT                   /inference="similar to AA sequence:KEGG:Athe_0356"
FT                   /protein_id="ADL41648.1"
FT                   /translation="MYGNSDMLELRAEDSRSNRWIIAKEFRVFQGHSSWYNKRCNKT"
FT   gene            370826..371053
FT                   /locus_tag="COB47_0303"
FT   CDS_pept        370826..371053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: emi:Emin_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41649"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI17"
FT                   /inference="similar to AA sequence:KEGG:Emin_0461"
FT                   /protein_id="ADL41649.1"
FT                   /translation="MEQCQIKKSGFDARLIHNTKNVIAIDKEIHRKISGYYSSKKEFTK
FT                   DKTVREWLAGQSYEFQYGDLSRILCFQFIT"
FT   gene            complement(371021..372262)
FT                   /pseudo
FT                   /locus_tag="COB47_0304"
FT   gene            372382..372735
FT                   /locus_tag="COB47_0305"
FT   CDS_pept        372382..372735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: emi:Emin_0462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41650"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018568"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI18"
FT                   /inference="similar to AA sequence:KEGG:Emin_0462"
FT                   /protein_id="ADL41650.1"
FT                   /translation="MIDVKKLIEEYRNAAILQKEASRDGDYKTANKQYSKLIRIYKILE
FT                   KDKDLREKVLKELLKDENICVSSWAAAHCLRLNIYVDEAVKLLEEIAKREDIGIWRFDA
FT                   EMTLKVWREEGKL"
FT   gene            373289..373794
FT                   /pseudo
FT                   /locus_tag="COB47_0306"
FT   gene            374118..376322
FT                   /locus_tag="COB47_0307"
FT   CDS_pept        374118..376322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0307"
FT                   /product="ABC-type bacteriocin transporter"
FT                   /note="TIGRFAM: ABC-type bacteriocin transporter; PFAM: ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   ABC transporter transmembrane region; KEGG: ate:Athe_0327
FT                   ABC-type bacteriocin transporter; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41651"
FT                   /db_xref="GOA:D9TI19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI19"
FT                   /inference="protein motif:TFAM:TIGR01193"
FT                   /protein_id="ADL41651.1"
FT                   /translation="MKRRYYCVKQHDITDCAAASIATICLQYGKEVSIAKIREIAGTDR
FT                   FGTTAYGVVKAAKELGFEAKAVRAETKEAIFEKIPLPCIAHVLVDGKLFHYVVIHEIRK
FT                   ESIVIADPAKGIVKLKPEEFFKIWTGILILLVPNERFKKGKQEGVLKKFFKLLAPQKSL
FT                   LLNIFAVSIVYTLLGIAAAFYYKFLMDDVIPNLLKNTLHVIAAGTILITVFKVILGAFR
FT                   VRLLIHLSQRLDIKLMLGYYEHVIKLPMSFFGSRKIGEIISRFMDASKIRDAVSGATLT
FT                   LMIDSIMALAGASILYLQNSTLFFIAFVMVLLYAAVVFGFNRVLREANRQEMEDNAILT
FT                   SYLVESLNGIEVVKAFNIEEDVSFKTESKFVKLLKDVFKVANLNNLQSNISAAIAGIGV
FT                   IVLLWAGANNVINGQMSIGELFTFNALLAYFVDPIKNLIGLQPMLQTAIVAAERLSEIL
FT                   ELESEFKEDEDKKLAPSLKGDIEIEGLNFRYGARQLVLRDINLKIRSGEKIAIVGESGS
FT                   GKTTLAKLLLGFYDYESGEIRINGYNIKDINKRHLREKIAYISQDIFLFSGTIFENLVL
FT                   DNRNIKMEDVIEISRLTTLDEFVSKLPLRYNTMIEENGANLSGGQKQLIAITRALLKRP
FT                   EIVIMDEATSNLDSVTEQAIGKVIEKVCEGITTIIIAHRLSTILKCDRVVVMHEGRIVE
FT                   VGTHEELMRKKGYYYNLWREQLIGLEQKGLWDLVGSAAGK"
FT   gene            376319..377713
FT                   /locus_tag="COB47_0308"
FT   CDS_pept        376319..377713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0308"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ate:Athe_0252 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41652"
FT                   /db_xref="GOA:D9TI20"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI20"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADL41652.1"
FT                   /translation="MREVIYDFGELKESKLLYESEISKYGLYITYILLALVIGLVLWSI
FT                   VGKIDINVKVQGIIRPWEDEAKVISYVGGKVKEVFVKEGEYVKKGDVLFKIDDEEYIKK
FT                   RDLLRQQLSEYEKKIDDLKELRNSIEKGESLKNKNTYYLRYLSYSYEIKKLKKAAEEAR
FT                   VQREYSIMDFKKQIESLDEKIKNIDKFESMLKEIKEVVNKGEQVKLTKYDIGYLGFILS
FT                   EIEDYNQQVKTKSDGSDMKKILILKIDSKLDELRQSKSELILQRQKIEGQLRLLVISGD
FT                   DIKGDIEKYKLEVLQQIDSEISSLTHEIKNLKINLEETKRLIESCSIRAEKNGYVEYSA
FT                   ELFSGAAISSGAEIGRIVDGQSKRFKVIGYIPNTKSSGIERGQRVKVKLAGTDGLKVVE
FT                   GKVTRVSRDIKVANENGQGFYEVEVEVRNVGNGINLSAGQVCEMSIVVKQERLIKWVLE
FT                   KLELRL"
FT   gene            377799..378014
FT                   /locus_tag="COB47_0309"
FT   CDS_pept        377799..378014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: min:Minf_1175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41653"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI21"
FT                   /inference="similar to AA sequence:KEGG:Minf_1175"
FT                   /protein_id="ADL41653.1"
FT                   /translation="MMETALKGYLVLNEDDELTEVNGGALPAIVIWGLGFLAGCVVEGV
FT                   VEGLTGKSISDWIAEGVRRVKEQFAH"
FT   gene            378096..379271
FT                   /locus_tag="COB47_0310"
FT   CDS_pept        378096..379271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41654"
FT                   /db_xref="GOA:D9TI22"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI22"
FT                   /inference="similar to AA sequence:KEGG:Csac_0145"
FT                   /protein_id="ADL41654.1"
FT                   /translation="MDFKKFFRLQLFRYIKSKFLFLIFVILFFLQFGGWFITYLDTDYN
FT                   RQLVFKENKLVELRSKFENAKKRNLKEVDITYYEKEIKNLESEIKELELIKKYLGKKEF
FT                   IQTKIQELKNNINLYKNNNDLKQTNQLAVELLYYERLLKEKIYKPKNFIAIENVWISNT
FT                   MGFRWMDVFFGFIIIALCIATLFGDDLKKGYIKMLFPNYRIKREKLYIYNIICEVIIFL
FT                   LIFTISVIVFSALIYVLFKRKFDIKMPYFTIYGLQTWGNSVIVSPEKTTFDSCLIGFLK
FT                   LFVVYSLITVMLITLYKMLYTILANDYFVLGVVIFLKMVNSILPKLGIERKYLLINPLT
FT                   YTDGWGIVTKSLSLDYNVLIGNSLIYIMIIVCYTLVFIIIGLIIFRKKNFY"
FT   gene            379317..379472
FT                   /locus_tag="COB47_0311"
FT   CDS_pept        379317..379472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41655"
FT                   /db_xref="GOA:D9TI23"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL41655.1"
FT                   /translation="MKVYFLYYLIILIALLLAKPAYELGKIIGKMIREKVDQKGEGRIN
FT                   ENNRSR"
FT   gene            379450..380343
FT                   /locus_tag="COB47_0312"
FT   CDS_pept        379450..380343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0312"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: csc:Csac_0164 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41656"
FT                   /db_xref="GOA:D9TI24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41656.1"
FT                   /translation="MKIIEVDNVTVKTREKIILDRISFTIEEGEVVGLIGPNGAGKSTT
FT                   LKVLFGLVIPSNGWVKINGFDVLKNPEKALKDVEGIIENPTFFPNQTGFDNLDLFGISN
FT                   GTTRNEIQKTAQFWDFNEKILKRKVKKYSSGMLQKLALTKVFSSNPKLVILDEPTNALD
FT                   PTSKIKFAQKVKEINEVQKTTFLISSHLLDEVEEICNKFIFIKEGRIILGIGENELIDN
FT                   NVYILTLDRAFEKDKISASTIFKFLIESKENQLKFKIDSQEDLNFIIKELIEKGYIIKE
FT                   VKQSKKNLREIYRELY"
FT   gene            380512..381078
FT                   /pseudo
FT                   /locus_tag="COB47_0313"
FT   gene            complement(381096..382338)
FT                   /pseudo
FT                   /locus_tag="COB47_0314"
FT   gene            complement(383095..384249)
FT                   /locus_tag="COB47_0315"
FT   CDS_pept        complement(383095..384249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0315"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ate:Athe_1984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41657"
FT                   /db_xref="GOA:D9TI25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI25"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADL41657.1"
FT                   /translation="MNIIPYHELRKISPEKARELIRKVFEANNKNISKTAKILGVSRHT
FT                   VRRAVYGPVEDKSRKPKTCPKKLSSELENLIIQEAKKTGFRYRRLSLYLFRKYGVKISE
FT                   NTIKSILKRNSVPRKTRKTKKGERSLYDYESLIPFSEFQLDTKHLLDKESLPKEVYEHM
FT                   IKYNLPCYEWNMIDVATRTRFTAYSYELSSTFGFMFITLVVLWLRTHNVRNPIRIRLDN
FT                   GAEFCGGSEKKLKEWNEMLSFLGVELNPIPPKAKHLMGIIENSHRADDEYFLMIHAERC
FT                   ITKDEFMTRAQKWQDTWNFYRPHNGKGMNGRTPFEKFRDSKILVSSHVFQFPTLLLEDL
FT                   LKKVGTFYSLFCNKLGGKYVFTTCHLQDCLYLHETYNSINKYNY"
FT   gene            384475..385719
FT                   /locus_tag="COB47_0316"
FT   CDS_pept        384475..385719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0569 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41658"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI26"
FT                   /inference="similar to AA sequence:KEGG:Maeo_0569"
FT                   /protein_id="ADL41658.1"
FT                   /translation="MWGATKRRGRGPGVYDINAGRLVGNNVDNRFVFRILRPELAKAAA
FT                   NFFSDVSEKDYYAPYVTMLTVAQAIDGYWCIRKDKKTGKVIDKRRVIRWDRQLTFEDLW
FT                   KIVSQVSRTGVSMIVGDTYENQMDNYKEAIIRKDPQLEQWAKEMQKKYKLKSLDEVYDR
FT                   YLYSPGRREALKYYKYDYSKIGRPITRFELALAFMANVDDNYMAAILSVKNPKQYPPNK
FT                   TDGHYIGASNPYTMAIYLNQGKPATRYFRKVKIDNAAIEKRLIKGTDSDKAVYGNPKYY
FT                   KYAADYLELSYKTEGVKRYVYILNYMPFSIPINYSVIEQGKKLGVFHSNYARWLDNKLQ
FT                   ALDLFKNWPNMPKEPDANWWYSPATLREAIVLYDAITAYLYNVQMTNHEAVYHDWSDYD
FT                   FKNFGEFLNYLGKGY"
FT   gene            385703..385969
FT                   /locus_tag="COB47_0317"
FT   CDS_pept        385703..385969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfu:BC1G_02581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41659"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI27"
FT                   /inference="similar to AA sequence:KEGG:BC1G_02581"
FT                   /protein_id="ADL41659.1"
FT                   /translation="MERGINSMRRIVSILLAIAMILTAIPLTVFGEQGIHVQTGGDASA
FT                   TFQVPGSGGGSGAGRSSYLQPSGTIKISLVKTILDYYKGIILY"
FT   sig_peptide     385703..385798
FT                   /locus_tag="COB47_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.992 at
FT                   residue 32"
FT   gene            386041..386583
FT                   /locus_tag="COB47_0318"
FT   CDS_pept        386041..386583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00767550 Zinc carboxypeptidase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41660"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI28"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_00767550"
FT                   /protein_id="ADL41660.1"
FT                   /translation="MFLIEGDWRSQNKVRQLIDSFKYDKDGERIIQNDDIIIKSSRKGL
FT                   LKFMDSEEGNKYRQNLLPSILSRLNNGFDIPGSIHNDLKFEANKQYTFVVVFKPIRRRV
FT                   QVVLEDKENHILCDNYLDSPACFIKDIFISSTGDIVNDAVDKYKNMYVDRVYQGTSENM
FT                   SKQIYSETCQEFCVSNL"
FT   gene            complement(386556..387798)
FT                   /pseudo
FT                   /locus_tag="COB47_0319"
FT   gene            388692..388901
FT                   /pseudo
FT                   /locus_tag="COB47_0320"
FT   gene            complement(389103..389557)
FT                   /pseudo
FT                   /locus_tag="COB47_0321"
FT   gene            complement(389760..390494)
FT                   /locus_tag="COB47_0322"
FT   CDS_pept        complement(389760..390494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0322"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cpy:Cphy_3619 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41661"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI29"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL41661.1"
FT                   /translation="MVNVKGKWALITGASRGVGYQIATFMAKMGCNLILHGRKLEHLKK
FT                   ISEEVKKFGIETYCVQAEFSEPTQVVTMLDEIESTGIAVDIVFNNAGLQVAYRKDFWKT
FT                   PIEDFEISFRVNFISAALICYRLIPPMIERGFGRVVNVTSGIKNEPEQAAYSASKAALD
FT                   KFTKDLSSKLDGTNVMINLADPGWCRTDLGGPNAPNPVESVIPGIVVGAFIDDKKSGRL
FT                   FPAQAFTGLTLEEAVAKAEKMS"
FT   gene            390688..392088
FT                   /locus_tag="COB47_0323"
FT   CDS_pept        390688..392088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0323"
FT                   /product="AMMECR1 domain protein"
FT                   /note="KEGG: ate:Athe_0359 AMMECR1 domain protein; manually
FT                   curated; PFAM: AMMECR1 domain protein; Extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41662"
FT                   /db_xref="GOA:D9TI30"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI30"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ADL41662.1"
FT                   /translation="MVGYLLPHPPVLIPEIGRGEEKKCQATLNALEKVADEIAEYKPEV
FT                   IAIISPHAPVFSNAFFLNDKPEITGDLAKWGVYGAKFSFKNNLEIVQEIAKMCAQEGLA
FT                   VAFVSDKLQKRYSVSRELDHGALVPLYFITRRYKDFELIHTSYCMLDDINLYKYGMILR
FT                   KAIEKQGKKGLIVASGDLSHKLSYDGPYGFAKEGPEFDRLLVELLQGSNIRALYDIDPV
FT                   LSENAAECGFRSIKVLLGAFEGYSIESKVYSYEGPFGVGYCVAAFYQKGEASSSLLEEI
FT                   VQKKEERLKRIRENEDEYIRLARESLEYYVRHRRYLDYIPDYVTERMLKERAGVFVSIK
FT                   KDGNLRGCIGTIFPTQENIAKEIIRNAVAAGFYDPRFEEVTEDELDSLVYDVDILSPPE
FT                   KVSSKDQLDPKKYGVIVRKGTRQGLLLPDLEGVDTVEEQLKIACRKAGIDYESEDFEIE
FT                   RFTVERHK"
FT   gene            392103..392951
FT                   /locus_tag="COB47_0324"
FT   CDS_pept        392103..392951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0324"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ate:Athe_0360 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41663"
FT                   /db_xref="GOA:D9TI31"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI31"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL41663.1"
FT                   /translation="MVEARYYEKLEGKKVRCKLCPHGCILPQGSTGFCRARKNVDGILY
FT                   SLNYGYISSIAFDPIEKKPLYHFYPGSTILSIGTFGCSFKCLHCQNFEISQLSPNVFEV
FT                   ETEKLIALAKKDPKCIGIAFTYNEPTIWFEYVMDVAKAFKQEGLKTVLVTNGYLNEEPL
FT                   YELLEIIDSANIDVKAFNDEFYKKVCGGDLEPVKRFVEICAEKIHIEITTLIIPTLNDR
FT                   DEEIESLAKWIASMDDRIPLHLTRYFPRYKMTLPPTPKETLMRLREVAKKYLVNVYLGN
FT                   I"
FT   gene            392973..393830
FT                   /locus_tag="COB47_0325"
FT   CDS_pept        392973..393830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0325"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   ate:Athe_0361 protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41664"
FT                   /db_xref="GOA:D9TI32"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI32"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADL41664.1"
FT                   /translation="MLKDFSFYLQEFLRNVTLIRISPFDIIDIAIVSFVIYKIIVWIKD
FT                   TRAYQLIKGIAVLIVITQVSKWLNLNVINWLLTNTLSYGVLALLIVFQPELRRALEEIG
FT                   RSKIWGKFLWFGPDEKMAIKWQNSVEEIIKAVMYLSKNKIGALIVVEGQTKIGDIINTG
FT                   IIIDSEISSQLLINIFIPNTPLHDGAVIIRDGKIKAAACFLPLSENRYISKELGTRHRA
FT                   ALGISENSDATAIVVSEETGIISVAYNGGLTRNLGPEALRKILLRPLKQEEGKNGLSIF
FT                   KWRR"
FT   gene            393834..395072
FT                   /locus_tag="COB47_0326"
FT   CDS_pept        393834..395072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0326"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: ate:Athe_0362 YbbR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41665"
FT                   /db_xref="GOA:D9TI33"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI33"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADL41665.1"
FT                   /translation="MKKIAIKRPKDGNFWLRVVSILIAIVLWFYVNSIINPIKKREIII
FT                   PIRYNVATLSKGLVMTEADAKEVRIVISGTQDELSKVDEKNIQAMVDFSDIRQTGEVKL
FT                   PVAIQNPYHRINIESVYPRNVTVSIDNLVTIQKDVTVEINGNPKKGYIINNYQEEPNVI
FT                   SIKGAESDIKEISECVAQLNLSLNDRSFKASVPVKVIDSRGKDITSLFELSQKSIDVYV
FT                   EILKTKQVPLSVKFKGSLPPSKVISKIILKPSTINIAGKEEDINSINEIVVGTIDTKML
FT                   DNVSTFQFDFSLPKNIKSLDNVKQVTIIIYTDSIVEKSINIPIEVRGLSPGLLAKLSPD
FT                   KVKVELKYYQSAQNSVDFNSLKAYVDVSNLTKGSYDLQVLVEKPENIKEFEVFPTYIKV
FT                   EISENNQTKTQSQ"
FT   gene            395107..396888
FT                   /locus_tag="COB47_0327"
FT   CDS_pept        395107..396888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0327"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   ate:Athe_0363 excinuclease ABC, C subunit; SMART:
FT                   Excinuclease ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41666"
FT                   /db_xref="GOA:D9TI34"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI34"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ADL41666.1"
FT                   /translation="MLLEEKLSNLPTSPGVYIMKDENGNVIYVGKAVNLRNRVRQYFQN
FT                   SSDMLPKTRLMVKKIKDLDYIVTDNEIEALILECNLIKEYRPKYNVLLRDDKNYQYIKI
FT                   TNEMFPRLVTTRKIEKDGSRYFGPYVSGYSVKQTVELLKSLFMLRTCKKKFPDQLGKGR
FT                   PCLNFYIEKCLGVCKGDVAEEEYQRLVEGAIKVLSGKGDEIVQELKAKMFEYAENLMFE
FT                   KAQEIKNKLSSLEQIITKQKVIYADDRSEDVINFAKDHTHIAIVVLIIRNGKLINKEEF
FT                   VLKADEDTFERFLEQYYSDVVSLPKEIIIPHTIENADNIEKMIEKLYGFKVKVTVPKQG
FT                   EKKQLLDMAKKNAEISLANRQRVGDVYAEALLTLKNLLGLENEIEKIESYDISNIAGAD
FT                   NVGTLIVFEDGRFNKEFYRKFKIKGFEGQDDIKSVKEVLTRRFTSLEKHGRIPDLILID
FT                   GGQNQVNAALEVLNTLGFSIPVAGMVKDDRHKTRDLIYNGKEVGIQEYPLVYKLIYAIQ
FT                   EETHRFAVKFHREVRKKHLYESILDEIEGIGEKRKLKLFRTFGSIDNLRKASIEEIVKA
FT                   ADIPYEVALKIKEKIGV"
FT   gene            396903..397865
FT                   /locus_tag="COB47_0328"
FT   CDS_pept        396903..397865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0328"
FT                   /product="HPr kinase"
FT                   /note="KEGG: ate:Athe_0364 HPr kinase; TIGRFAM: HPr(Ser)
FT                   kinase/phosphatase; PFAM: HPr serine kinase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41667"
FT                   /db_xref="GOA:D9TI35"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI35"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ADL41667.1"
FT                   /translation="MQEGCDYRLFYTTVGKMLKELNLESLTEISGLEERKIKDMNLNRP
FT                   ALQLMGFFEYFDEQRIQIIGISEMAYLKTMTPTQRRDAIERLFQRNIPCVIITSNQQPF
FT                   EEFLEFSKKYGVPLLRTQEVTTRFMTNLSTFLTHELAPRITRHGTLVNVYGEGVLMLGE
FT                   SGVGKSETALELVKRGHILVADDAVEIRKVSEKTLVGEAPEIIRHLIEIRGIGILDVKN
FT                   LFGVGCVKESERIDLVIQLETWKQGKEYERLGLHDQYIEILGIKVPTLVIPVRPGRNLA
FT                   IIVEVAAMNNRQKKMGYNAAKALTERLQRQMSRGNETVE"
FT   gene            398092..400197
FT                   /locus_tag="COB47_0329"
FT   CDS_pept        398092..400197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0329"
FT                   /product="MmpL domain-containing protein"
FT                   /note="KEGG: csc:Csac_0246 MmpL domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41668"
FT                   /db_xref="GOA:D9TI36"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI36"
FT                   /inference="similar to AA sequence:KEGG:Csac_0246"
FT                   /protein_id="ADL41668.1"
FT                   /translation="MHKFGLFIAKHRKLVLVIAVLLLIPSVYGFITTKINYDILTYLPK
FT                   DLDSTKGQEILDKDFKQAAISMLIVKGKMNISDIQKMKEKISKVNGVEKVIWIDDFLDP
FT                   TIPKDMLPEVLRTTFYSKDSTLLLIQFSNSAASIETQNAISEIRKIATKQCFLSGMSAI
FT                   IKDTRDLSDRETPLYVAIAVLFIFILLILTMESPVIPILFLLSIGMAIIYNLGTNKFLG
FT                   QISYITKALAAVLQLGVTMDFSIFLMHRYDEERKRFESKEEAMAEAISKTLVAILSSAA
FT                   TAIAGFLALCAMRLRIGADIGIVMAKGVFLGVLGTITILPALILEFDNAIHKYRLKNIL
FT                   PTFSHTANFVSKNYVILFIIFLIAFIPAIYGRNNLKVYYNLIDSLPKTMKSVEATDLLK
FT                   KEYNMITTHMILVDRSLPGYKIKSMCEEIKNVKGVEKVLAFDEVLGPAIPKNFIPQELK
FT                   DNFEKGKYKLIMVNSAYKAATQEENQQIEMIQHIVKKYSKNSYVTGEGVLTKDMIEMAD
FT                   IDLKRVDFISILAIFIIILITFKSISIPVILVSAIELAILINLSIPYYTKTVVPFIASI
FT                   VLGTIQLGSAINYAILMTTRFREEIRKGLDRFEAIRVAVKTSSRSVVTSALAFAFSTLA
FT                   VAIIAKIDMIRSLCEMLSRGAVISMIVILFILPSLLLLFEGVIAKTTFSWGTKKASIKP
FT                   EEEYETL"
FT   gene            400229..402427
FT                   /locus_tag="COB47_0330"
FT   CDS_pept        400229..402427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41669"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI37"
FT                   /inference="similar to AA sequence:KEGG:Csac_0247"
FT                   /protein_id="ADL41669.1"
FT                   /translation="MMRNIRFLKLISLCVATVFLLTNVAFAGEAVKKETVYVILDATGK
FT                   VKSQIVTDWIHSDTPNSTIKDKSELENIVNLKGDESPQKDGKYITWKLNTNDLFYQGTI
FT                   SKQLPFIVSIKYYLNGKEIEPQYLAGRSGKVKIKIEVENKQHKIVKINGKNKTIYLPLT
FT                   FAAVVNLPLDKFENVKTNVGEVITEGNTQAVVSVLLPGLLESLGMKSENDIVDIPKYIE
FT                   ITAACKYFELSPIYMVATNKLLDIKDIKEIDSIDSLQKAINTLYTSSEKILEGAVKLSG
FT                   GEKEFTLNFEKFTNGLKLLSDASGQLCKGIESLEDGTNKLYTSSKQLKIGTGELNKNSQ
FT                   KLYKGVAEFGDGVYKYTYATSQFSDGAIKIVDGYELLFAKNQELFEAVKKVSSGLDLAT
FT                   SSQKDLVAGAKKLEDAIQNLLEGNKKELEVLNIVYNGFDAIISGLQKLESIPVVKDVVS
FT                   NLIAGIDKQRQAIKGLIDSKQAMINGLSQILDNLKKMSQGQEKLSIALMQLKDAQAKIA
FT                   NSSDLIVQNQKLLKQSATKLKDSKNILDEGAKKLLNSKDQLVNGTKSFCEGIEKLDSAT
FT                   AQFVSGTEKLNEGAKQLSGGMMEFDKNIKMVYSASGKLLEGSKKLEDGAESLSINYHKF
FT                   HNEGIQKLYSKADETIEKLNDIKDTLNELKEFSQSYKTFSGISDELDGEVKFILKTDEI
FT                   KAKEEKQVLKEIKTVSLQNNEKKSFWKWLLGLLHIKVE"
FT   sig_peptide     400229..400312
FT                   /locus_tag="COB47_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            402521..403303
FT                   /locus_tag="COB47_0331"
FT   CDS_pept        402521..403303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0331"
FT                   /product="protein of unknown function UCP033101"
FT                   /note="PFAM: protein of unknown function UCP033101; KEGG:
FT                   ate:Athe_0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41670"
FT                   /db_xref="GOA:D9TI38"
FT                   /db_xref="InterPro:IPR011397"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI38"
FT                   /inference="protein motif:PFAM:PF10086"
FT                   /protein_id="ADL41670.1"
FT                   /translation="MISNLKIIFMCITLIISVFFPFVLAVIVLKKYSGVLKSILIGALI
FT                   FFISQIVLRMPIIQILSKQNYFIEFSKHYILYSLFLGMTAGIFEEIGRYIGFRGFLKDR
FT                   LNYQNGIAYGIGHGGIESVLIVGITYINNIVYSFLINAGILDSLLKGKVGAGVVGTIKS
FT                   ALINTPDSAFLFAGFERIFTMAIQIALSLLVLVAVKKRKLYYLLLAILLHTIIDAPVAY
FT                   MSLLKVNIFVLEFVVLLWAVLSLVYIIKWQDIHRIQEN"
FT   sig_peptide     402521..402598
FT                   /locus_tag="COB47_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            403320..403706
FT                   /locus_tag="COB47_0332"
FT   CDS_pept        403320..403706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0332"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_0366 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41671"
FT                   /db_xref="GOA:D9TI39"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI39"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL41671.1"
FT                   /translation="MFIKIDFTSDIPIYEQIKNQIIEAVARGELQNGDSLPSIRDLASE
FT                   IGVNMHTVAKAYNELKYMGLIAINKKHGAYIAVSKNYDKEFLNEIIKEVTPIVAKAICK
FT                   GMNKYELIRLIETIFDDFGGKKDA"
FT   gene            403699..404832
FT                   /locus_tag="COB47_0333"
FT   CDS_pept        403699..404832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0333"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   cbh:CLC_1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41672"
FT                   /db_xref="GOA:D9TI40"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI40"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ADL41672.1"
FT                   /translation="MHEKLLIFILSFPAQIFLVLLCFFIPYFSREHILFGVNVPPTIKK
FT                   SEVTKKFYKEYWKNFALTVLIPTLLFFYILFESTERVLIKYNILYPLFVIVLMTLNHYV
FT                   IYRKVLKAKKKGNWQEGKKQIVVVPIKKDKKGGYPSRLWFLVPIGVFIGLLIITVVRYN
FT                   QLPKIIPLHYNLKLEVDYIGPKSELIKPLSVMFGSMLLAQGLGYFVYELTKKGKMKLSI
FT                   YFPEKSAEQNEKVKSYTAYFLIWILVLIELIMGLVIFSMLDIINIQTTLALLPVFLIFP
FT                   LITLGYYLMKVFNINSERLNLMPEEKISEKIIDRDDDKYWIAGMFYYNPDDPALFVERR
FT                   VGGFGWDLNYAKPLGKFIGFLIIGILVAVVVVSLVLI"
FT   gene            404933..405895
FT                   /locus_tag="COB47_0334"
FT   CDS_pept        404933..405895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41673"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI41"
FT                   /inference="similar to AA sequence:KEGG:Athe_0367"
FT                   /protein_id="ADL41673.1"
FT                   /translation="MDNENKEKLPAKEHDSTFKLLFENPKDVYLLVSKIINYSWANEIR
FT                   ESSIEIKKTNYITKEFSQVEADVVAKARLKDRDIYFYILIENQSTIAKDMPERLLRYMI
FT                   SIWAEEIRNGVEKLPAIIPIVVYNGLDRRWEVPTDIVGAFDIFKDDIFKYKVVDIAQVD
FT                   IKNYLEEEDVLTPIIFYLEQVRNDSNELICRLQEIAQSLMKLSFNNIERFLLWSQHVIR
FT                   PRLGEKQKKEYDKIVERVKQKGVEVMGEFVSNVARLLDETKTKEFLAGIQQGIQQGIQQ
FT                   ERIETAKRMIQLGISYEVISKATNLSIEEIEKIAREQIN"
FT   misc_binding    405984..406109
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 61.35"
FT   gene            406252..406443
FT                   /locus_tag="COB47_0335"
FT   CDS_pept        406252..406443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0335"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="KEGG: ate:Athe_0368 thiamine biosynthesis protein
FT                   ThiS; TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41674"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI42"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ADL41674.1"
FT                   /translation="MIRVNDKEMEFCGNVLELLLSLNLNPQVCAVLVNGEIVKKKLWEN
FT                   LLLKDGDYVEIVSFVGGG"
FT   gene            406497..407261
FT                   /locus_tag="COB47_0336"
FT   CDS_pept        406497..407261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0336"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   ate:Athe_0369 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41675"
FT                   /db_xref="GOA:D9TI43"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI43"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ADL41675.1"
FT                   /translation="MFEVGGKTLKSRLFVGTGKLPDYSLIEKMYYEAGVEVFAVAVRRI
FT                   GPNTKHTKNVLEYIPKDAIIMVNTSGAQDHKEAVKIAMIGRELTNSNWVKVEIEKDTKY
FT                   LFPDSIETLKACEILVKEGFKVFPYIYPDLNLAKELEQIGVEAVMPLGSPIGTNKGIGC
FT                   EVLLKPIINEIKIPVIIDAGIGRPSHAAKAMEMGADAVLINTAIATSSDPVKMALAFSK
FT                   AVEAGRLAFEVGLLKEYEYAQASSPLEDFITG"
FT   gene            407311..408420
FT                   /locus_tag="COB47_0337"
FT   CDS_pept        407311..408420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0337"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="KEGG: ate:Athe_0370 biotin and thiamin synthesis
FT                   associated; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41676"
FT                   /db_xref="GOA:D9TI44"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI44"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ADL41676.1"
FT                   /translation="MTEFIRKAQKVWEEFKDYVPTYDEVCEILEKEVVSIEDVAKLLNV
FT                   EDKNSILLMASKAKKLTRENFGKVILLYAPLYISNYCQNGCVYCGFSCRKNYKREKLDL
FT                   DEIENELRSMKEEGIDSVIILTGEDRIHSPVDYIKQACKIAANYMSEVSIEVYPLFEEE
FT                   YRSLANAGVVGITIYQETYQKEDYEKLHPFGPKKDFEFRLTTVERALLAGFHEACVGPL
FT                   LGLSHPKKDVLCTLLHAEYLLDKFPKTEISVSFPRVRSAGTDFVPKFFVSDKEFIKFLI
FT                   VARIYLPRVGIVISTREDARLRDALIDVCITKMSAGSKTTVGGYATQEERDAQFEIEDR
FT                   RSVAEVVDSIIRKGLRPEFTNWVRGVNSL"
FT   gene            408417..409028
FT                   /locus_tag="COB47_0338"
FT   CDS_pept        408417..409028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0338"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="KEGG: ate:Athe_0371 thiamine biosynthesis protein
FT                   ThiF; TIGRFAM: thiamine biosynthesis protein ThiF; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41677"
FT                   /db_xref="GOA:D9TI45"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI45"
FT                   /inference="protein motif:TFAM:TIGR02354"
FT                   /protein_id="ADL41677.1"
FT                   /translation="MSLFDLMLRNYFDEKMLEKLSKVKILIIGCGGLGSNIAVLLVRCG
FT                   VKNLTIVDFDKVDISNLNRQNYFFYQVGEDKTSALKDILSKINPYVIVKAVNMKVDESN
FT                   IDSLILEHDIIVEAVDNELTKVLIFRKAHEHGKKVVLASGIAGFGDCENIKIKRGKNFS
FT                   IVGDFVTSIKDKKPLAPKVVAVAAMQADEVLRMVSELEFD"
FT   gene            409021..409680
FT                   /locus_tag="COB47_0339"
FT   CDS_pept        409021..409680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0339"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /note="KEGG: ate:Athe_0372 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41678"
FT                   /db_xref="GOA:D9TI46"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI46"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADL41678.1"
FT                   /translation="MTKEEKLELFSIYTIYGMTAEKFSNGRSNIEVVKAMLDSGIKIIQ
FT                   YREKYKSLKEKYKECLEIRKLTEDYGALLIVNDHVDLCQMVGADGVHLGQEDLPADEVR
FT                   KLLGDKFIIGVTTHTKDQVLKAKEDGADYVGLGPIFASFTKDNPHPPIGLEMVRWAAEN
FT                   SPLPFVAIGGIKEHNLKDVLANGARCICAVTEIVGADDIRKKIESLFKILRSFERS"
FT   gene            409687..410949
FT                   /locus_tag="COB47_0340"
FT   CDS_pept        409687..410949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0340"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="KEGG: ate:Athe_0373 thiamine biosynthesis protein
FT                   ThiC; TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41679"
FT                   /db_xref="GOA:D9TI47"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI47"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADL41679.1"
FT                   /translation="MTQMSLAKQGIFTREMELAIKNEEISKKEFLQKVAEGKIVIPANR
FT                   NRKREKYFAIGEGTYVKINVNLGVSEACPNFDLERQKLELAKKFDVESVMDLSSGLDAS
FT                   NFRKYILQNYDFIVGTVPVYQVASRHDDITKVDSKEFIEEIERQAEEGVDFFTIHAGIT
FT                   RKALERLEKNERLLKIVSRGGALLYKWMMTNRKENPLYEHFDEILKICKKHDVTISLGD
FT                   SLRPGAVYDATDALQIEELINLGELTKMAWKEDVQVMIEGPGHMRANEIAANMVIQKRL
FT                   CHGAPFYVLGPLTTDIAAGYDHISGAMGALIAALNGADFLCYVTPAEHLRLPSLEDVKE
FT                   GIVAFKIAAHSANIAKGFKKPLEKDIEMSVARRDLDWEKMISISVDPEKAREYRSSFTS
FT                   ETCSMCGRLCAVKNSRDETIL"
FT   gene            410994..411773
FT                   /locus_tag="COB47_0341"
FT   CDS_pept        410994..411773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0341"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; KEGG:
FT                   ate:Athe_0381 phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41680"
FT                   /db_xref="GOA:D9TI48"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI48"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADL41680.1"
FT                   /translation="MKKVLIIAGFDPSGGAGVLLDIKVVRALNGYAASVVTSLTVQDTQ
FT                   RVYDLKPIDPHFFEYQLQKVVEDIKPDSVKIGLLGSSEIAVVLLRNLKKYSLKNIVCDP
FT                   VLKSTSGFEFCKSEFVEFLKYDFFKACDVITPNKNEAELIFDVEIKNFDEDVLSCVQER
FT                   MKRMGIKSCILKGGHLDGELAEDVLITQNEIYRVSAIKKGLPDEIHGTGCAFSSAFATF
FT                   LAKGYNMYDALKQTKDFMIGLINASVKIGNGRLVLNP"
FT   gene            411829..412902
FT                   /locus_tag="COB47_0342"
FT   CDS_pept        411829..412902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0342"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: queuine tRNA-ribosyltransferase;
FT                   tRNA-guanine transglycosylase, various specificities; KEGG:
FT                   csc:Csac_0257 queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41681"
FT                   /db_xref="GOA:D9TI49"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI49"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ADL41681.1"
FT                   /translation="MAIKFELIKKSKKSNARRGRLYTPHGVIETPVFMPVGTQATVKAI
FT                   MHRDLYEMGTQIILANTYHLYLRPGVDVIKEAGGLHKFMNWQKPILTDSGGFQVFSLSK
FT                   LRTITEDGVEFRSHIDGSRHFFTPEKVIEIQNILGSDIIMAFDECVPYPVDHEYAKWAV
FT                   ERTARWLKRCKAHHKNTENQALFGIVQGSTYKDLRIESAKRTVEEDLPGYAIGGLSVGE
FT                   PKQLMYEMIEVLHPILPEDKPRYLMGVGTPDCLYESVIRGVDMFDCVFATRTARNGTVF
FT                   TKEGRMIIKNAQYAKDFRPIEEDCDCYTCQNFTRAYLRHLIKAEEILGAILLSIHNVRF
FT                   LLRFMEKLRKDIEEDRI"
FT   gene            complement(412916..414415)
FT                   /locus_tag="COB47_0343"
FT   CDS_pept        complement(412916..414415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41682"
FT                   /db_xref="GOA:D9TI50"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI50"
FT                   /inference="similar to AA sequence:KEGG:Athe_0383"
FT                   /protein_id="ADL41682.1"
FT                   /translation="MYSIITIFVVFVFEKVFIVGYLDYVLPTRIPKTLSRAILFLFVIT
FT                   ISIFLIFLNLKKIIIEKFNEKHIIFFLFAISITLPLVLVFLIKVEPKSDFLTYYLIAKH
FT                   LVYSKIFIPNYIATFPHTIMFPIFLSFIFRIFGPSILAAQLTGILLSAMSVIFVFLIGK
FT                   EAGKKQLGFIAAIMWSLMPSRIFYSLLICTENLFNTVALFTIFLFFRNIRAFKSIKTKY
FT                   LNLAFIGILLAWLSSIRPNGIILFIAMTLFYIVFSKETNNNFLKKDMNNIHFFKFIAIF
FT                   IMLATYLLASFSLNIIIESIINQKIASTRIGWNLYVGMNISSHGQWNKNDSELFGRLIK
FT                   ETGPNQAQKTFFNLGLNRLQNLIKEKKIISFISDKIITMWHADHESYDYVAGAQLQNTA
FT                   GKLIFPKNNKIIKLLFDIYYYIILFTALLGLILEIKNCNFSNSIIIIGGLVILGTILLH
FT                   IPFEAALRYKNHALLWFCFISANGIITASGKIIKANKIQCK"
FT   gene            complement(414563..415369)
FT                   /locus_tag="COB47_0344"
FT   CDS_pept        complement(414563..415369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41683"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI51"
FT                   /inference="similar to AA sequence:KEGG:Athe_0384"
FT                   /protein_id="ADL41683.1"
FT                   /translation="MKKFFVFLLSLLIIITFYVKVYAVIPSGYTAVSFLNGGNNFIYSD
FT                   NPESFSVTPNDLFYLWGASLNTTPKDVEMYHILYNGWNSNNKLMVGIAIRNSNNSPVTI
FT                   TFKGSGNAWDIQSNQSANAFEKTPVILRDYFNASYTYVTIPAYSTQVVYAINTNFVTGN
FT                   YKFVFIRAQFQSSLSSNVWMRLFVAGENKINSTTFLNDLFNISSPNAPGTTNTFTGELL
FT                   YTQKITTIVANVKTTYRFCEWPRPLSNINEYTGVVTYKSGPVSLNR"
FT   sig_peptide     complement(415298..415369)
FT                   /locus_tag="COB47_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.958 at
FT                   residue 24"
FT   gene            415800..416759
FT                   /locus_tag="COB47_0345"
FT   CDS_pept        415800..416759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0345"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   csc:Csac_1057 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41684"
FT                   /db_xref="GOA:D9TI52"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI52"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41684.1"
FT                   /translation="MYPKVYFVIPCYNEAEMLPYTIEKMSQKFDSLLKNGFISNESKIV
FT                   FVDDGSKDNTWHLIKEAAKDKMFVGVKLSRNCGHQNALMAGMSYALKFCDCVITLDADL
FT                   QDDINVIDEFIKKFEEGYDIVYGVRSNRKTDTFFKRFTAQSFYKLMRAFGVEIVYNHAD
FT                   YRLLSKKALEFLMQFEERNLFLRGLIPLIGLKSTIVYYERQERIAGKTKYPLKKMLSFA
FT                   FEGITSFSVKPIKYITSAGFLMFLLSIAILIYAIVQKIRGEAVTGWTSLTISIWFIGGL
FT                   QLVALGLIGEYIGKIYKEVKRRPLYFIEEIVEDAQEQE"
FT   gene            416740..417207
FT                   /locus_tag="COB47_0346"
FT   CDS_pept        416740..417207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0346"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: csc:Csac_1056 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41685"
FT                   /db_xref="GOA:D9TI53"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI53"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADL41685.1"
FT                   /translation="MHKSRSSYKRKLILKIHSKIEKLFELIKFSIVGVINTAIDFAVFF
FT                   VCYSILHFDSSFSQIFGYTAGMLNSFLMNKRWTFEDRTRGRKVLLKAVKFGFTNIISLL
FT                   LSIGVLKFSKLYLSSSILIAKILATLCAQGINYILYKFWVFTKAEVNDESV"
FT   gene            417194..417767
FT                   /pseudo
FT                   /locus_tag="COB47_0347"
FT   gene            complement(417772..418767)
FT                   /locus_tag="COB47_0348"
FT   CDS_pept        complement(417772..418767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0348"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ate:Athe_0390 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41686"
FT                   /db_xref="GOA:D9TI54"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI54"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL41686.1"
FT                   /translation="MEKFVSRLKIERLFSGGVITNYYCSSACKHCLYNSSPSWKKEYMT
FT                   EEMADKVFKTLKNFGVFSVHIGGGEPFLNFEGLKKVIQKANENDVYIEYIETNASWVEN
FT                   EDDVKRKLRELKNLGIETILVSISPFHNEYIPFKKVLRLIQLLDEVGIGIFPWIESFAN
FT                   EIRRLNIDKTHSLSEYKDIFGENYIRYLPQRYYLTLNGRAIKTFEEYFPTKTADEIIKN
FT                   SSACFELYSKSHFHMDLFGNFIPNPCVGFRISIDDLGKELDTSKYFFVSLLYTHGVKGL
FT                   FEFAKENYGYTPSKRFLNKCSLCLDIRRFLIVDKNLEAPDLGPREFYLNF"
FT   gene            418889..419254
FT                   /locus_tag="COB47_0349"
FT   CDS_pept        418889..419254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0349"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="KEGG: ate:Athe_0391 preprotein translocase, YajC
FT                   subunit; TIGRFAM: preprotein translocase, YajC subunit;
FT                   PFAM: YajC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41687"
FT                   /db_xref="GOA:D9TI55"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI55"
FT                   /inference="protein motif:TFAM:TIGR00739"
FT                   /protein_id="ADL41687.1"
FT                   /translation="MSLSNLLLEIAYAAGNQSSQQQAPAGATALALLAQFIPLILMFVV
FT                   LYLLIIVPQRRREKQFREMINSLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLK
FT                   IYKWAVKEVLKKAEPKD"
FT   gene            419332..420180
FT                   /locus_tag="COB47_0350"
FT   CDS_pept        419332..420180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0350"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   ate:Athe_0392 dimethyladenosine transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41688"
FT                   /db_xref="GOA:D9TI56"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI56"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADL41688.1"
FT                   /translation="MNLAITKTELLNLLKKYELSPNKKLGQNFLIDENVVRKIILFSQT
FT                   EGKEVIEIGAGPGTLTIYLAKTAQKVFAVEIDKKILNVLKEVCQNLSNVQIVNSDFLEL
FT                   NVKNLTKGNKIYVVGNLPYYVTSQILFKLFEERECIEKFTIMVQKEVAQRLLAEPGTKE
FT                   YGNLTVAMNFYCEIEDYFYVSKNVFYPKPEVDSTVLRARFKIEKPNIDEKKFFKIVHAC
FT                   FSTRRKTILNALSNHFDIEKDKLKRIINMAEVDENLRAEDLSLDDYIRLYKCFEEEFLK
FT                   S"
FT   gene            420344..422110
FT                   /locus_tag="COB47_0351"
FT   CDS_pept        420344..422110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0351"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: ate:Athe_0393 phosphoenolpyruvate
FT                   carboxykinase (GTP); PFAM: phosphoenolpyruvate
FT                   carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41689"
FT                   /db_xref="GOA:D9TI57"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI57"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADL41689.1"
FT                   /translation="MVKVNLHPSVYEWIDEMAKITKPDKIVWIDGSEEEKQRLIKEALE
FT                   TGELMELNQEKLPGCYLHRTHPSDVARVEDRTFICTPTKEEAGPTNNWMDPKEAYKMLY
FT                   SLFDGSMRGRTMYVVPYLMGPVGSPYSKVGIELTDSIYVVLNLRIMARIGDVALKALGS
FT                   SPDFVKGLHSKANLDPEKRYICHFPQDNTIMSVNSGYGGNVILSKKCFALRIASYLGKK
FT                   EGWLAEHMLIVGVEDPSGNVTYIAGAFPSACGKTNLAMLIPPEPLKKLGYKVWTVGDDI
FT                   AWMRIGEDGRLWAINPEAGFFGVAPGTSYKTNPNAMETIKRNTIYTNVLLKEDGTVWWE
FT                   GMDGEPPERGIDWLGRPWTKDSGEKGAHPNARFTAPASQCPSISKEWENPKGVPISAII
FT                   FGGRRAKVAPLVYEAFDWQHGVYVGATMASETTAAAMGKVGVVRRDPMAMLPFCGYNMA
FT                   DYFAHWLEMGKKIPNPPRIFHVNWFRQDENGKFIWPGFGENLRVLKWIIERCEGKVSAK
FT                   ETPIGYVPYVDDLYLDGIDIDKETVEKLLEIDKELWLKEAEDSREFLSQFGDRLPKELI
FT                   EENEKLKQRLSK"
FT   gene            422180..423340
FT                   /locus_tag="COB47_0352"
FT   CDS_pept        422180..423340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41690"
FT                   /db_xref="GOA:D9TI58"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI58"
FT                   /inference="similar to AA sequence:KEGG:Athe_0394"
FT                   /protein_id="ADL41690.1"
FT                   /translation="MIENLPFTRFVVILKGIEQKGKIPFGYVKVQAIVDSTNLEIVIQG
FT                   LEETEDKITFWGVVKKSGEYYPTFLTTLSKPEKGTITQILTTSRFNLFRTGWKLTDLVG
FT                   FAVAKERKGKPSFILIGSFDDNDLYEMEKDILKGFEKGESNKNQDKKDMNNHDEKNKEE
FT                   TEKEEKVESSFSKDDDKLSEDHNEDIEKEMVQAKEQEAEDELGSESVENSEKDEDSSEI
FT                   VENSTRELQKICQDESREENFHFDVEKNYCILEFGDKKIWKRIFEELKEKCERFDPFSD
FT                   DKVKWFKIEKKDIISISHMHPFLYVIFNPFVFNLVSEHGYLIIGYRRSKRKRDRVEILV
FT                   PAEFSEETEKVAKSFGFSEFVTRDGKVMDGKEGYFKMSLELIEKEE"
FT   gene            423347..424402
FT                   /locus_tag="COB47_0353"
FT   CDS_pept        423347..424402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0353"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: ate:Athe_0395 mannose-1-phosphate
FT                   guanylyltransferase (GDP); PFAM: Nucleotidyl transferase;
FT                   mannose-6-phosphate isomerase type II"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41691"
FT                   /db_xref="GOA:D9TI59"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI59"
FT                   /inference="protein motif:PRIAM:2.7.7.13"
FT                   /protein_id="ADL41691.1"
FT                   /translation="MDWACILSGGAGVRLWPKSRKTFPKQFLRIIGDKSFLEMTYDRVK
FT                   RIIPPEKIHIVTHINYREHLRMLLKNVNDENLIFEPEQKETLACVSLACIHILKKDPDS
FT                   VLGIFPSDHFISKIDKFESAIKKGYEIAKKGHIVCFGIAPTRADTNYGYIKLGKELEKG
FT                   VFTAERFVEKPDAKRARYLIKSRYFWNSGIYIFKPSIFLKELKRYMPNCYDVFMRIFSS
FT                   ISTDGYIDELKKGYKLLDKISVDKAIMEKTKRLVVLTADFEWDDVGSWCAFERILSKDE
FT                   NGNVIKAEAITNETKNCIIFSDKFVIALGIKDIILISVDDAILVSHKSKEREIKEIIQT
FT                   IALNEKYKKYL"
FT   gene            424475..425104
FT                   /locus_tag="COB47_0354"
FT   CDS_pept        424475..425104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0354"
FT                   /product="sporulation protein YunB"
FT                   /note="KEGG: ate:Athe_0396 hypothetical protein; TIGRFAM:
FT                   sporulation protein YunB; PFAM: Sporulation protein
FT                   YunB-like"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41692"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI60"
FT                   /inference="protein motif:TFAM:TIGR02832"
FT                   /protein_id="ADL41692.1"
FT                   /translation="MRFYNYNRRRCQKALVLLAFLIFALFTLAIFIEVWLENYLIEAFE
FT                   DKAKQKIIEVTNQAVLQVLQQQKIKYDDVVKVEKGENSSLIKIDTVVLNKEAANLILVI
FT                   NQKVKMLTPLQVEFRMGNIFNNMFFNQFGPLLRGNVMYISAVSYNWQSDFNSAGINQTV
FT                   HRIYLNLKFEGHFSFLRAKRKVTLLQRIPIAENIYIGEVPKVYIGK"
FT   sig_peptide     424475..424564
FT                   /locus_tag="COB47_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.855) with cleavage site probability 0.779 at
FT                   residue 30"
FT   gene            425369..426900
FT                   /locus_tag="COB47_R0003"
FT   rRNA            425369..426900
FT                   /locus_tag="COB47_R0003"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            426973..427048
FT                   /locus_tag="COB47_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            426973..427048
FT                   /locus_tag="COB47_R0004"
FT                   /product="tRNA-Ala"
FT   gene            427058..427134
FT                   /locus_tag="COB47_R0005"
FT                   /note="tRNA-Ile1"
FT   tRNA            427058..427134
FT                   /locus_tag="COB47_R0005"
FT                   /product="tRNA-Ile"
FT   gene            427206..430152
FT                   /locus_tag="COB47_R0006"
FT   rRNA            427206..430152
FT                   /locus_tag="COB47_R0006"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            430224..430340
FT                   /locus_tag="COB47_R0007"
FT   rRNA            430224..430340
FT                   /locus_tag="COB47_R0007"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 99.85"
FT   gene            430751..431422
FT                   /locus_tag="COB47_0355"
FT   CDS_pept        430751..431422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0355"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="KEGG: ate:Athe_0397 beta-phosphoglucomutase family
FT                   hydrolase; TIGRFAM: beta-phosphoglucomutase family
FT                   hydrolase; HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41693"
FT                   /db_xref="GOA:D9TI61"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI61"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ADL41693.1"
FT                   /translation="MGKIKAAIFDMDGVLTDTVKLHFKAWKKMFESHGYKFEYEDYKWK
FT                   VDGKPRLDGIRSIAYDVPEDELIEMAEEKQRYFLEFVEQENLEAFEDSIWLLNHLKQNN
FT                   IRLAVASSSKNTTKILTKIGIYNMFDTIVTGYDFKKGKPDPEIFLTAAQRLNVNPKECA
FT                   VFEDAIDGVKAGIRAGMLTIGVCRDGQFDRLKEAHYVVDKLTNVNLELLENLHEKLFKM
FT                   V"
FT   gene            431436..433703
FT                   /locus_tag="COB47_0356"
FT   CDS_pept        431436..433703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0356"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="KEGG: ate:Athe_0398 kojibiose phosphorylase;
FT                   manually curated; PFAM: glycoside hydrolase family 65
FT                   central catalytic; glycoside hydrolase family 65 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41694"
FT                   /db_xref="GOA:D9TI62"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI62"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADL41694.1"
FT                   /translation="MKLSEKNWLIEQESFGVSHKHETCFALTNGYIGIRGINEECFCDE
FT                   IPGTFIASVFDKDIAQVTELVNLPNPIGLRIYINREYLNPLKCKVLEFKRVLDLKQGLL
FT                   FRKLRLKDEKGRITSIEGFRFVSMKNKNLIVQKYNVVCENYSAVLNVESFIDANTMNSK
FT                   DIPNDRVKHYEVKDKRDCKNCIFLDITTKDKRYKVGMASSTEVLLDGQKCYFNRFVKDL
FT                   GSVITENLEVEAKEGKSYEIVKLSVLVSSRENVEDIFESSQNKLERAKELGVERLLSEH
FT                   IEEYDKLWDVAKLEVIGDEVADRSLKFNVFHLLSMANPEDEHVSLGAKGLHGEGYKGHV
FT                   FWDTEIFMLPFYIYTNPKAARSMLMYRYNLLDAARENARKNGYKGAQFPWESADTGQEE
FT                   TPKWGYDYLGKPVRIWTGDIEYHISADIAFAVLEYVRATDDMEFLLNYGAEIVIETARF
FT                   WASICKYNEEKDKYEINDVIGPDEFHEHCNNNAYTNYLAKWNLEKAYEVLTRLEENYPS
FT                   HFERLVKKINLSEDEPLNWLKVASKIYIPYHPETKLIEQFEGYFNLKDFVIEEYDSNNM
FT                   PVWPKGVELDKLNNYQLVKQADVVMLLYLLGDQFDEEVIKINYDYYEKRTMHKSSLSPS
FT                   IYALMGVRVGETKRAYINFMRTALTDLEDNQGNTALGIHAASLGGTWQALIFGFGGLKI
FT                   EKDDVLSVNPWLPERWKALKFSIWWKGNLLDFTVTAENVEIKKRVEKSKIKIKIRGKEI
FT                   VL"
FT   gene            433937..435163
FT                   /locus_tag="COB47_0357"
FT   CDS_pept        433937..435163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0357"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   EppA_BapA family protein; KEGG: ate:Athe_0399 extracellular
FT                   solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41695"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI63"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41695.1"
FT                   /translation="MKKFLTILLTLIFLLSLLAGAFVTQKDVFATSKITLKLGAWSSSP
FT                   AEKKIVQNQIAAFKKLYPNVDIKLVEIVGDYNQKMQLLMASKTEPDIFYMDSMPAWQYI
FT                   AKNVLEPLDSWMKKYNVKTIGYESALLQPFIYKGKVYGLPKDYNTLVLFYNKEMFKQAG
FT                   LTQPPKTWQELKEYAKKLTTDKVVGLTMNLELARIQPFAYQNGGKVFDGNKPVFTDLKA
FT                   LEGLKFALDLFKEGVCKTPKDLGAGWVGDAFADKKAAMTIEGGWMIPFLNDRKIPKDSY
FT                   GIAELPAGPAGKSTMAFTVAYVMSKNSKHKPEAFKLIRFLTGEGGQKYVVEAGLALPSL
FT                   KSAGVSFAKTYPERKALVDGAKYAQVYFYGLDGTKVVDVFNKAFEDYVIGKKYDLKKNI
FT                   EERVKQIMK"
FT   sig_peptide     433937..434002
FT                   /locus_tag="COB47_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.704 at
FT                   residue 22"
FT   gene            435265..436152
FT                   /locus_tag="COB47_0358"
FT   CDS_pept        435265..436152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0358"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0400
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41696"
FT                   /db_xref="GOA:D9TI64"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI64"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41696.1"
FT                   /translation="MRNRTKTQEYLTAFVMLLPYILSFCVFFAYPLVKAFMISFQNFSF
FT                   LGDTPPKFVGFANYKEALTNKMFLDSILNTLYYSVLVVPTQLIIALILAVIVNDKVKFK
FT                   EFFRTTYYLPTVTSPVAVSIIFLFLYKTDGIVNQILRHIGITPRNWFNEPSFVMPAIVS
FT                   VAVWGSVGFYMVTFLSGLSTIPDQLYEAAEVEGAGEFIKLIKITVPLLKPMIFFNTVVS
FT                   FISTLQMFDLSYIIGGSDGGPMGKAMTMVVMIYRTAFKEFNMGVASAMAFVVFGIIFVL
FT                   TLIQRKFFGEEMSY"
FT   gene            436196..437029
FT                   /locus_tag="COB47_0359"
FT   CDS_pept        436196..437029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0359"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0401
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41697"
FT                   /db_xref="GOA:D9TI65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI65"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41697.1"
FT                   /translation="MWKKENTYGIGVKIVLYTICILWALITLVPYLIAVITSLKPIEDV
FT                   TKFSVDFGKLSFSSYKYITTEFPFMRWLFNSFVVAVAVTAGNLLFNSMAAYALARLDFP
FT                   LKKVIFYIIIGTMMIPGQVLLIPIYLILNRLGWIDSYKGLIIPWLVSAFYVFFMRQYFL
FT                   TIPKDLEEAALIDGLSRFGIFFKIFLPLSLPALAAQAIFIFVGNWNSFMWPSIIASSEE
FT                   LYTLPVGLNSFYGQYYQFWNQVLAGAILLSLPTIIVFVAFQKYFVRGIVTTGLKE"
FT   gene            437122..438141
FT                   /locus_tag="COB47_0360"
FT   CDS_pept        437122..438141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0360"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_0402 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41698"
FT                   /db_xref="GOA:D9TI66"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI66"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADL41698.1"
FT                   /translation="MRKNKNVTIKDIAKALGLSPSTVSRALNNYSDINPETRDKVIEMA
FT                   KKLNYTPNIFAKSLVTNKTKRVGLFIEDMEKEGIYGVFYYEILISFRKAAMDNGYEVVL
FT                   LSTSSEEQKRISFDTVMQEKGLEGAFIMGLKMDDEYLNEIQKSTYPVVLLDIPIKNSNI
FT                   GYVTTNNLKGAQLATEHLINLGHKRIGFLNGHKKAYVSQERLNGYILALSKNGLQVDSE
FT                   LIYEGDFTEVSGFKAADYFVQKGVTAVFAASDMMAIGLIKRLKELGVDVPKKVSVVGFD
FT                   DISLARYITPTLTTIRQNKSEMGKSAFYLLLNLISKQPINHIILEPELVKRESTAKLR"
FT   gene            complement(438211..440556)
FT                   /locus_tag="COB47_0361"
FT   CDS_pept        complement(438211..440556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0361"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: ate:Athe_0403 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41699"
FT                   /db_xref="GOA:D9TI67"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI67"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADL41699.1"
FT                   /translation="MRKLPKKEPIFLPDEWNIIEDGFHPENNFMLETIFTVANGYLGLR
FT                   GNLDEDFPDKKQSFKATYINGFYEEFDITYPEGGYGFAKRGEAMVNVADVKTFEIMIEG
FT                   EKFNLFSGKIYKHIRKLDMKSGTVVREILWESERGRKIYISFERLACFKRQHLGAINVR
FT                   IKPLNFSGRIKIVSKIDGNSSNLLETEDVRVGSGIEKFPFETIKACHAELSGFLMQKTK
FT                   KSRLSYGCMVEHVLYFDDFQYKSFTDKEKNLVIFEIEFDAEKDMEYNLTKYFSYFTQRD
FT                   IEEDLIEERCAAEILEAKKIGFKNLLKEQREFLETFWENADVVVKGDPKIQQAIRFSLF
FT                   SLLQSTGRNGISNIAAKGLTGEGYGGHYFWDSEIYIMPFFIYTYPEIARMLLIHRYNLL
FT                   NAARQRAKELHHSGALYPWRTIAGKECSTYFPAGTAQYHINADIVYAIKKYFEVTDDLE
FT                   FIKSYGAEIVFEVARFYSELGHFSEAKNGKFCIFCVTGPDEYTALVDNNAYTNYMVKMT
FT                   LEFATNLYTLLKEKDSDAFEKLCRKIELSRDEVLLWKNIADNMYLPYNPELKIIPQDDS
FT                   FIYKKRLDLSKIPESQFPLLLNWHYLDIYRYQVCKQPDVLLLIYLLRENFTFEDLKNNY
FT                   EYYEPITTHDSSLSPAIFSILAAELGYLDKAYEYFVYTVRMDLDDLNDNTKDGIHAACM
FT                   GGAWQALLFGFGGMRTNKGILSFAPKLPEKLEYLSFKVRYKGRVLKVETTKSITSYTLL
FT                   EGENIQLSHYGSSFELKRGQTKEFILAN"
FT   gene            441083..441211
FT                   /locus_tag="COB47_0362"
FT   CDS_pept        441083..441211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41700"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI68"
FT                   /inference="similar to AA sequence:KEGG:Athe_0404"
FT                   /protein_id="ADL41700.1"
FT                   /translation="MYGKEIEIGGKKLAVANEILRSPEGKIYFIVEEVARWLCDVI"
FT   gene            441198..441983
FT                   /locus_tag="COB47_0363"
FT   CDS_pept        441198..441983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0363"
FT                   /product="Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase"
FT                   /note="KEGG: ate:Athe_0406 hypothetical protein; PFAM:
FT                   Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase;
FT                   SMART: Lysozyme subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41701"
FT                   /db_xref="GOA:D9TI69"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI69"
FT                   /inference="protein motif:PFAM:PF01832"
FT                   /protein_id="ADL41701.1"
FT                   /translation="MTLYRSDISWNGYYTPKVASGGSITLKGNSEASRKESSSASITPG
FT                   YSDNFVLGDRGYSGGISASVSPVRTGGCYTTPRINGGASSTPKPSGSSTLTEVKTITSN
FT                   MSKEDFVAAVFAAAKEVEKKTGIPAAIITAQAILESNYGKSVPVDKKTGQYSYNLFGIK
FT                   GEDPAGSVTVTTTEYVNGKKIKIEDRFRAYNNFEESIKDHSEFLRNNKRYQELFKTSDP
FT                   IKWAEGLQKAGYATDPEYSKKLINIMTTWKLIDTKEKKK"
FT   gene            441980..442609
FT                   /locus_tag="COB47_0364"
FT   CDS_pept        441980..442609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lba:Lebu_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41702"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI70"
FT                   /inference="similar to AA sequence:KEGG:Lebu_0018"
FT                   /protein_id="ADL41702.1"
FT                   /translation="MKKAFCRIIVLILMCITLISCSFTKGNTTSEIKQTVNKFVHAIKT
FT                   GNIEEFVNIANPYGILVIRNYITGGYGLRGKNIRNFYKPNEISSGLIFPVDGELPVKLS
FT                   ELFHSTVQLGGKINNIKKLKSIYFTNKIEYIQYNNIQSTKEIVNRIYKILNKAGKNYET
FT                   PVIYVLDNDEFLLCEAKIINSLPVGSFVLFKKLKGDYKVIAVIDLK"
FT   sig_peptide     441980..442060
FT                   /locus_tag="COB47_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.484 at
FT                   residue 27"
FT   gene            443175..443303
FT                   /locus_tag="COB47_0365"
FT   CDS_pept        443175..443303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41703"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI71"
FT                   /inference="similar to AA sequence:KEGG:Athe_0404"
FT                   /protein_id="ADL41703.1"
FT                   /translation="MYGKEIEIGGKKLVVTNEILRSPEGKIYFIVEEVARWLCDVI"
FT   gene            443290..444207
FT                   /locus_tag="COB47_0366"
FT   CDS_pept        443290..444207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41704"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI72"
FT                   /inference="similar to AA sequence:KEGG:Athe_0406"
FT                   /protein_id="ADL41704.1"
FT                   /translation="MTLYRSDISWNGYYTPKVASEGSITLKGNSEASRKESSSASITLG
FT                   YSDSFVLGDRGYSGGISASVSPVRTGGCYTPKINGGGSLTPKLSGSLSIADKFRDFLDG
FT                   IGQKVEDFSSKTEKIVLRVILKDLLEALRHASSNSLKYSINFLEHSLQDNPNDIIISNE
FT                   KSELSQKIRENEDYKKVRKYIISIAKELLPAMKVGEEKEKDQNGKFFKVTFSKEQDLDL
FT                   YLAINNANLYFKKENENTISIWLKDTYNFDNNVKKESSIVQILDLVRGEIGVGKWLNEF
FT                   GEDLQNMDVVNSYEILIKIETVKF"
FT   gene            444241..444903
FT                   /locus_tag="COB47_0367"
FT   CDS_pept        444241..444903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41705"
FT                   /db_xref="GOA:D9TI73"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI73"
FT                   /inference="similar to AA sequence:KEGG:Athe_0407"
FT                   /protein_id="ADL41705.1"
FT                   /translation="MIGKKTLRGFCLLIVLSVMGFFVFIVGIIVFSIYFNSNPPKHVKN
FT                   RAEWIRLYKIFNIEFPEPIKEEKIVKCETYFLDLLIFDEKAKPKLEKLTSNWLYIRNNK
FT                   IPDNLDRKMQDDIKTVLYHVKTFSLGKKKLPDDLKPLFFDENGKEDDESILNEKLVQNM
FT                   LFEMKEGYKFYRYYRKGKRVFGELSLYFVYIPKMNHLYVYNDTFYTERIDYIKKALQ"
FT   gene            complement(445109..446251)
FT                   /pseudo
FT                   /locus_tag="COB47_0368"
FT   gene            446348..447220
FT                   /locus_tag="COB47_0369"
FT   CDS_pept        446348..447220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0369"
FT                   /product="glycoside hydrolase family 24"
FT                   /note="PFAM: glycoside hydrolase family 24; KEGG:
FT                   ate:Athe_0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41706"
FT                   /db_xref="GOA:D9TI74"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI74"
FT                   /inference="protein motif:PFAM:PF00959"
FT                   /protein_id="ADL41706.1"
FT                   /translation="MASGGSITLKGKSEASRKESSSASITPGYSDNFVLGDRGYSGGIS
FT                   ASVSPVRTSGCYTPKINGGGSLTPKLSGSTTLPTLNSQLSSTKIDAASKTQNIPAAIKR
FT                   LEPSKALFEFVKSYEGYSSIAYRDKDGVWTIGIGHVLRDKELGEYVDLKTNKPKKAITE
FT                   EKAYEFFKNDIKGATDAINKFMENNKIQLSQNQFDALVSFTFNVGSAWTNNEMSKTRDD
FT                   IIKVVKNGIDTKLERELRDDFLSWSKAKGQVLEGLQRRRYDEWKMFVKGDYKITDINTW
FT                   RKIKKEIGL"
FT   gene            447253..448083
FT                   /locus_tag="COB47_0370"
FT   CDS_pept        447253..448083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41707"
FT                   /db_xref="GOA:D9TI75"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI75"
FT                   /inference="similar to AA sequence:KEGG:Athe_0490"
FT                   /protein_id="ADL41707.1"
FT                   /translation="MNNKLLFEGNLFLCFGQKLTKLVRWYLVKLIKKVVTTFLIMFLIL
FT                   PNAVVLSNDKIERGYYDYSGKKGNNDVVMSIYLNNSKVTGLYAYKGVKKYIKLEGIIKE
FT                   EKIKLNELDQKGKVIGTFRGNIKTADIIEGTWSNGKDKEIFKLKLIGKNYAEYGRRFDL
FT                   VGFPDEEVVKFAISVQNYLIRNNRKALAKLIAYPIDVKINGKKKTIKNEKEFVNSFDKI
FT                   FNVNLKKAIIKAEPLFMFVNQYGAMLGESGYNVWFAAVEKKDKKHYLLIHTINN"
FT   gene            448097..448303
FT                   /pseudo
FT                   /locus_tag="COB47_0371"
FT   gene            448504..448881
FT                   /locus_tag="COB47_0372"
FT   CDS_pept        448504..448881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41708"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI76"
FT                   /inference="similar to AA sequence:KEGG:Athe_0419"
FT                   /protein_id="ADL41708.1"
FT                   /translation="MNSIQKIAHHIVSSIANDLRENTLTNIVSIAAGGIGGGVKAYRAA
FT                   TSGFTMLERKVASKTVSGVLKGMGEGYLFGKGTVSVIATVTNKIASVEKWFDNTKVGKA
FT                   IDNAITKVEYGLHKLIGGGTY"
FT   gene            449384..449635
FT                   /locus_tag="COB47_0373"
FT   CDS_pept        449384..449635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41709"
FT                   /db_xref="GOA:D9TI77"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI77"
FT                   /inference="similar to AA sequence:KEGG:Athe_0420"
FT                   /protein_id="ADL41709.1"
FT                   /translation="MSKKFKAKDILFRISIVFIIFITILTGFIVIPVLGSLINVALKAL
FT                   KIEWLWSVAAFGLVGYYVYKFVSKRINNRKLRKEGMQD"
FT   sig_peptide     449384..449491
FT                   /locus_tag="COB47_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.675) with cleavage site probability 0.541 at
FT                   residue 36"
FT   gene            449775..450041
FT                   /locus_tag="COB47_0374"
FT   CDS_pept        449775..450041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41710"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI78"
FT                   /inference="similar to AA sequence:KEGG:Athe_0421"
FT                   /protein_id="ADL41710.1"
FT                   /translation="MEWYNPEGKLVFTINIDVKPTNQEHPYRYFWSVMRYNFINAIKGK
FT                   VFGVWKVKIKPFDIEYEFVIKDLKSYSLFKESKTISGVLDEIV"
FT   gene            complement(450172..451158)
FT                   /locus_tag="COB47_0375"
FT   CDS_pept        complement(450172..451158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0375"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ate:Athe_0422
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41711"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI79"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADL41711.1"
FT                   /translation="MYVADSNRYNNMLYLRCGQSGLKLSAISLGFWHNFGDGDQFDNMR
FT                   KIVQKAFDLGITYFDLANNYGPPPGAAEENFGRIFKLDLKPYRDQIIVATKAGYTMWEG
FT                   PYGDWGSKKYLLASLDQSLKRMNLDYVDIFYSHRPDPQTPIEETMEALYQAVHQGKALY
FT                   AGISNYNPEQTKLAYSAAKQMGLKLIVNQVRYNMFARDVENGLFDTLNELGMGAVIYSP
FT                   LAQGLLSDRYLDGIPEDSRVRKSGVFLKESDITPERIEKVKKLSEIAKRRGQTVSQLAL
FT                   AWILRNKVVASVIVGASKVSQIEDNVGCINNLEFSEEELKEIEEILK"
FT   gene            451317..451790
FT                   /locus_tag="COB47_0376"
FT   CDS_pept        451317..451790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0376"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   ate:Athe_0424 protein of unknown function DUF710"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41712"
FT                   /db_xref="GOA:D9TI80"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI80"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ADL41712.1"
FT                   /translation="MDENIRREDNLKRIEVKIAGMNYVLKTDEDEEYIMKIANYINKKM
FT                   SEVVANEPQLSTSLSAMLTAFLVADEYFKHLLECDDKLSKVISEKEKYQKEVDEYKEKL
FT                   KEAEEKLLQQNQEIEKLNEIIQNLNQELEKTKQELEKTKKELDDFINAFDGDR"
FT   gene            451798..452673
FT                   /locus_tag="COB47_0377"
FT   CDS_pept        451798..452673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0377"
FT                   /product="metalloenzyme domain protein"
FT                   /note="PFAM: metalloenzyme domain protein; KEGG:
FT                   ate:Athe_0425 metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41713"
FT                   /db_xref="GOA:D9TI81"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI81"
FT                   /inference="protein motif:PFAM:PF01676"
FT                   /protein_id="ADL41713.1"
FT                   /translation="MLFIFLDGVGKGEKSEHNPFFYYHPKAYDIFLKEGNVLFLDATLG
FT                   VEGLPQSATGQVTIYSGINAAKEVGFHINGQITPSLKRIIERQNIFTTLLHKGFKVDFA
FT                   NVYRNEYLQKLLNDKNFKMSVTSYMTLISGIKFKTVEDLLRGEGVYFDITNHVLIESGY
FT                   EVPVFLPEKAAENLLNVLHKNDFVLFEHFKTDIIGHSCDMEKALELLKLLDEFMLYLIE
FT                   NLPENTCLIVTSDHGNVEDLSTKTHTKNKVPFLAYGNKKEIFKLESIDQIYRSILKYFE
FT                   KEAQRDDKEI"
FT   gene            452670..454973
FT                   /locus_tag="COB47_0378"
FT   CDS_pept        452670..454973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0378"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: ate:Athe_0426 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41714"
FT                   /db_xref="GOA:D9TI82"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI82"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADL41714.1"
FT                   /translation="MKKVELLSPAGGFEELVAAVKAGADSVYVGAKEFSARAYAKNFSE
FT                   DELRKAIDFCHERGKKIYLAINTLIYNDEMPKALKLVEFANKEGIDAVIVQDLGLLFII
FT                   LKEFPGMPVHASTQMTVHNCAQVKFLENLGVKRVILSRELSIDEIKNIRQQSSIELEVF
FT                   VHGALCVSYSGQCLFSSILFKRSGNRGQCAQVCRLYYKLLDKEKKEIDEGFLLSPKDIC
FT                   LLENIDTLIKAGVESFKIEGRLKDQYYVYTVTSIYRKYIDMYYEKGKITIDSADRQKLL
FT                   LVFNRGNFCSGYLENAGIDRIIFKSAPNNTGLFIGKFYFKNGKLFLQTSYNLSNGDVIS
FT                   FRNKNFEEILLEINNNIAKEDDKIFEVKVDFERKKRLKEFSEGQVFIVRSKEHEKEIEK
FT                   ELKLEKKFRKVDFKIWIEKGKRIKALAMSDGFVVEEEGEVVQQAKEKEVTSEAVISSFS
FT                   KLGGTVFEMGNFDAHIEDGCFVKVSELNRLRKLLIEKLSQKIISSYKKELNQDIEISRY
FT                   LGDCYVRSFDRNHRFSFMVDSIWQLEKLKKWCELRNLSDYEIYVPYNIIFDVKIDDNMV
FT                   VYLDRITHDEDLKRVEVEKIKEKGIKKVLVRNLGQYEIFKHHFEIYFDFSLNTTNSASL
FT                   RFLEQLNCKRICLSVELSKTRIAEIYTSARKSEIEIIIFGKIPLMINRLKFFEKGEYLQ
FT                   DRKGELLKLIKTQSEKNEILNPAFLYIDDKDVMADVLRFDFTGATKNEMEKALEGYFDA
FT                   KKIFLKITKGYYLS"
FT   gene            454973..456085
FT                   /locus_tag="COB47_0379"
FT   CDS_pept        454973..456085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0379"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="KEGG: ate:Athe_0427 sporulation integral membrane
FT                   protein YtvI; TIGRFAM: sporulation integral membrane
FT                   protein YtvI; PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41715"
FT                   /db_xref="GOA:D9TI83"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI83"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ADL41715.1"
FT                   /translation="MREFTKNRFVVAMIYVILISAFIFSCAYLIRTFDIFMRFVIKAFI
FT                   PVIIGLFIAEVSEPLLKYLEKRKVSRTISAILILIALNLILGFMLAEGIYILVNECMSL
FT                   VSSLQNIDYDKIYQMLDKLFASVKNIYSGLPVPIVNFIQSGVNEITNVLNQIATLSLKV
FT                   VKVIPATLKGITIWFFSVLSSFFFMRDRHKMRAWLIQNFSAQLYREISSIVFKVIDSVV
FT                   DYAKSQIILSALMFLSGLIGLSIIRAPYFLVVSLLLGLLSIIPIIGSGIILLPWIAGSF
FT                   IAGDTNFGMKLLVVYLIILGLREFASIKIVASQVGISTFTTLVSIYAGVEVFGAWGFVI
FT                   GPLLVVFLKAVYETGAIKKIRENLFMPKKE"
FT   gene            456097..457914
FT                   /locus_tag="COB47_0380"
FT   CDS_pept        456097..457914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0380"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: ate:Athe_0428 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41716"
FT                   /db_xref="GOA:D9TI84"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI84"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADL41716.1"
FT                   /translation="MPIVKVYAKNQIVAEIEVEKGSILLDVLQRNSVEIVASCGGKGVC
FT                   GKCKVTVKKGQTPYMDNFTSEEEKHLRSEEISRGVRLACCLKVYEDIEIFLEESSENAN
FT                   ILSHFVMNDFGYEENIIVKKVVLQRPSLDGQKSFDLILKEAIGDNKLKILPKTLQKLAK
FT                   MKDSEFYAVVYSEEIIDVKISSFVFGVAVDIGTTTVVCYLVDLIQKKVVDYYSFINPQR
FT                   KFGADVISRIDFAREKEDGLFILQNEIINALNTAIKVLVDRNSISTEDIVRIVIVGNPT
FT                   MLHLLLGVDPQTIAISPFVPVFTERIYAKPADIGLKINQAGTVEVLNSISAYVGADIVA
FT                   GVLSTKMYKNPRISLLLDLGTNGEMVLGSSSFMLACSTAAGPAFEGVNISCGMGAVEGA
FT                   IDSVKIENGKVHFTTIGAKWPIGICGSGIVDAIAYMLKEGIIDETGKFCDKNETYKEYL
FT                   KEVNGQQAFFITDSVYITQKDIREIQLAKAAISAGIKTMIQHANVTEDEIENVYLAGGF
FT                   GNYINPRSAVEIGIIPKKLQDKIVAVGNSAVAGAVLVLLSSKAAIEAQSLCKNVNYIEL
FT                   SNSQDFNQFFIESMIFESFEQEGEQSRNG"
FT   gene            457907..458605
FT                   /locus_tag="COB47_0381"
FT   CDS_pept        457907..458605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0381"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ate:Athe_0429 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41717"
FT                   /db_xref="GOA:D9TI85"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI85"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADL41717.1"
FT                   /translation="MVDEVRAKDKIKLWIFIFIIVLSMFALVYAEKQHQLNPKYIKQYI
FT                   SHFGVWAPVVFLILYSIKSFIIFIPAGVFMLAAGLSFGTMFGAIILIIGTILSSTIGFV
FT                   FARYFGKDYVQKRLQNTKFSDVGKKIAEKGFLIILLLRLVPILPYDVINYICGLSKIRY
FT                   RDFILATFIGTVPACFLYAYLGENILKPFSKGFYLSLCLVIVISLTPVLFAKSIKEFLQ
FT                   DDKEEDEHKI"
FT   gene            458648..459370
FT                   /locus_tag="COB47_0382"
FT   CDS_pept        458648..459370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0382"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: ate:Athe_0430 cell wall hydrolase/autolysin;
FT                   PFAM: cell wall hydrolase/autolysin; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41718"
FT                   /db_xref="GOA:D9TI86"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI86"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADL41718.1"
FT                   /translation="MKSIRENLFLICISLFTFGILIACLFINRYVFEIAEIFNEDTYQG
FT                   KNLVVIDPGHGGFDPGAVIGDIKESVINLQIAKKLKEYFEMFGFRVVLTRSTEDDLSEH
FT                   DKKSHDLKKRKEIVLANNPQVFISIHLNSFPVSKYFGAQVFYDKSNEEAKKVALFVQNE
FT                   LRYMPNGLVNRRQPKPIDVYILKNLKIPAILVECGFMSNKMELSLLQSQQYQDWLSYSI
FT                   LKGVLNYLDQREEKGKNG"
FT   gene            459363..460754
FT                   /locus_tag="COB47_0383"
FT   CDS_pept        459363..460754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0383"
FT                   /product="dipeptidase"
FT                   /note="KEGG: ate:Athe_0431 dipeptidase; TIGRFAM:
FT                   dipeptidase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41719"
FT                   /db_xref="GOA:D9TI87"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI87"
FT                   /inference="protein motif:TFAM:TIGR01887"
FT                   /protein_id="ADL41719.1"
FT                   /translation="MDEVKALIDKEIEDLKDDIINTTVQLIKIRSVEDMPAPNMPFGKA
FT                   INDALLTCENLCKNLGFETKNYDGYALEAVYGNQDEDVCVIGHLDVVPEGEGWSVPPYE
FT                   GVVKDGKIFGRGAVDDKGPTVAALYGMYVLKKLAEEKKISLKRKLRFVFGTNEEGGSKC
FT                   LQYYFERAKYPTVGFTPDADFPVIQGEKGFLVFEFAKDVEDTFEIEGGQRPNMVPDRCR
FT                   FEGSFDVQKAKEIIAKKGLNDKAEVFEEAGKTIIVTKGVSAHGSLPFKGENAISYMFDI
FT                   LDELWTKEDEFRRFIDFYNTHIGFDVFGEKLSIGFEDEKSGKLVLNAGMIRKEKDKLIL
FT                   TINVRYPVDTSYDEIEKIVKEVVQNYNIEYRLVTNVPPLYFEADHFLIRTLLEVYREFT
FT                   NDDTQPLVIGGGTYARWAKNVVAFGPNMPGDEEVAHQKDEYILIDRLMLCSKIYANAIY
FT                   RLAKE"
FT   gene            complement(460815..461441)
FT                   /locus_tag="COB47_0384"
FT   CDS_pept        complement(460815..461441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0384"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   ate:Athe_0432 protein of unknown function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41720"
FT                   /db_xref="GOA:D9TI88"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI88"
FT                   /inference="protein motif:PFAM:PF02659"
FT                   /protein_id="ADL41720.1"
FT                   /translation="MNIYQIFVITLSLNIDALFFGVAFGTKGIKILTKSKVIIFFTSMS
FT                   ITIISFFMGRWFGKFLEPQLSSHLGAIFMIIIGIVFVIRTLLEKNSSPLPKTLVNLSLK
FT                   SLGLTIKIIKEPVLSDIDSSGSIEPVEAFLVALALSLDGLSASFSLGLSNLANIEQIFL
FT                   IPVFQFIAISAGNVFAYFFKTFKKSLIANYIPGIVLILLGIYNLF"
FT   gene            461610..462152
FT                   /locus_tag="COB47_0385"
FT   CDS_pept        461610..462152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0385"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ate:Athe_0433 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: sigma-70 region 2 domain
FT                   protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41721"
FT                   /db_xref="GOA:D9TI89"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI89"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADL41721.1"
FT                   /translation="MDERELVERAKKDKKYFEKLYEMYFDKIYSYIYYRTFNHPITEDL
FT                   TSETFMKVLRSLDRFEWKENGSFCAWIFRIAQNVVNDYYRAKKEFIGIEKISGSSVLRN
FT                   PEDEFLDKVEKDMIKSALKKLTKDQQEVVILRYGANMKFNEIAKIKNKSDVAVRALFFR
FT                   AMHSLKEMLLKEVHESE"
FT   gene            462145..463497
FT                   /locus_tag="COB47_0386"
FT   CDS_pept        462145..463497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41722"
FT                   /db_xref="GOA:D9TI90"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI90"
FT                   /inference="similar to AA sequence:KEGG:Athe_0434"
FT                   /protein_id="ADL41722.1"
FT                   /translation="MNDEKLDRIFEEAFKVEYRKEFKQELKEMLLKEYDRREKRRYFLK
FT                   ISTVVAAFIVLAIVAFGTIKLDLMRLNVQDTSFVKTEMENAFHKEDTSTRQETKQNDNK
FT                   NKSGDFTAQQKVSQDINIPEKSQTRVKEKQSTNNTFFASSSKKTEFQKSSDIIEKPATI
FT                   KNNNKNAFSSQKPAISSSLPRSSTKKIIENDVKKVPEQNTKKVSKAASETKSSDTSVVV
FT                   TTQNKEIKKENQYVIVKEDEKVSESVYVLKEEDLKIDKEYILDVLSSVVSSNVYEKENS
FT                   TLQDTVVANVYEGYFNFKVAKSDTPILISRFSEFESQEDVLKSVYDKTNFILQGLGIKD
FT                   YKITVFPVDEGYRAEITVFFDGYRIFDVDSFIDYSSSADVISGKIYLKGFSVLKSMKII
FT                   DKKTAAQEFEKKYNLKDINPSDIAIVYKKTEKLFIPTYIYIHENKIYWLEK"
FT   gene            463549..463857
FT                   /locus_tag="COB47_0387"
FT   CDS_pept        463549..463857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0387"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: ate:Athe_0435 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41723"
FT                   /db_xref="GOA:D9TI91"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI91"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADL41723.1"
FT                   /translation="MNLDLKERISENGIVIELKGELDIFSSPTLKDKLYSLIDTSSNDV
FT                   IIDMNDVTYIDSTGLGVFVGALKKSRQKGTNIVLKNLKPNVRKVFTITGLDKVFRIE"
FT   gene            463875..464231
FT                   /locus_tag="COB47_0388"
FT   CDS_pept        463875..464231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0388"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: ate:Athe_0436 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41724"
FT                   /db_xref="GOA:D9TI92"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI92"
FT                   /inference="similar to AA sequence:KEGG:Athe_0436"
FT                   /protein_id="ADL41724.1"
FT                   /translation="MDQIMLTIPPKAEYIMVVRLTLSGIAARAGFDFETIEDLKMAISE
FT                   VFNLFEIEKLSRKISIEFNVTSEYLDIRIDVPNGELTGNDLAKMILQTLIDEAEFEKTE
FT                   DGHIVKLKKYHRGV"
FT   gene            464236..465006
FT                   /locus_tag="COB47_0389"
FT   CDS_pept        464236..465006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0389"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   subfamily"
FT                   /note="KEGG: ate:Athe_0437 RNA polymerase, sigma 28
FT                   subunit, Sig B/F/G subfamily; TIGRFAM: RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: sigma-70 region 3
FT                   domain protein; sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41725"
FT                   /db_xref="GOA:D9TI93"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI93"
FT                   /inference="protein motif:TFAM:TIGR02980"
FT                   /protein_id="ADL41725.1"
FT                   /translation="MVDEKRTLEIDDEKIDRLFEEYQRTKAIELRNELVNKYLYIAEII
FT                   AKKFVNRGIDYDDLYQVACVALINAVERFEPNKGYKFTSFATPTIMGEIKRYFRDRASI
FT                   IRLPRRLYETSAKIKLVTEMLSSKLKRPPKVEEIAQHLNMSTEEVLEVMEASNSYLPQS
FT                   LDQTMYEDEEMTLGDVLGKSDENILQIENVEAVKKAIERLSPFEREFVQKRFFEEKTQK
FT                   EIAEEMNVSQMYISRLEKKVLKKLKDFIEEKKEE"
FT   gene            465166..468639
FT                   /locus_tag="COB47_0390"
FT   CDS_pept        465166..468639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0390"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   ate:Athe_0438 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41726"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI94"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADL41726.1"
FT                   /translation="MLKRRGKRLFAFLTLLSFLLSFLVNTSFSQNLSYYQQAAQVLKQK
FT                   GIMTGDTKGNLNLDKPLKRSEISKMIIMLLGKKPLADFYANQKRSSFKDIKTDYWGLGY
FT                   IEAAKAIGLISGYTDGTFKPEQYLKVEELTAIVVRALGVRESELKGKWPLNYIQKAYSM
FT                   NIFYGIESEIEIGKLVTRGQTAAILYNAFLNESLKATKPVGIEIIDLQNLKVTFDKELS
FT                   SIVKSDFSFDGGLSVLDAKFADSSKKVVEIKTSAQQEGKEYTLFYKGQATTLKFVAKTM
FT                   PFSFAEDIKIESLKKVDLKFTKPISKSQQDNLPIKIYVNGKEVTDVKKSISSDFKTVSI
FT                   IFPSRLNQTDKLMVEITNLLSETGQILSITKELTVIDATQPKVVDFRLINSKKFKVIFT
FT                   EPMNIDSANAYKVCDLSSVGANIRIDSNYVYAKVSPDHQENAVDIELLYPLADGNHTVE
FT                   ITEAKDFAGYKAPDFKATFTTVLEKNPPKLVSLELVSNNRIRLVFDEEIRSLDGLIPTG
FT                   EYEIYQAQDSTNHAIGAKITLLSDEKTIDIQLNQQLKLDSRALVSFEVRFRYVEDLLGN
FT                   KVSDWVSVAGKAQDDTTKPAVKSIEVLDGNIIKVTFTENVNADDRVQSFSLLSADSMQI
FT                   IESQAKSVKKLKENDSSIFVVEFSALAAINGGRYTLKISGICDTSVKENVMDTSIYSID
FT                   VKDTLAPTITAAIAKYDSSSDMDKIDIFFSEPMDIEKLKNLSSYFVGASSATIPLSSIK
FT                   GAKVDYISPNGDRITLLIPGADDTSPGKWSQSGAVVDKLAVPTLTDKAGNFIANATIAM
FT                   PVSVSANFRGISAQDIEVVALDKNTIEIRSLNGYIFASFDPAAIMFRNAYSTSSLNGNP
FT                   DNDKVVSLGFVSYTISQDKKAITLKTSISLTSSAMADTNDSGQDVEPLKIFTVNSNIKD
FT                   QFEQSLVISPTLDISFYPSILLKDKISPQQTGISVGSGNQSDTIAITFDEPVFALSGIN
FT                   NTVLAAGIELKVGGITLIPDVDYTAYIQNGIVYVKIKRAGIVDSKVSVEIKRPDLIVDN
FT                   SGNSASVLKAQTVEHVTERTSPDVTAEFSSTDTRKVKLTFSEPIDASTLIAQNFSCVAG
FT                   GSIVSFVKSSDNKVVEITFTNPLLSGSIINISPNVKDLAGNSVSVQAVRK"
FT   gene            468790..469218
FT                   /locus_tag="COB47_0391"
FT   CDS_pept        468790..469218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0391"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: ate:Athe_0440 6-pyruvoyl
FT                   tetrahydropterin synthase and hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41727"
FT                   /db_xref="GOA:D9TI95"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI95"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADL41727.1"
FT                   /translation="MSKEQPLKFLVNIYYGLGVIFVMLLKKIFKFDAAHNLTKYNGKCE
FT                   NLHGHTYKLVVTVEGKPDNQDMVIDFVLLKKIVQNEVIDILDHAYINDIIENPTAENIA
FT                   KWIWGKLSKKIEEQGVKLYEIEVWETEDSSVIYRGEDE"
FT   gene            469215..469985
FT                   /locus_tag="COB47_0392"
FT   CDS_pept        469215..469985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0392"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: ate:Athe_0441 protein of unknown function
FT                   DUF198; PFAM: protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41728"
FT                   /db_xref="GOA:D9TI96"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI96"
FT                   /inference="protein motif:PRIAM:3.5.4.16"
FT                   /protein_id="ADL41728.1"
FT                   /translation="MIDVQSQKDLRGISIQKVGIKDLNWPIVVMDRENKTQTTIAKITA
FT                   AAELKGDIRGTHMSRFIEAIDELKVVGPKEIEKLLDRIKEKLNSEKAYIRFDFPYFINK
FT                   RTPVTGTLSPLKVDCYFEAERDNKFDLKVGVVVPVHTLCPCSKEISEYGAHNQRAYVTI
FT                   EVKMRKFMWIEELVEIAESSASCPLYSILKRPDEKWVTERAYQNPRFVEDLLREVVLKI
FT                   REDGRIKWYKVFVESIESIHNHNAFAYIEGEITK"
FT   gene            470049..471488
FT                   /locus_tag="COB47_0393"
FT   CDS_pept        470049..471488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41729"
FT                   /db_xref="GOA:D9TI97"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI97"
FT                   /inference="similar to AA sequence:KEGG:Athe_0442"
FT                   /protein_id="ADL41729.1"
FT                   /translation="MKIKIYTKRLGISIAAFVFGILFIILLIRNFTIKNTPTQNDNITY
FT                   VKNMFELKNAKLVEDNILIEKLPDDAFMFKYLFEDSKSKYEIYMKEDQTIVYFKKFTPS
FT                   DIVNRFSISDVKTKAFKILYKLAPYTKGNVDIEVASSQNAYVCVFNRYEGDKKVLGDWA
FT                   TVVLNKDNGELLEFNINWHQDINFRNAGKKGDEESKILSSIKVVPVLSSDSFLKYTTVN
FT                   NVLGLKDVYYDFVDGKVYPQLNLPVNTLNIKDYNSYVEYAQKKAHAEYVKLKFEKILNL
FT                   LSSKTRRLPFSSSEFNISSSGEYLYTKKSIFGNVEITADKYGNILKAVAHLKPSDEIKK
FT                   IESKVLNDWAEQIMQVLVGKFVHAKSYIFENKSQHTVSYKFYIGNAYIMNGRLEVTFDR
FT                   PSGEVIKLDFDLGIRPEFMEKVKTLKSPSEYMNLIKSSGFEEVYVLTKDYGKVYLYQKP
FT                   VEAHLALKPKFDMTYLMHATK"
FT   gene            471523..472692
FT                   /locus_tag="COB47_0394"
FT   CDS_pept        471523..472692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0394"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: ate:Athe_0443
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41730"
FT                   /db_xref="GOA:D9TI98"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI98"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADL41730.1"
FT                   /translation="MESILIKNAKIYTMDEKGIIERGDILIKDGKIAMIDNNINEYADH
FT                   VIEAKDRLVFPGFIDAHSHIGMWEDSVGFEGADGNEDSDPVTPHLRAIDAINPFDRSFE
FT                   EAIEGGVTCVATGPGSANVIGGQFCVIKTFGKRIDKMVVKEPAAMKVAFGENPKSVYHE
FT                   KHQMPQTRMATAAILREALFKAREYLNKKLEAQQDEEKDMPEFDMKSESLIKVLTKEIP
FT                   LKAHAHRADDIFTAIRIAKEFDVNLTLDHVTDGYLIVDELKQENIPCIVGPNLTDRSKV
FT                   ELKNLDFKNPGILSKNGILVAIMTDHPVIPQKYLVLCSALACKSGMDEIDALKAITINP
FT                   AKILGIDNRVGSIKEGKDADIVVYKGHPFDIFSEVEYVLIDGKVVYHRK"
FT   gene            472713..473186
FT                   /locus_tag="COB47_0395"
FT   CDS_pept        472713..473186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0395"
FT                   /product="uncharacterized protein family UPF0079, ATPase"
FT                   /note="PFAM: uncharacterized protein family UPF0079,
FT                   ATPase; KEGG: ate:Athe_0444 protein of unknown function
FT                   UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41731"
FT                   /db_xref="GOA:D9TI99"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TI99"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADL41731.1"
FT                   /translation="MKEIISYSYEETVAIGYNIGKNLFKGSIVALEGDLGSGKTALTRG
FT                   IAKAFGIEDISSPTFTIFHVYEGKDDILVYHFDIYRIEETELEDIGYEEYFYGDGIVII
FT                   EWADKLKRLYPKECLKVCIQKIDENVRNIVITGIGERYKKVEDVIERDEDIGD"
FT   gene            473167..473832
FT                   /locus_tag="COB47_0396"
FT   CDS_pept        473167..473832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0396"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   ate:Athe_0445 peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41732"
FT                   /db_xref="GOA:D9TIA0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA0"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADL41732.1"
FT                   /translation="MKILAIETSGKVASAALLEDCKVISEVVLNTKLVHSVMLIDLIDQ
FT                   VLKNASVNIAEIDLFAVAVGPGSFTGLRIGVSTIKGFCYATSKPCVGVDTLKALCYNFW
FT                   ACSDFLMPILDAKSQKVFTGIFRFEDGKLKTYHPTSIVDIEEAKELAKKYNPVLLGEGL
FT                   DVYDFSQFKLSPKFLQYQKASNVGLLAYELAQEGEVISHFDLVPVYLKKSYAEREQGT"
FT   gene            473829..474272
FT                   /locus_tag="COB47_0397"
FT   CDS_pept        473829..474272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0397"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; KEGG: ate:Athe_0446
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41733"
FT                   /db_xref="GOA:D9TIA1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA1"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADL41733.1"
FT                   /translation="MTKGVIRRMTEKDIDMVHEIEILSFSVPWSKESFIDEVKNENAIY
FT                   YVYEEDSKVWGFAGMHHIVDEGHITNIAVHPQKRGQGIGRLLLSALISYAKENGLVGLT
FT                   LEVRSKNYVAISLYKSLGFVQEGIRKNYYSDPPDDAIIMWLWL"
FT   gene            complement(474332..474463)
FT                   /pseudo
FT                   /locus_tag="COB47_0398"
FT   gene            complement(474541..476190)
FT                   /locus_tag="COB47_0399"
FT   CDS_pept        complement(474541..476190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0399"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   ate:Athe_0447 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41734"
FT                   /db_xref="GOA:D9TIA2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL41734.1"
FT                   /translation="MYEKNKDLNCKANNYAAKISIIYAVASAIWILVSDMLTTKLLSSK
FT                   NLFAMFSIIKGWLFVLVTASLLYFLIRKKIYSLYLSENNLQNALNELQKTNAELSKTQE
FT                   KLVVQYKKLAKNQEKIKELAYFDQLTGLPNKNHFMLTLEKTIKESNFKGQQFALILIDI
FT                   DNFGKINNTLGHTTGDIVLKEIAQKLKESIGTNGFVARLTGDEFGIVVYSFPDLNILNY
FT                   FIYKIFNSFSTSWEIMKYNFYITPSMGIAIYPSDGKDSTSLLTNADKALKLAKEKGKNT
FT                   FCFYSLEMDNILQQRLEFESDLRKAIEEEQFILYYQPIVDLKKIQLCGAEGLIRWIHPQ
FT                   KGIIPPMSFIPIAEQTGLITQIGKWVVTKVISDLKNIREVVNYNFYISFNTSLREFSSA
FT                   NFIDDVLYTIETSNIDPAYLGIEITESVAMADPQNTIKSLKTFKEKGMKVLLDDFGTGY
FT                   SSLNYLKELPIDVVKIDRSFIANMNKDIKEQKIAKSIIDLSHILELKVVAEGIEDSQQA
FT                   EILKSFECDFGQGYLFGKPLPKDQFMELAKRF"
FT   gene            476382..478859
FT                   /locus_tag="COB47_0400"
FT   CDS_pept        476382..478859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0400"
FT                   /product="pullulanase, type I"
FT                   /note="TIGRFAM: pullulanase, type I; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; KEGG: ate:Athe_0448 pullulanase, type I; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41735"
FT                   /db_xref="GOA:D9TIA3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011840"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA3"
FT                   /inference="protein motif:TFAM:TIGR02104"
FT                   /protein_id="ADL41735.1"
FT                   /translation="MIVKAYIDDFNEIIVILSQMVHSVKKEDFKIFLNEEEIDIERIDK
FT                   IVPHSDSPYEAEMRGYEICEEKGKIRFVLKEGYFDYHRKPLSKPVFVIGEMNNWQISPE
FT                   WEMTYSKLRGRYELIKDLKEIKIGQKFKFAEGASQKLWYPPGFGNDIVINEYFDRESAF
FT                   TNMIKIVTSKRLLPNLKYKITYKTEHIWARPRGILTAPEFFYPYELGMKYESYGTYFKL
FT                   WAPSAYKVKIKIFDESENYRFEKEMAREENGVWNIYLTGNLKNHYYLYEVWHYNYDDDE
FT                   GFVVYEVPDPYSRASSSNSQKSFIFDPADIQIEGWQQDTYIKNIEKQQDAIIYEMHVRD
FT                   FTIDKTSGVEERLRGKFLGLCQQSYYKEKFSTGLLHLKELGITHIHLLPISDFGSVDDK
FT                   NPDKKYNWGYDPVLYQCPEYWYSTKSGGIEALKELKTMVKTLHENNIGVVMDVVFNHTY
FT                   HIKGGRFSIFDKIVPGYFYRIDDYGEYSNATGCGNEIATEKPMVRKFILDTIIYWAEEF
FT                   HIDGFRFDLMGLIDTQTMRTIAREVRKRNPKALIYGEGWVMGDSLCLVEERATIESSAH
FT                   KGYSIGLFNDRIRDSIRGDLDGFRTGYMHGNLSDVERLKQGIKAAIDDFAKEPDECVNY
FT                   VSCHDNLTLFDKAQKTMVGEDIFWIDRACRLANAIILTSQGIAFLHGGVEFNRSKGGHP
FT                   NTYNAGDSINKIDWSLKEKFYDTFKFYCDLIKLRKEHLAFRMRSSGEIRKYLKFLPASD
FT                   GIVAFLISYPYDVWKKIIVAYNPFKEKKVIALPDGIWKIKANDGVIFSEENEQEAIGSF
FT                   EIAPSSLFIAYQE"
FT   gene            complement(478943..480088)
FT                   /locus_tag="COB47_0401"
FT   CDS_pept        complement(478943..480088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0401"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   ate:Athe_0449 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41736"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA4"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADL41736.1"
FT                   /translation="METFWLFIICSLLFALNFFITKKFGLKSVEYEIHFEENKKSEGDE
FT                   IHIIERIYNGKILPLPWVKSEFEVSAFFFMENAKNYVVGDKLRYISIFFFLPYQQIVRR
FT                   HRFVATKRGFYKLDKIYLVTGDLFGLSTDDRCYYVNSNITIYPAFLDLKKHLLPRSSLS
FT                   GEVVVKRHYYEDIFHFAGIREYQSFDSFNRINWNATAKYNTLMVNKYEYTSSGEALILL
FT                   NVQSSEYERKEVFNKNAIEFGIKIAASLAKECLDAHIPVGFVCNGVDEETLQPLEILLP
FT                   SQDSNQLLKILETLAHIKIQVNEYFEVLLYQVLRSYNFRELFIITSFVNKEMEDSILLY
FT                   SSLGVKFTIILLEYNDKALNLESENVRIFLAKQNILESTRA"
FT   gene            480378..480464
FT                   /locus_tag="COB47_R0008"
FT                   /note="tRNA-Leu1"
FT   tRNA            480378..480464
FT                   /locus_tag="COB47_R0008"
FT                   /product="tRNA-Leu"
FT   gene            480603..481361
FT                   /locus_tag="COB47_0402"
FT   CDS_pept        480603..481361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0402"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ate:Athe_0450 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41737"
FT                   /db_xref="GOA:D9TIA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41737.1"
FT                   /translation="MIVKNILIADENEYVRKAIRERFENSFDPIHHYMFFEAVDGEEAL
FT                   NKIGENNIHIAIIDTNLSKINGFEVLRTIKRSPVKAHIPVILLSSNIHRATRLKAYELG
FT                   AVGIIPKPFSTLEVFNIVKSLLYTQDEYLHIHEIMHIISFLEQMSNKHIIVVPKIVDEF
FT                   LSEYFTSYKFLAVNASTGELLYNRDFDEDEIKEILSYLKNGQKINSNALTIKINVKNEI
FT                   FHFIFKIFSDNKRFVLLKKVLDFWSELNDR"
FT   gene            481351..482571
FT                   /locus_tag="COB47_0403"
FT   CDS_pept        481351..482571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41738"
FT                   /db_xref="GOA:D9TIA6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0451"
FT                   /protein_id="ADL41738.1"
FT                   /translation="MIDSINFVILCVICIVILLIVTSGIVFLYKIINSIRQGKMRQVFE
FT                   NYSKIVYDVITGKRSIISAENFYLLSDVINTNYPWIDGEEKKNLYVALKNSDFFDFAID
FT                   KIQKGNRAQKLRFAKVLSVVGGEDELKMLLNMSIKAPYLIDITAEAIFKNIDKIQDLNI
FT                   FKPFLKTVFLEMDKYPYAIRRRIEFFAVYGGEKIKDILFYVIKENPSDKVLISCLNIFS
FT                   EIATLEDLKNIDFLINHSSPEVRAAFCKATEKVGCINCAEKLETLINNEKVNFVKLRAL
FT                   RALSNVYPKSSLKYLLSALEDDWFYMRDFAKNMLSEFGPVVLKELLTFYFSTNDKFAKD
FT                   KIREVFYSPVNFEYIIKSFLNYRTDYEKNLALEIIKILESSNPQCFYQRLKEEGYDYLI
FT                   TIKRGSE"
FT   gene            482576..483970
FT                   /locus_tag="COB47_0404"
FT   CDS_pept        482576..483970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0404"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ate:Athe_0452 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41739"
FT                   /db_xref="GOA:D9TIA7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL41739.1"
FT                   /translation="MKQIMLWFSWFVSYYVLVLNTIYAVLILISLFGIVSYWRNKIKGR
FT                   IVEIVSSDFAPPVSLLVPAYNEEETIAKSVKSFLQIDYPEYEVVVINDGSKDGTMDVLK
FT                   SEFELYIVDRKFRKVLPTKDIKAIYYSKKYSNLIVVDKENGGKADALNAGINVCTYPYV
FT                   CSLDADSILERDSIAKVMQPFFDNPDEVVVTTGIVRIVNGCKLDTFGNIQELHLPKSAI
FT                   AKFQIIEYLRAFLGARKGLSMIGSLVIASGAFAAFNKNAIVKVGGFSHKTVGEDMEVVV
FT                   KLRKNSYKEGGHGKVEFVPDPIVWTQCPESIQDLSKQRRRWQRCLCQVLFMHKDLLFNP
FT                   RYRMLGLFAMPYQFIFELLGPFVEIMGYIFIPFAYFTHIINLEVALFFFVVEILYGIVI
FT                   SILAVLLGEFSEKKYEEWREFGLLVLFAILENFGYRQMTVLFRIIGTFEAILNKKGWAK
FT                   PERKKL"
FT   gene            484051..484470
FT                   /locus_tag="COB47_0405"
FT   CDS_pept        484051..484470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0405"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="KEGG: ate:Athe_0453 hemerythrin-like metal-binding
FT                   protein; TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41740"
FT                   /db_xref="GOA:D9TIA8"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA8"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADL41740.1"
FT                   /translation="MPQIEWLDQYSVGVESIDNQHKELFERVNRLLNACAQGEGKKVLP
FT                   EVLDFLGDYVVFHFSTEEKYMKEYLYPDYLTHKKEHDSFVETYKKFREEIEKEGAGVAA
FT                   VIKTNKLIVDWLKNHILGTDRKLGVFLKERKIQTE"
FT   gene            complement(484530..485072)
FT                   /pseudo
FT                   /locus_tag="COB47_0406"
FT   gene            485198..486526
FT                   /locus_tag="COB47_0407"
FT   CDS_pept        485198..486526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0407"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: csc:Csac_0465 RNA methyltransferase; TIGRFAM:
FT                   RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41741"
FT                   /db_xref="GOA:D9TIA9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIA9"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADL41741.1"
FT                   /translation="MKIDTLNHQAQGIARIGGFVVFVDNVLVDEVVKIKIEEVKKEYAR
FT                   AKLIKILEKSPHRKQPECPYYYLCGGCHLMHAKYQYQLSLKKLLVEDAFRRIGKLNPRI
FT                   NDVIGMEKPFRYRNKTALPVGEDYKNPQIGFYKKMTHDIVDIDYCLIQHEVCDDVIKGM
FT                   KDLIRKYNIEVYSEKKHQGVLRHIVVRNSFAFNEMMLILVCTKVPEDLENIKKDILNKF
FT                   PNIKSLYVNLNPKRTNVILGEEDILIWGSNTIKDKIGNLIFEISPKSFFQVNSIQTELL
FT                   YNQVVKYLRNIDAEVVFDVYSGIGTISMFVAPFCKKVYSIEIVEDAVEDAKKSSKNNGI
FT                   SNIEFICANAEIEIPKLMEKGIIPQVVILDPPRSGCEKALLESLIKQKIPNIIYVSCNP
FT                   STLARDSSILCSNGYEIVEVQPVDMFPQTFHVECVVLMSRVDK"
FT   gene            486610..487220
FT                   /pseudo
FT                   /locus_tag="COB47_0408"
FT   gene            487189..488727
FT                   /locus_tag="COB47_0409"
FT   CDS_pept        487189..488727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0409"
FT                   /product="transposase"
FT                   /note="KEGG: ate:Athe_0076 transposase; TIGRFAM:
FT                   transposase ; transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41742"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB0"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADL41742.1"
FT                   /translation="MITVQTKLIFEGSEDKQKVLDLMRRWSSCMRYAYKRLLEGHKRNE
FT                   LKKQLQGIFNLNSRYVDDAIMKAKSILTSCKERGENPKKVVFGGRQLFEKLQKRHINGK
FT                   AYKKLQLKWQEKRKGNLYSRGDRSKKGNLNTRIEIDEDCTRLRINVGEREYVYARIQPG
FT                   WKIKDGRYIDRNQLLEAISICGQPYSVQLKLKSGVVYAYFAIEEVFPQPAITRANGVIG
FT                   IDTNAYPRHVAWVETDEHGQLLGYGRIPMPELESGSFEKKEYYRWQYAHMIVQMAKEKQ
FT                   KAIVIESLSIKDRGRREDFSGRRSRRIRHYFGYRSLLEKVKLLAKREGIEVIEVNPAYT
FT                   SVIGMLKYAPQFMVSKDVASSYVIARRGLGLRDRIPHNYMMFLGRLDVNELEELKEYVR
FT                   KVVKNTYVRKKQLREIGRVIKFLQSLESETERLSVPLDGTSTGSRGKNHNLWQVLRVAV
FT                   VTPLSPERVLRDLSVLKSLLVSGQVGKTYKGASSCFLGQGLWLSQIPPAGAGKA"
FT   gene            488804..490039
FT                   /locus_tag="COB47_0410"
FT   CDS_pept        488804..490039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0410"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pth:PTH_0766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41743"
FT                   /db_xref="GOA:D9TIB1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL41743.1"
FT                   /translation="MSNNSKNQFTSATILIIIFGIISMLGDVIYETARSANSQYLNLLG
FT                   VSAAQVGLVFGIGEFLGYFLRLVAGSLSDKSGKHWIFMFLGYGMLLVVPLMGFSMNWKI
FT                   LFVLILMERIGKALRSPAKDTILSCVAEKEAGVGFAFGLQEALDQIGAFIGPLILTMFF
FT                   HFSGKNGITQYQLGYKSLFIPFVILMLFLIYAYGKIKRENLIPAGIKKDFHTERLKPIF
FT                   WIYTAFTFFCTLGFVNFSTIGYHLKAKNLMSDESITLLYSIAMVVDAVTALLIGKAYDR
FT                   LKVKTENKTGGLLVLMAIPFLTLLLPFLTLSNSAVLIVIGMIIFGIVMGTHETVMRSAI
FT                   ADITPFYKRGTGYGIFNTSYGLALLGGAALMGLFYDMNMIKIIIAITCITELIAIILYF
FT                   KMNNMVRNSNQV"
FT   gene            490192..490575
FT                   /locus_tag="COB47_0411"
FT   CDS_pept        490192..490575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0411"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   ate:Athe_0456 protein of unknown function DUF1232"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41744"
FT                   /db_xref="GOA:D9TIB2"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB2"
FT                   /inference="protein motif:PFAM:PF06803"
FT                   /protein_id="ADL41744.1"
FT                   /translation="MKKNIKGKVKLLKKQIPAIFLAMKRRDTPLLAKIFALITIAYALS
FT                   PIDFVPDFIPILGYLDDIIILPLLVTITIKLIPDFILNECQKEAENLWQEGKPKKWYYG
FT                   IPIIIFWSLIIGVIIYKIVEGIS"
FT   sig_peptide     490192..490323
FT                   /locus_tag="COB47_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.634) with cleavage site probability 0.632 at
FT                   residue 44"
FT   gene            490594..491076
FT                   /locus_tag="COB47_0412"
FT   CDS_pept        490594..491076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0412"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: csc:Csac_1088 methylated-DNA--protein-cysteine
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41745"
FT                   /db_xref="GOA:D9TIB3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB3"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADL41745.1"
FT                   /translation="MKISIGYLLSPIGLIKIVGQDNSIVSVKFVSHKDEDELISPVIKE
FT                   AILQLKEYFEGKRTSFELKLQLQGTEFQKRVWNELIKIPFGCVISYKELAKRVGKTQGA
FT                   RCVGNAVGKNPAVIVVPCHRVVKSDLALGGFSGGLEKKIWLLSYEGWKIENGLLIK"
FT   gene            complement(491105..492463)
FT                   /locus_tag="COB47_0413"
FT   CDS_pept        complement(491105..492463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0413"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: ate:Athe_0458
FT                   beta-galactosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41746"
FT                   /db_xref="GOA:D9TIB4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB4"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ADL41746.1"
FT                   /translation="MSFPKGFLWGATTASYQIEGAWNEDGKGESIWDRFTHQKGNILYG
FT                   HNGDVACDHYHRYEEDVSLMKELGIKAYRFSIAWARIFPDGFGTVNQKGLEFYDKLINK
FT                   LVENNIEPVITIYHWDLPQKLQDIGGWANKEIVNYYFEYTMLLINRYKDKVKKWITFNE
FT                   PYCIAFLGHWHGVHAPGIKDFKVAMDVVHNIMLSHFKVVKAVKENNIDVEIGITLNLTP
FT                   VYLQTERLGYKVSEIEREMVKLSSQLDNKLFLDPVLKGSYPQKLLDYLVQKNLLDSQKA
FT                   NNMQQQVRENFIFPDFLGINYYTRSVRLYDENSGWIFPIRWEHPEGEYTEMGWEVFPQG
FT                   LFDLLTWIKESYPQIPIYITENGAAYNDKVEDGRVHDQKRVEYLKQHFEIARKAIENGV
FT                   DLRGYFVWSLIDNFEWAMGYTKRFGIIYVDYETQKRIKKDSFYFYQKYIKENS"
FT   gene            complement(492719..495091)
FT                   /locus_tag="COB47_0414"
FT   CDS_pept        complement(492719..495091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0414"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; carbohydrate binding;
FT                   glycosyltransferase 36 associated; KEGG: ate:Athe_0459
FT                   glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41747"
FT                   /db_xref="GOA:D9TIB5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037828"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB5"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADL41747.1"
FT                   /translation="MNFGYFDEQKREYVITNPKTPTSWVNYLGTSDYCLIISNNASGYS
FT                   FYKSPKLGRVTRFRFNSIPMDRPGRYVYLKDEKTNDFWSISWQPVGKPLDKFLSICRHG
FT                   LGYTIFESKYNSIISSLKIFVPVDKPLEIWEVKIKNDSNEKKEFSVFTYTEFCLWNSML
FT                   DMMDFQYILYTCRMGYNKEDEIIDYSIKLWSPYEPKAFFTCANKKIESFDTDRDVFIGP
FT                   YNSESNPEAIKNGKCFGSIAIGGNPCAATQVKIELQPGQEEYLVFLLGIGNAYKEGREY
FT                   KKIFASIDSVEKEFKKVQEYWKERLNKFECNTQDEKMNLMLNIWNQYQCHTTFNWSRSA
FT                   SFIEAGGRDGLGFRDSSQDILGVVHSIPQEVRRRLIELLKAQLSEGYAMHHFQPLTMSQ
FT                   GKHNIPPRERIYSDDHLWLLIAVPAYIKETGDFSILDEIVEYADSGSASVYDHLKQALE
FT                   FSWNNRGKHGLLLGLAADWNDCINLKDGGESTWSTQLYYKALSEFIDLAEYIGKTDDVE
FT                   KYKKYRDEIKRALEEFTWDGEWFVRGYLASGKKLGSKESEQSKIFLNSQSWAVFSGAFL
FT                   DEKGKTAMDSVKKYLATEHGCVKNWPAYVDYIIEVGAITSFPPGLKENAAIFCHANTWV
FT                   IIAEALLGRGEYAFEYYMSFLPANKNEIAEIYTAEPYVYSQFITGKEHPYYFGRARNPW
FT                   LTGTATWAFTAATQYILGIRPHYNGIIIDPCIPSSWDGFEVKRIFRGKKLLIKVLNPEH
FT                   VSKGVKKVIINGKEIKSNLISEALLDEENVIEVIMGL"
FT   gene            complement(495116..497551)
FT                   /locus_tag="COB47_0415"
FT   CDS_pept        complement(495116..497551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0415"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; carbohydrate binding;
FT                   glycosyltransferase 36 associated; KEGG: ate:Athe_0460
FT                   glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41748"
FT                   /db_xref="GOA:D9TIB6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037825"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB6"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADL41748.1"
FT                   /translation="MKFGYFDDAKREYIITTPLTPYPWINYLGMKDFLSLISNHAGGYC
FT                   FYKDARLRRITRFRYNNVPLDMGGRYFYVKDGDDFWSPSWMPTRKDLEFYQCRHGLGYT
FT                   IITGRRNGIEVEQSFFVPVDENCEIHHLKITNMTNDKKDIKLFSFIEFCLWNALDDMTN
FT                   FQRNFSTGEVEIEGSVIYHKTEYRERRNHYSFYSVNTPIAGFDTDRDTFLGLYRGFENP
FT                   LAVETGKSFNSEAHGWSPIASHMIELSLLPGETTELIFILGYIENEPDKKWFKKGIINK
FT                   EKAYKMIEKFSKPEDVNAAFEKLKEFWNRLLDKFNVSTGIDKVDRMVNIWNQYQCMVTF
FT                   NLSRSASYFESGIGRGMGFRDSNQDILGFVHQIPERARERILDLAATQLEDGGAYHQYQ
FT                   PLTKRGNNEIGGNFNDDPLWLILSTVHYIKETGDWSILNEMVPFENNPEKMGTMFEHLK
FT                   RAFYHVVNNLGPHGLPLIGRADWNDCLNLNAFSTNPDESFQTCDNKDGKTAESVMIAGM
FT                   FVYVGKEFVKLCEKTGNFELAKDAQNHIDKMKEAILKYGYDGEWFLRAYDYFGNKVGSK
FT                   ECDEGKIFIETQGFCVMAQIGLDDGKAISALDSVKKYLDTEHGIVLVQPAFTEYKIHLG
FT                   EITSYPPGYKENAAVFCHNNPWIMIAECIVGRGDRAFEYWSKIAPSYREEISEIHKIEP
FT                   YVYCQMIAGKDAYKPGEAKNSWLTGSAAWNFVAMTQWILGIRPDFDGLLIDPCIPASWE
FT                   GFKVKRVFRNAIYNIEVKNPNKVSKGVKKVIVDGNEISSNLIPAFSDGKEHFVEVIMG"
FT   gene            497728..499035
FT                   /locus_tag="COB47_0416"
FT   CDS_pept        497728..499035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0416"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ate:Athe_0461 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41749"
FT                   /db_xref="GOA:D9TIB7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADL41749.1"
FT                   /translation="MIYSIWTFILKTLQKKLKKSILQKGRKELKNVWIFNHYAIPPKVG
FT                   GITRHFDFAKQLVQRGYSVTIFASSFDHKQRVEMLEKGKKFKMEKYDKVRFVWIKTFPY
FT                   KKNDIKRLLNIFSYAKNLYFIARKFERPDVILASSFHPLAWIVGYLLSKKFKCKFIAEV
FT                   RDLWPQSGIDLGAFKEGSLIVRLLRKLEKFIYTKADYVMTVLPKADQYIESLGIDKNKI
FT                   VHIPNGCDIERFDSLRNSISEEVSNILREHEGYFKACYLGALGQANAMETIIEAAKIVQ
FT                   ENAGDSIHFLIIGDGPEKEKLQNMAKEFELKNVFFYPPIAKLSVPALLEHVDVTLVSMH
FT                   NLKVYRFGISLNKLFDYLCAAKPIVFAGNVVNDIVKESGAGISCQAYDSKAFAQAILRF
FT                   CAMSKEEREEIGKRGREYVQKYHDIRMLATRLEKIL"
FT   gene            499053..500399
FT                   /locus_tag="COB47_0417"
FT   CDS_pept        499053..500399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0417"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: ate:Athe_0462
FT                   exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41750"
FT                   /db_xref="GOA:D9TIB8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB8"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADL41750.1"
FT                   /translation="MKSYIKSYHKLSKFFVVLIDILLIHAGYILAYIIKFNFTFPERNF
FT                   MPYYTLIPQITLFALVLLNIYGLYTITMKTISEIAFSLGLALMLLQFLTVVSTFFYRHF
FT                   AFPRSIFIIAFFVQFLLLLGWRGFVLYVFKRVQGIKYVLVIGETSRAHEFAQKLQNISK
FT                   GWIEVKYVLEPTTIEELIPYIKVVDTIYLYSKMDENLKSEIVRKAIEFKKHIFIAPDFR
FT                   DILVSRARVIQFDDVATLSIEQPELTSEQKLIKRVCDILLASVALVIAFPIMILIAIAI
FT                   KLDSEGPVIYKQKRVTEGEREFYVLKFRTMVKDAEKMTGPVLATENDPRITRVGRFLRA
FT                   TRLDELPQLINILKGEMSFIGPRPERPYFVEQFKKLYPEYSLRHNVKAGLTGLAQVYGK
FT                   YATSPEDKLRLDLIYIKNYSVFLDIKILLLTLKTIFTKEAAEGVKNQKG"
FT   gene            complement(500474..500656)
FT                   /pseudo
FT                   /locus_tag="COB47_0418"
FT   gene            501692..502411
FT                   /locus_tag="COB47_0419"
FT   CDS_pept        501692..502411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0419"
FT                   /product="Conserved hypothetical protein CHP02391"
FT                   /note="PFAM: Conserved hypothetical protein CHP02391; KEGG:
FT                   cpo:COPRO5265_0050 ymh, putative"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41751"
FT                   /db_xref="InterPro:IPR012654"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIB9"
FT                   /inference="protein motif:PFAM:PF09509"
FT                   /protein_id="ADL41751.1"
FT                   /translation="MNYRMIAIQVGDLLKYDTSKNDIERAANSVFNFQREDFPKEAITS
FT                   ERAKLIHDWILTLAKQKMNNDGRNRLLRKFLYLITPEDKVAEVEKILREAGVNLHIDDA
FT                   LNEFYSRNYHYLICKHCLQLYKQKNYFHAVFEAAKVYNKMVKEKTQSDKDGYELMMDVW
FT                   ALKGVLKVTPCETDTDKNVQEGLKFLSAGLMRAIRNPTAHEPALDWPISKDDCLDLLSF
FT                   ISFLLRQLDKAVYYKGN"
FT   gene            503340..504287
FT                   /pseudo
FT                   /locus_tag="COB47_0420"
FT   gene            complement(504685..505017)
FT                   /locus_tag="COB47_0421"
FT   CDS_pept        complement(504685..505017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0421"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="KEGG: transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41752"
FT                   /db_xref="GOA:D9TIC0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC0"
FT                   /inference="similar to AA sequence:KEGG:TherJR_0136"
FT                   /protein_id="ADL41752.1"
FT                   /translation="MYRQGDILLIPIPFSDLTSNKKRPVLVLSNDDYNNRTEDILVAAI
FT                   TSNLTAKDYIVMLTNHDLAEGTLKVDSCVRVDKIYTLSQSIVINKFGSVKKHIIERVKE
FT                   KLYELI"
FT   gene            complement(505010..505207)
FT                   /locus_tag="COB47_0422"
FT   CDS_pept        complement(505010..505207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41753"
FT                   /db_xref="InterPro:IPR018739"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC1"
FT                   /inference="similar to AA sequence:KEGG:Csac_1094"
FT                   /protein_id="ADL41753.1"
FT                   /translation="MKVNKNLLLELIEEIPESQLEEVIDFILFLKHRQDKKLLSDLVSA
FT                   SESSIDFWNNDIDDEVWNNV"
FT   gene            complement(505315..505679)
FT                   /gene="ssrA"
FT                   /locus_tag="COB47_R0009"
FT   tmRNA           complement(505315..505679)
FT                   /gene="ssrA"
FT                   /locus_tag="COB47_R0009"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 202.41"
FT   gene            complement(505680..506156)
FT                   /locus_tag="COB47_0423"
FT   CDS_pept        complement(505680..506156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0423"
FT                   /product="SsrA-binding protein"
FT                   /note="KEGG: ate:Athe_0463 SsrA-binding protein; TIGRFAM:
FT                   SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41754"
FT                   /db_xref="GOA:D9TIC2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC2"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ADL41754.1"
FT                   /translation="MSEKNKQNDIKVIATNRKAYHDYFIEETIEAGIELKGTEVKSVRL
FT                   GHVNLKDSFARVEDGEVFLYNMHISPYEKGNIFNVDPMRDRKLLLHKHEINRLAGYVQQ
FT                   KGYTLIPLKIYLKRGKIKVELAVAKGKKLYDKREAIAKRDAELEIKKKMKEYLR"
FT   gene            complement(506270..509689)
FT                   /locus_tag="COB47_0424"
FT   CDS_pept        complement(506270..509689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0424"
FT                   /product="SNF2-related protein"
FT                   /note="manually curated; PFAM: SNF2-related protein; SNF2
FT                   helicase associated domain protein ; helicase domain
FT                   protein; KEGG: ate:Athe_0464 non-specific serine/threonine
FT                   protein kinase; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41755"
FT                   /db_xref="GOA:D9TIC3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC3"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ADL41755.1"
FT                   /translation="MSIELNYQTIVQFLTDSQLAQLAKNRKAFEKGISLARKVEKEDIQ
FT                   YDQEENAIFGKVEDGKNEYWVFVDFDLPSYMTQDFFGNIKIENIIISAACTCSLENIDL
FT                   ESEEDIDIEDLVLFDDFCRHIIAVLKSFADGKYILNSLNKMQETLLQMLEQKLNEAIEK
FT                   ERKQNSRIYQFFASNFEENYIKFSLDNLSIKSPNIFLEKYFGYSTNDLVTLKLKVKTLD
FT                   LKRDYVVSNIPEFLKAYEQKQPFQFGKNFVYNPTYHFFGEKDKKFLNALLKYLNFLDLE
FT                   TEKNTIYLPVKIANEIIEILDNEEIFISFDYFVANYYDAQKVKVDLCTKVKPKILFKLE
FT                   DNQVKLYSDLIDTANKKFLYSDGSYFVSGDTLYKLSPEQKIFSSIIKKMAEANRVFNFF
FT                   KVEYVNFFTLNKEDFCEFMNKYYLFLNEHFELEIDPDLKKLILEDYIIKPKLYLEFENE
FT                   RFVARISGMNEIFDIISKTKKVPLFDYFGLFEIQSILFAYRFNEIESDQEFCYECVDPD
FT                   LFMEFLAEGIPQIQNITDVYYSEDFKKLKIKKDVKIIPCLKYSKHSIDFWLESDDLDSS
FT                   ELKNILDAIKKKKKYYKLKDGSILILESPNIKRFVSFIESASDIGQVIKEKAELSLQEA
FT                   VAVTKLLEESGIQANGVESIKNIVEKIENIREIDIEIPVELQGVLRDYQKLGIKWLSSL
FT                   FENELGGILADDMGLGKTLQVLGFILANKQKIKKPVLAIVPTSLIYNWKQEIEKFAPGL
FT                   KTLIIDSTPAKRKKAIEKIPEYDIVITSYALLRKDIEFYKDIDFSVCILDEAQYIKNPH
FT                   SQIKLAVKEICADAKFALTGTPIENNLIELWSIFDFILPGYLGGAEKFVERFAMLIYSG
FT                   NNNALEKLKKLIKPFVLRRVKQDVLNELPELIETNIQVAMSPEQEKIYKQFLVSAKKEI
FT                   EKEIDSAGFEKSQIKIFSLLTRLRQICCHPKLVFEDYKGSSGKMEALKEILQDCLESGH
FT                   RVIIYSQWTSMLSIIKKMLDKEKILYFYLDGATKAEDRVEMVNRFNSGEKNVFLLSLKA
FT                   GGFGLNITGADVVIHFDAWWNPAVENQATARSHRLGQKNVVQSFKIIAKNSIEEKILAL
FT                   QQKKKDLFDSLIEASQSFIGKLTKEEIMELLE"
FT   gene            complement(509886..510908)
FT                   /locus_tag="COB47_0425"
FT   CDS_pept        complement(509886..510908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0425"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ate:Athe_0465
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41756"
FT                   /db_xref="GOA:D9TIC4"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC4"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADL41756.1"
FT                   /translation="MKYRRLGRTNIEVFPIAFGGIPIQRIDEESAIKVIRRAIELGINL
FT                   IDTARGYTDSEIKIGKALRGINKTVYLASKSANRTKEGILRDIEISLKNLGVEQIDIYQ
FT                   LHGINDLDTFNKVFAEDGAFWGLVEAKEKGLIRFIAASSHSVDVLEKLINTDKFDVIQL
FT                   CYNIIETDVEDKIFPLALEKDIGIIAMKPMGGGVIPNPALSLKYVLQKEFVVPDPGIET
FT                   IEELEENVKVAMHIEPLTEEEKREIERIRKEMGKEFCRRCNYCQPCPQEIPIWVILHAD
FT                   SAMKRLPYQTLKSGWFYDAYRKAKNCIKCGVCITRCPYNLPIPDMIEKKLEIIRVTIGD
FT                   "
FT   gene            complement(510905..512671)
FT                   /locus_tag="COB47_0426"
FT   CDS_pept        complement(510905..512671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0426"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: csc:Csac_1116 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41757"
FT                   /db_xref="GOA:D9TIC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL41757.1"
FT                   /translation="MGYLIKLVKMARPYWKYLIIAAFSMLAITALNLLGPWLVRNLTGI
FT                   ITAAGKYPNARKTIINISLILVLSYILRIVFQFLNSYFSHYAAWHLVADVRTKVYEKLQ
FT                   SLSFGYFVDKQTGQLMSRVVNDTANFEVLIAHAVPDLFTNALIIFGVAVILFIINPVLA
FT                   AISLIPIPFLVLSGTVFAKKILPNFREAQKALADLNADLQDNLSGIREIQIFNKQEKEL
FT                   LKIKEKIYRHIHALLSALKLSAVFHPTVSFLSSVGTVIVVSVGGLMALRGKVPVKDIVG
FT                   FILYLSMFYQPVTALSQVIENVQQALAGAERVFEILQTESEIKEKENAQKLKNVKGKIT
FT                   FENVSFSYNPEIQVLKNISFEIQPGEMVAFVGPTGVGKTTIMYLLNRFYDPDSGVIKID
FT                   DIDIKDVTLKSLHDNISMVMQDVFLFNGTVAQNIAYGKENATMDEIIQAAKIACAHEFI
FT                   QNLPQGYNTVIGERGVKLSGGQKQRLAIARAVLKNAPILILDEATSSVDTETENEIQKA
FT                   INNLAGTRTILIIAHRLSTVKKADKIIVLKDGEIVETGTHDELFAKKGFYYHLCSVQLF
FT                   DESNNLIRGNTL"
FT   gene            complement(512692..513462)
FT                   /locus_tag="COB47_0427"
FT   CDS_pept        complement(512692..513462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0427"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="KEGG: ate:Athe_0467 CRISPR-associated protein Cas6;
FT                   TIGRFAM: CRISPR-associated protein Cas6; PFAM: protein of
FT                   unknown function DUF57"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41758"
FT                   /db_xref="GOA:D9TIC6"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC6"
FT                   /inference="protein motif:TFAM:TIGR01877"
FT                   /protein_id="ADL41758.1"
FT                   /translation="MKGRKNMRIKVDFESQKPIELPIHYNYFVQSMIYNTIDDKIYATF
FT                   LHDKGYEVDLKNFKLFSFSRLEGPFEIVGNDSNKKIVFDKKVSLTISSPVEDFITKFST
FT                   GLFKKDQIFLKDNILYVTSASILKRPKFLSFHKIKMLSPMCAYKTIRNESSEYKQFFTP
FT                   FEDEFYNLISQNLMKKCKLLIKDFEEKNFRFNLKPLKVEEKAHFKPMFFKKTPIKGWLG
FT                   FYTIETDPRIMEVAYYCGLGSKNSQGFGLFEIIE"
FT   gene            513656..515845
FT                   /locus_tag="COB47_0428"
FT   CDS_pept        513656..515845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0428"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="KEGG: ate:Athe_0468 glycoside hydrolase clan GH-D;
FT                   PFAM: glycoside hydrolase clan GH-D"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41759"
FT                   /db_xref="GOA:D9TIC7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC7"
FT                   /inference="protein motif:PRIAM:3.2.1.22"
FT                   /protein_id="ADL41759.1"
FT                   /translation="MPITFNPQTNMFFIEAKNTSYVIKLFKGKFLCHVYWGKKTREFEW
FT                   TDFDVTGGRAFGPTPDPNDKSYTFDTMLLEYPAYGNSDFRHPAYQVQQEDGSRITNLVY
FT                   KAHRIYDGKPKLEGLPATYVESSDEAQTLEIDLYDDLIDLKVTLIYTAFRDYDAITRSV
FT                   RFENLGKQKLKILRAMSTCVDFQEGDFELLHLWGAWARERYIERKEIIHGQQIIESSRG
FT                   ESSHQHNPFIALVRKDANEDYGDVYGFSLVYSGNFSAIVEKDQYNFVRVTMGINPFEFT
FT                   WILEPHSSFQTPEVVMVYSDQGLGKMSRTYHKLYRKRLCRGVWRDRRRLVLINNWEATY
FT                   FNFNEEKLLALAKEAKELGIELFVLDDGWFGKRDDDTSSLGDWFVDKRKLPNGLDGFGK
FT                   KLNEMGLKFGLWFEPEMISPNSELYRKHPDWCLQVKGRTLTQCRNQYVLDITREDVRKE
FT                   ILRMMKEILKTAPIEYIKWDMNRPLTEAYSLALPPERQKEVFHRYVLGLYQMMEELVTE
FT                   FPYILFEGCSGGGGRFDPGILYYMPQIWTSDDTDAIERLKIQFGTSIVYPASTMGAHVS
FT                   IVPNHQVGRITPMKTRGVVALSGAFGYELDLTKLSPEDKEEIKRQIETYKEIWHIVFEG
FT                   ELFRLISPFEEDAAAWMFVTEDKREAVVFYVEVLKSPNKHPRRLKLKGLLPEKKYFIKE
FT                   LNTSKFGDELMNLGIFIPEMWGDFNSKMWTLKALD"
FT   gene            515897..516715
FT                   /locus_tag="COB47_0429"
FT   CDS_pept        515897..516715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0429"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csc:Csac_1119 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41760"
FT                   /db_xref="GOA:D9TIC8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL41760.1"
FT                   /translation="MIRKLSSSDYDVLMDFVRKEKEWNIFIIGDIVSYGFDSPVVEVWG
FT                   EFDIVFGSLKAVLLRYRRDLIFYSDSEDYDIDSFCNIILTTKCKVLSGKKTVILPFLKA
FT                   LNVLQKREQFFMRLDTNIPKEKIETSLEEYERVKVISKDNLEENLDKIEMIVYLYQSIE
FT                   EFLNPATFEQIKQDVSLGRSRIYYIEEDGIIVSSARTGAELPDMAMVLSVCTMHEYRSR
FT                   GYATMCMKRLCTDLIKEGKSLCLFCDNPKAASIYRKIGFQQIGTWMTLGL"
FT   gene            517036..517818
FT                   /locus_tag="COB47_0430"
FT   CDS_pept        517036..517818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_1801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41761"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIC9"
FT                   /inference="similar to AA sequence:KEGG:CLH_1801"
FT                   /protein_id="ADL41761.1"
FT                   /translation="MKKLLFISKSIRLFLCFCLSILLLINVIYVRAQEQDKFLEDEILR
FT                   ASGMPQDEIDTLDNDIKKFVVDVQMFKKMSNEELNNFISNIAKLYFKSKTSKTSNIQTA
FT                   SVEQFNSIQLAWLAAAQIARNYGYSCAATLVEHSVKNIPYYEYGEGLFINKIRLTSVYK
FT                   DYISKLKSGKIKLNEKNSIVFEKEDNADLFYALHKVYIKSEKGLLSIYTITISDIFDFG
FT                   YDNYYDDLFTNIVNNWAWLCQQKQVLHPIDVTITLSEQ"
FT   sig_peptide     517036..517134
FT                   /locus_tag="COB47_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            517830..518399
FT                   /locus_tag="COB47_0431"
FT   CDS_pept        517830..518399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41762"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0470"
FT                   /protein_id="ADL41762.1"
FT                   /translation="MKKFVIFSVVFLSLILAPILFTILSPVILFSKDNVIREFEKNFNT
FT                   RLPKSTVSEKIYDDYGGFHNDGMKLYKFVFTAEGKKSFVSYIQKQKSWKNLPLSQAYQA
FT                   LIYGGEVKDFSGNITGFGGFAKEVGLPKISKGFWKAIGDRSVVTARFIDYENLDTKTLI
FT                   NLKSFDFYLAIYDTEKGVLYMLKVNT"
FT   sig_peptide     517830..517925
FT                   /locus_tag="COB47_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.857 at
FT                   residue 32"
FT   gene            518515..519249
FT                   /locus_tag="COB47_0432"
FT   CDS_pept        518515..519249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0432"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   ate:Athe_0472 protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41763"
FT                   /db_xref="GOA:D9TID1"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID1"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ADL41763.1"
FT                   /translation="MNNKNIAYVFIALILGISFTISSYFLANGLINFRAERKTISVTGS
FT                   AKKQLRSDLVKWTGMYTAVAKDLKEAYRLLEESQKKVKTYFLSKGLSEKDLIFSSISTQ
FT                   TIYEMLPNGIYSTKVDSYKLSQSIQITSKDVDKITELSRKSTELINSGVQFESMPPQYY
FT                   YTKLADLKIEMLSLATEDAVRRAKQIAKSTGSQVERLKSASMGVFQITPLYSTEVSDYG
FT                   INDTTSIDKEITAVVNCEFIIK"
FT   gene            complement(519302..520513)
FT                   /locus_tag="COB47_0433"
FT   CDS_pept        complement(519302..520513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0433"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: csc:Csac_1123 small GTP-binding protein;
FT                   TIGRFAM: small GTP-binding protein; PFAM: GTP-binding
FT                   protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41764"
FT                   /db_xref="GOA:D9TID2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID2"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADL41764.1"
FT                   /translation="MNTTPRSERLHIAIFGKRNAGKSSLINAITNQPIAIVSETPGTTT
FT                   DPVYKSMEILPLGPVVLIDTAGIDDVGELGKLRVEKTLEVLNKTDIAILVVSDIEDLSY
FT                   ERQLINLFNEKKVPKIGVLNKIDKDPSYKEKLSFLQQSLGIPFLAVSCATLKGIDELKS
FT                   SLAKLVPDVGEDLRIVGDLINPGDFAILVVPIDKAAPKGRLILPQQQTIRDILDSDAIA
FT                   IVTKEYELKETIENLGKKPAIVITDSQAFLKVDADTPPDIPLTSFSILFARYKGDLIEF
FT                   VEGVKKIKELKPGDTVLIAEACTHHRQADDIGTVKIPRWLRQIAGFDINFEWVSGYNYP
FT                   KDLTKYKLIIHCGGCMITRREMLFRIELAKQQNVPITNYGVTIAYVHGILPRALKPFGI
FT                   EFEY"
FT   gene            complement(520541..521926)
FT                   /locus_tag="COB47_0434"
FT   CDS_pept        complement(520541..521926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0434"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; Fumarase C-like; KEGG:
FT                   ate:Athe_0474 fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41765"
FT                   /db_xref="GOA:D9TID3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID3"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ADL41765.1"
FT                   /translation="MSRIEKDFLGSIELSDLELYGIHTKRAFANFNVSGNRVDKDLIKA
FT                   LVMVKKACAIANFEVGLLDEKIKDAIVFACDEILAGKYEDQFIIDKFQGGAGTSTNMNV
FT                   NEVIANVALIHIGKKPGEYDIVHPINHVNMSQSTNDVYPTALRIATIWNVRELSEECAE
FT                   LQKSLQKKEHEFEDIIKAGRTQLQDALPVTLGQEFGAYAQAISRDRWRLYKVEERLRVI
FT                   NLGATAVGTGVNAPLKYIFKVIEILRNLTKIGLARSDYLMDATQNADVFVECSGLLKAL
FT                   AVNLSKIANDLRLLSSGPNTGLNEINLPAVQAGSSIMPGKVNPVIPELINTIAFQVMAN
FT                   DFAITLAAQAGQLELNAFLPLIANNLLESLKILKNGIKIFREQCIDGIMANKEKCLEYA
FT                   KKTPAIAATLIDKIGYDKAAEIAKKAISENKPVIDVVKELNIMDEKEAQELLNPFEFIK
FT                   FRE"
FT   gene            522387..523373
FT                   /locus_tag="COB47_0435"
FT   CDS_pept        522387..523373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41766"
FT                   /db_xref="GOA:D9TID4"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0476"
FT                   /protein_id="ADL41766.1"
FT                   /translation="MKKNKVYIGFVMTFLLLFFTTFSATGASYSIEHNDEINILRRQYL
FT                   AESWLNLYISSLIKNCTKDSPALQSLNEITNINGPYNIEKFKLSKEYEYYRVFHIPTEV
FT                   KIAKNGRPYHIVRDEVKNKIKNLKFDSWRDVLNTEFVDKGWARIVYYDNVPVGHLLIEW
FT                   DSKMNNYIVNTGVLGDDSLGNAVNNLEKYLAQRGIKSDVKIVNIEEMTLYAVSGDGNWW
FT                   CAGAKGYENHIWDFGIIKDALNEIPVQILNAIEERSRLMREAPEKIMMGGEDPSKTLYF
FT                   IATKKERTQNVMIAISLLIMTAIVVICSKWKFSYQHLFYKHVRNRQK"
FT   sig_peptide     522387..522467
FT                   /locus_tag="COB47_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.897 at
FT                   residue 27"
FT   gene            complement(523467..523961)
FT                   /locus_tag="COB47_0436"
FT   CDS_pept        complement(523467..523961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0436"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: csc:Csac_1137
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41767"
FT                   /db_xref="GOA:D9TID5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID5"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADL41767.1"
FT                   /translation="MSKKIENILRFGMKMEKNAQDFYSFYANNLQDEGLKKLFEEFVKI
FT                   EQEHYKYLENILKSLDSQEPPISISWVVDDQNKMVDPHILVDNSVILETDFSDLTILRL
FT                   AYLIEGDFAAFYKHAAEKVEDSNVKGLLLHLAKWEEEHEKYFKERYHSLMKKEWKEIDL
FT                   F"
FT   gene            complement(524126..524731)
FT                   /locus_tag="COB47_0437"
FT   CDS_pept        complement(524126..524731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41768"
FT                   /db_xref="GOA:D9TID6"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0497"
FT                   /protein_id="ADL41768.1"
FT                   /translation="MKRKIIYIHIIFLIIMVLILSFLYKNYSIRRISFEKASENLKVKL
FT                   LSEIQSAVKLTDYIISNFDKDGFSEENILLLEYKSKVIYESIRHILSAVEIDKDNDYFI
FT                   RIRSIENTFEILFVFLNNVYNYYIKDGGTHFNLPNSNKIVIKSKKNIYNELLLYHDLFS
FT                   KLDITNKENYKGIELFNKIIEKWDTKKAELIIYPDERT"
FT   gene            complement(524784..525401)
FT                   /locus_tag="COB47_0438"
FT   CDS_pept        complement(524784..525401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41769"
FT                   /db_xref="GOA:D9TID7"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0497"
FT                   /protein_id="ADL41769.1"
FT                   /translation="MKRKIIFNHIVFLIIIASIFFILFKNYSKEINYLNKALNNLKAEA
FT                   FLKIRDISWNSAPDDIISNRNSIILERILYLKSEAECMSFIISALEYIDTDSNNVPYYK
FT                   AKLHSMYSTFSNFVTFLSKVYDYIKDGEKPFNLPNDKDTKFIIKTKKDIYNELLLYHDF
FT                   FSKLDTNVIGPIYGNEVFNKIIEKWSIEKADKIIYPSKRIQK"
FT   gene            complement(525775..526386)
FT                   /locus_tag="COB47_0439"
FT   CDS_pept        complement(525775..526386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41770"
FT                   /db_xref="GOA:D9TID8"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0497"
FT                   /protein_id="ADL41770.1"
FT                   /translation="MKRKLIYIHIAFLIIIALILSIFYKNYSVIKMRYINAFNDIKVTA
FT                   FNEIAEVAYCTKYIIDNFDKDGFSMENISYLELKVKFVFLAIDALMFARIDSFEIDNYG
FT                   TKLISMYNTFSLFDRFLTKVIEHIKDGGKPFNLFDNNDNKFLIKTKKDIYNEFLFYHDL
FT                   FSKLDLHVTKSSTGTELFNKIIKTWDIEKANKIVYPSERN"
FT   gene            complement(526489..528042)
FT                   /locus_tag="COB47_0440"
FT   CDS_pept        complement(526489..528042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41771"
FT                   /db_xref="UniProtKB/TrEMBL:D9TID9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0498"
FT                   /protein_id="ADL41771.1"
FT                   /translation="MIVRNKIITKILAVLMIISFSLISSAFNIKAYAENNELIVDNGIL
FT                   RGIQYKGGNFVKVDSENQLDSKLIIKKMQIKNDELILEAVIENKNMQNLIQATGKIYYS
FT                   QNMMLKKTRSLTVLFNNEGDYKILSFIIENNANEGLLLPVNRKLKNKTVAKIAVLCTKT
FT                   NDIFYFEDVFPNINKLSRLYTLAKEPAETYNKDEIDKSGIEIGKTNIDDADKVGFSENW
FT                   FMPFIANSNTSQLEETKDVSLKESQIVSLTTTSPVPGVPVSDFITLGKKVYNDNDNYGY
FT                   YKNTVEWPVGSGNRLTTLLKWGYTCNKPNTITASASRGTGSAQFNILTEAQYIYLAYNG
FT                   SIQLFDNSSYLRIRNLYMQVGIGSGNTDIFSKITKQASCSSGTLNISWSSLIGLLPFGD
FT                   TFSNAVSFFSAIEYKVENSSAGTTTYPITVNGQLLQYGKVVRGHKATIGSNDYLYTEGQ
FT                   QLLLEYEVCVPLDKPRVSGNRVFHNGFYFEIYSRHPVWLTYSVLEATVNKTVTNNYYVQ
FT                   "
FT   sig_peptide     complement(527941..528042)
FT                   /locus_tag="COB47_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.551 at
FT                   residue 34"
FT   gene            complement(528701..529498)
FT                   /locus_tag="COB47_0441"
FT   CDS_pept        complement(528701..529498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41772"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0478"
FT                   /protein_id="ADL41772.1"
FT                   /translation="MNKRNKLLISLFIISFLLLSVVCIKFYFSNNNASLTKTNSNLVYA
FT                   NIETSKNSNEQIQNSLDENLKKSFEVLLKTEDVRLNYNVPPEILTLDYEKYFSDEKAKY
FT                   LYKFIKDNFYSIYTDMYIKLDYETKQKFKKGYEEYLKEYQNNIFNIEKYAQYKIDKVAI
FT                   YYYEKFLKDLIKNPSDWQNIWKEFRTIVIEHKARSLLVKFEPDVKKNIFFSTPEGKALT
FT                   KQNNLTEEAIEKEREEYQKILEEKKKEVAQELDKWAKQNGIVE"
FT   sig_peptide     complement(529436..529498)
FT                   /locus_tag="COB47_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.737) with cleavage site probability 0.194 at
FT                   residue 21"
FT   gene            complement(529809..530539)
FT                   /pseudo
FT                   /locus_tag="COB47_0442"
FT   gene            complement(530560..531553)
FT                   /pseudo
FT                   /locus_tag="COB47_0443"
FT   gene            531832..532771
FT                   /pseudo
FT                   /locus_tag="COB47_0444"
FT   gene            complement(533049..533393)
FT                   /pseudo
FT                   /locus_tag="COB47_0445"
FT   gene            complement(533544..534142)
FT                   /pseudo
FT                   /locus_tag="COB47_0446"
FT   gene            complement(534151..534702)
FT                   /pseudo
FT                   /locus_tag="COB47_0447"
FT   gene            complement(534762..535079)
FT                   /pseudo
FT                   /locus_tag="COB47_0448"
FT   gene            535346..536161
FT                   /locus_tag="COB47_0449"
FT   CDS_pept        535346..536161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0449"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: ate:Athe_0499
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41773"
FT                   /db_xref="GOA:D9TIE1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE1"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADL41773.1"
FT                   /translation="MIIDFHTHCFPDDLAPRAMSKLSQNSGMPYYHDGTLRGLKESSKI
FT                   AGIDICVVLPIATKPQQTMTINRWALSVMEEHNDIICFGTVHPEFDMWEEEIRWLKENG
FT                   FAGIKFHPDYQDFFVDDKKMYPIYDAIAKNDMIILFHSGVDPAYMPPYHCTPERLQRVL
FT                   KDFSGAKIVAAHMGGYRFFDETLECLIGKDVYLDTSFFFGEVQIQNFEEIFRKHGIDKI
FT                   LFATDSPWKDQKREVEYVNSLRLSEEEKEKILWKNAQQLLKVKIVHRTN"
FT   gene            536216..537007
FT                   /locus_tag="COB47_0450"
FT   CDS_pept        536216..537007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0450"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: ate:Athe_0500 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41774"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0500"
FT                   /protein_id="ADL41774.1"
FT                   /translation="MRVKILINNWTFKGGYLAEHGLSLFIEKDGKKILFDCGQTNAILK
FT                   NIEKMGVGFDFDAVVLSHAHYDHTGGLKFLIEKTSCPIWVHTGFFEKKFAKREGEYKFI
FT                   GENFEKLDMSKFKIVDKDVYEIFDGIFMVNVTSGKESDEFYILKDDRFQSDLFLEEQSL
FT                   VIKEDGKIAVIVGCSHNGIENIIEKVEKYFSQNIFAVIGGFHSKDFRQDDLQRLCQFFR
FT                   EKKIYKLVPLHCSGIETLIYFAGNLPNKLKICGVGDEIEIC"
FT   gene            537082..537882
FT                   /locus_tag="COB47_0451"
FT   CDS_pept        537082..537882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0451"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ate:Athe_0501 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41775"
FT                   /db_xref="GOA:D9TIE3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADL41775.1"
FT                   /translation="MKANFWLNKTVIITGATSGLGKAITKILLEKGAKVVAISRSEESL
FT                   KGLKNELVSFAENLFLIKADVTVKKDCKYIFKTVEDELKTADLLINNAGVGLRCEVEEI
FT                   DELDLRKVFDTNFFGAFYMMQYGISFFKRQGKGTIVNICSLGVKRPVPFTAGYTASKAA
FT                   LSTLADAARLELKKDGISVLCAYPGSISTDFRKNALGKPYPENEVRLSRLLPEIAAKRI
FT                   IRGIEKGKIEIYTSKKDYLFILFTRLFPRLSDRVVEKAFAKKQE"
FT   gene            538111..539721
FT                   /locus_tag="COB47_0452"
FT   CDS_pept        538111..539721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0452"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="KEGG: ate:Athe_0502 acetolactate synthase, large
FT                   subunit, biosynthetic type; TIGRFAM: acetolactate synthase,
FT                   large subunit, biosynthetic type; PFAM: thiamine
FT                   pyrophosphate TPP-binding domain-containing protein;
FT                   thiamine pyrophosphate central domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41776"
FT                   /db_xref="GOA:D9TIE4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE4"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADL41776.1"
FT                   /translation="MKVKMTVARAMVEVLKSEGVEIIFGIPGAAIYPFYDALYSSDIKH
FT                   VLVRTEQAAVHEASGYARTTGKVGVCVATSGPGATNLITGIATAYMDSVPIVAITGQVN
FT                   SSLIGKDVFQEVDITGATAPFTKHNYLVKDPKKIVRVLKEAFYIASTGRRGPVLVDVPI
FT                   DVQMQEIEFEIPREIEIPGYKPREKGHPLQIKRAVEAIEAAKKPVICSGGGVIASKASE
FT                   ELRILVEKQKIPVISTLMGIGAISTNHPYYLGMIGSHGQREANLALRQADLLIVVGARL
FT                   ADRALGDTKITDNMKIIHIDIDPAEIGKNVDTNIPIVGDAKYVLSEINKRISEREEFWA
FT                   AEIKAQKKILPDDGKLHPYDVLREISTQYDGEYIITTDVGQHQIWAAHHLYIKRPGTFI
FT                   TSGGLGTMGYGVPAAIGAKFGSPDDEVIAITGDGSFQMLMQELATIKREQVPVKIVLFN
FT                   NTRLGMVYELQKRRCTGRFIATCLDGNPDFMILAKAYGIEGMRLESKEKLKEAISVMKS
FT                   YKGPFLLEVVTDPDEPTIP"
FT   gene            539774..540286
FT                   /locus_tag="COB47_0453"
FT   CDS_pept        539774..540286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0453"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: csc:Csac_1143 acetolactate synthase, small
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41777"
FT                   /db_xref="GOA:D9TIE5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE5"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADL41777.1"
FT                   /translation="MKYTLSVLVENHPGVLSRVAGLFSRRGFNIDSLAVGVTEDPAISR
FT                   MTIVVNGDDYIVEQVTKQLNKLIDVIKIKKLNPKEAVERELALIKVNANSQTRSDIIQI
FT                   TEIFRANIVDVSKETLTIEISGDEDKIEALIELLKQYGIREVVRTGLIAIERGNKVITK
FT                   SKSEEDE"
FT   gene            540288..541289
FT                   /locus_tag="COB47_0454"
FT   CDS_pept        540288..541289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0454"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   ate:Athe_0504 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic
FT                   domain-containing protein; acetohydroxy acid
FT                   isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41778"
FT                   /db_xref="GOA:D9TIE6"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE6"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADL41778.1"
FT                   /translation="MAKIFYDHDCNLDLLKDKTVAVIGFGSQGHAHALNLRDSGINVVV
FT                   GLYQGSKSWAKAESHGLKVMTADEAAKVADVIMILVNDEKQPKLFKESIEPNLKEGKAI
FT                   AFAHGFNIHFGQIVPPPYVDVIMIAPKGPGHTVRSQYEEGKGVPALVAVHQDYTGKALD
FT                   IALAYAKGIGASRAGIIQTTFKEETETDLFGEQAVLCGGLTELIKAGFDTLVEAGYQPE
FT                   IAYFECLHEMKLIVDLIWQGGLSLMRYSISDTAEYGDYMTGKRIITEETRKEMKKVLEE
FT                   IQNGTFAKKWILENMAGRPEFNSIRKREQNLLIEQIGKELRKMMPWIKPIKE"
FT   gene            541306..542829
FT                   /locus_tag="COB47_0455"
FT   CDS_pept        541306..542829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0455"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="KEGG: csc:Csac_1145 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation)
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41779"
FT                   /db_xref="GOA:D9TIE7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE7"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ADL41779.1"
FT                   /translation="MGNRVIKIFDTTLRDGEQTPGVSLNVNEKLQIAKQLEKLKVDVIE
FT                   AGFAIASPGDFEAIKVISENIKDAVIVSLARAVEKDIDRAYEALKNAQAPRIHTFIATS
FT                   DIHMKYKLKMTEEEVLERAVAMVKYAKKYVSDVEFSCEDATRTRIEFLIKVFDAVIKAG
FT                   ATVINIPDTVGYTTPEEMKRIIRAIKENIPDIDKVQISVHCHNDLGLAVANSLAAVEEG
FT                   VHQVECTINGLGERAGNAALEEIVMALKTRKDFYNVDVLIDTTQIYRTSKLVSSLTGIF
FT                   VQPNKAIVGANAFAHESGIHQHGVLSERSTYEIIDPVSIGLPKNRMVLGKHSGRHAFEE
FT                   RLKELGYTDLTREEIDAAFEKFKVLADKKKVVLDKDIEALLEQKSLNIPETYELIKFQI
FT                   ISGNDLISTASVKIKSGEEEFEEAATGDGPVDAIFKAIDRITGLQVELDDYSIKAVTQG
FT                   KDALGEVTVRIKKDGKAFLGRGLSTDILEASAKAYVNAINKMLYKISEE"
FT   gene            542909..543073
FT                   /locus_tag="COB47_0456"
FT   CDS_pept        542909..543073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41780"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0506"
FT                   /protein_id="ADL41780.1"
FT                   /translation="MIIRICGAITIIGIISIIRKRIIRLIYKISYAALHPFWPVYDQRG
FT                   FLKRPLGHG"
FT   gene            543175..544752
FT                   /locus_tag="COB47_0457"
FT   CDS_pept        543175..544752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0457"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="KEGG: ate:Athe_0507 2-isopropylmalate
FT                   synthase/homocitrate synthase family protein; TIGRFAM:
FT                   2-isopropylmalate synthase/homocitrate synthase family
FT                   protein; PFAM: LeuA allosteric (dimerisation)
FT                   domain-containing protein; pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41781"
FT                   /db_xref="GOA:D9TIE9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIE9"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ADL41781.1"
FT                   /translation="MEDNKTIIIYDSTLRDGAQAGGISYTLEDKLKIVERLDKFGVKFI
FT                   EAGNPGSNIKDQEFFARVKQMKLKNAKLIAFGSTRRVGIDVKDDPNIQSLIAADTEAVA
FT                   IFGKSWDFHVIEVLRTTEDENLQMIYDTIKYLKSLGKYVVFDAEHFFDGYKNNKKYALE
FT                   TLKVAKEAGADSLDLCDTNGGTFPMDIYNITKEVVEMFPGTLIGIHCHNDTGMAVANSI
FT                   MAVLAGARQVQGTINGYGERCGNADLITLIPNLQLKLGFKCIPDENIKHLTSLSRYVAE
FT                   IANMIPNERAPYVGAYAFTHKAGMHIDAVKKNPASFEHINPEVVGNTRRIVLSEVAGRA
FT                   TILDKIREIDPTVTKDSPVTKEIIDELKRLENEGYQFESAEASFEMLIRKKLGLYEPFF
FT                   TLKEFKVLINEPAVEYSSSAIVKIAVDGVTAITAAEGDGPVHALDSALRKALEKFYPEL
FT                   KEVHLVDYKVRVLNAETATAAKVRVLIESTDGKDTWSTVGVSTDIVNASWIALVDSLEY
FT                   KLCKEKVK"
FT   gene            complement(544847..544967)
FT                   /pseudo
FT                   /locus_tag="COB47_0458"
FT   gene            545068..545241
FT                   /locus_tag="COB47_0459"
FT   CDS_pept        545068..545241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0459"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /note="KEGG: csc:Csac_0737 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41782"
FT                   /db_xref="GOA:D9TIF0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF0"
FT                   /inference="similar to AA sequence:KEGG:Csac_0737"
FT                   /protein_id="ADL41782.1"
FT                   /translation="MAYYITDDCISCGACESECPVQCISPGDGKYVINEEQCISCGACA
FT                   NVCPVDAPKPRD"
FT   gene            545354..545911
FT                   /locus_tag="COB47_0460"
FT   CDS_pept        545354..545911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0460"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="KEGG: ate:Athe_0510 hydro-lyase, Fe-S type,
FT                   tartrate/fumarate subfamily, beta subunit; TIGRFAM:
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, beta
FT                   subunit; PFAM: Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41783"
FT                   /db_xref="GOA:D9TIF1"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF1"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ADL41783.1"
FT                   /translation="MNRIFVPLQSPEEIKSLRCGQEILVSGKLFVARDAAHKRLFEMIQ
FT                   KGSKIPIDFKNGAIYYMGPCPEKPGEVIGPCGPTTAGRMDVFTPMMLELGIKVLIGKGK
FT                   RNEAVKEAIKKHGSIYLATFGGAAVLIQSCVKSQRIVMFEDLGAEAIREIEVENLPCIV
FT                   AIDSQGEDIYEVGPREYAQDFR"
FT   gene            545892..547265
FT                   /locus_tag="COB47_0461"
FT   CDS_pept        545892..547265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0461"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   ate:Athe_0511 Orn/Lys/Arg decarboxylase major region"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41784"
FT                   /db_xref="GOA:D9TIF2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF2"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADL41784.1"
FT                   /translation="MRKILDNLKIFSALKSYNFLRLHMPGHKGKEEIFPDAIKNIFPSF
FT                   DVTETFCTDNLLDPKGYIKEFLDGINEFFGSNYSFLSLQGSTHLLQASIAAFSNPYDGI
FT                   LINRDAHKSIYNIAKILKLDIEYIYPQYDDSLGIFTYIDEKHFESVLQTSKSQIVVITS
FT                   PSYYSIEQNVQALSDIAKKYQKKLIVDQAHGGYYKFAGKKTALDLGADICILSLHKTLP
FT                   CPNQSALLLSNLSNNDNKKLSAYLGYLHTTSPSYVLLAWSEYGIEFSKMFGRQLFKELE
FT                   GKLEKLCKPVLEYTNYVYRDVDVLKLLLNFGKAGKNQSFVKNLLERYSIVPELFDQNRI
FT                   LFYFSLVDALFNFEILESFFYDIIKEKGKRELEKKFLSPPRPKKVLKIYQVDNAKKRRV
FT                   KIYEAEGFVCAQAIIPYPPGFPVVVEGEVIDKDTIEYLQELFGKEFIKENEVDVIEEG"
FT   gene            547252..547884
FT                   /locus_tag="COB47_0462"
FT   CDS_pept        547252..547884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0462"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: ate:Athe_0512
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41785"
FT                   /db_xref="GOA:D9TIF3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF3"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADL41785.1"
FT                   /translation="MRKGKLIVFEGNDGSGKTTQLFKVEKYLKDKGYKVLTTREPGGTE
FT                   VGYRIRKLLLDPQYKMDGLTEALLLAADRNEHVKNVLIPALDEGYIVLCDRYILSSIVY
FT                   QGIVRGVGVENILRLNSIFEDKIKPDLYIVLTLEPEIAIQRIQMAGKNNRLDLEDLEFH
FT                   RRVYSGFKEVSKWFERCVNIEAQGSEKEVFEKVCREIEGLFESKEKW"
FT   gene            547942..548271
FT                   /locus_tag="COB47_0463"
FT   CDS_pept        547942..548271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0463"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   ate:Athe_0513 protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41786"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF4"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADL41786.1"
FT                   /translation="MKLIVAVVQNEDISRLLDALQKEGIMATKLSTSGGFLRSGNTTLL
FT                   IGIDDDRVAEVIDIISQKCKTRKQIVSSPVPNNPSAGVYLPYPVEITIGGATIFVLNVE
FT                   RFEKV"
FT   gene            548298..548744
FT                   /locus_tag="COB47_0464"
FT   CDS_pept        548298..548744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0464"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   ate:Athe_0514 protein of unknown function DUF327"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41787"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF5"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADL41787.1"
FT                   /translation="MRVEDVRRNNINNVTFFQDQRRVERPKDSFSSYVKQLEKDEIINR
FT                   IKELISKIDSLGKSLAERLDLSTLKEYKKAIKELLGYTVYSSHEYFNESLFGRKGRHKV
FT                   FGIVKKIDEKMDMLTQEILKKEADNLKVLSYVGEIKGLLVDLFI"
FT   gene            548771..549733
FT                   /locus_tag="COB47_0465"
FT   CDS_pept        548771..549733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0465"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: ate:Athe_0515 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41788"
FT                   /db_xref="GOA:D9TIF6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0515"
FT                   /protein_id="ADL41788.1"
FT                   /translation="MNLDTFIGQKGIVATLKKALVQPFHAYIFEGEKGLGKKLLAMTFS
FT                   KQILCEKKLACGVCKSCRLFDALTHPDFKIIKREEDKKEISVDAIREIIKDISRGPIFA
FT                   SKKIYLIQEAEEMSTSAQNALLKTLEEPPEYALFILTCNNLERLLPTVISRSLVLSFKR
FT                   YSASEISEILKNYELEPKDYVLKLCRGNPKIALDFYDKEVQNKRDYIFDKLLSYDGASF
FT                   SLIKEFESDFEKFKDDFAFLFETVIYFLRDALMFKRTNLVELITNTDKLAKIVEFANKH
FT                   TIYHIYRLLQDFMMLEKYPDANVISDNVLDMIFLKLSGG"
FT   gene            549741..550628
FT                   /locus_tag="COB47_0466"
FT   CDS_pept        549741..550628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0466"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: ate:Athe_0516 PSP1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41789"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF7"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADL41789.1"
FT                   /translation="MAEVVGVRFKKAGKIYWFDPNNIDLKAGDDVIVETVRGIEMGKVM
FT                   IEKREVPDEEIVQPLKKVVRKATEEDYKKAQENMEKAAKALEICKEKVQKHGLPMKLLH
FT                   AEYTFDNNKLLFYFTAEGRVDFRELVKDLAAVFRTRIELRQIGVRDDTKFRGGLGPCGR
FT                   EVCCSVHLCEFVPISIKMAKQQGLVLNPAKISGLCGRLMCCLTYEQKFYEEAMLKLPGI
FT                   GAIVKTADGIGEVVEVNVLKEKIKVRFEDEMQNVELKEYSVGEFEILKDTKKIQQPVVA
FT                   LDDDELKELLDLEE"
FT   gene            550741..551979
FT                   /locus_tag="COB47_0467"
FT   CDS_pept        550741..551979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0467"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   ate:Athe_0517 protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41790"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF8"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ADL41790.1"
FT                   /translation="MEVVLLIVIIVLVISNLLLLIRLKNNMSSSLDTQNKLLEIEKELG
FT                   QIQNSISQQFSQNKNETQSMISSFGSILMTRFSDISNQIINFTSSNQERLDSIRKEIDN
FT                   KLEKIRETVDSQLQSTLETKLSQSFKLVSERLELVHRGLGEMQALAGSVGDLKKILSNV
FT                   KVRGTLGEIQLGNIIDQILDSSQYERNVRIKPHTQEQVEFAIKIPSKNSKDNEFIYLPI
FT                   DSKFPIEGYQRLIEAQEKAEAEEVARFSKELENSIRQNAKTIKEKYIDPPKTTDFAIMF
FT                   LPSEGLYAEVLKIPGLFESVQREYKVIIAGPTTVVAMLNTISLGFKTFAIEKRTSEVWE
FT                   LLSAVKTEFSRFAEILEKVKKKLSEAQDTIDTATRKTRTIERKLKSVEVLSSEKDPEKI
FT                   LYDEEAIEEGSGK"
FT   gene            552157..553554
FT                   /locus_tag="COB47_0468"
FT   CDS_pept        552157..553554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0468"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   ate:Athe_0518 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41791"
FT                   /db_xref="GOA:D9TIF9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIF9"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADL41791.1"
FT                   /translation="MARVEFNPKTNLIEQAAYKYTLQDVPEPNLYREIFPYTEIPKIAF
FT                   NHRHVPMFVPDEIWITDTTFRDGQQARSPYTVEQIVRLFDYLHELDNNSGVIRQTEFFL
FT                   YSKKDREAVIKCMERGYKYPEVTSWIRARKEDFQLVKEMGIKETGILVSCSDYHIFKKL
FT                   NMTRKQAMEMYLSIVEAALEHGIIPRCHFEDITRADFYGFVVPFANELMKLARQANMPV
FT                   KIRACDTLGLGVSYPGVALPRSVQGIIYGLRHYAEVPSEWLEWHGHNDFYKAVVNSGTA
FT                   WLYGASAVNCSLLGIGERTGNTPLEAMVIEYAQLRGTTKNMRLEVITEIADYFEKELDY
FT                   EIPPRTPFVGRAFNATRAGIHADGILKDEEIYNIFDTKKILNRPIVIAVDAHSGLAGIA
FT                   AWINTYFRLEGDKKIDKRDPRVAKIKEWVDKEYENGRTTVIGDDELEMVVREVMPELFK
FT                   MHESRVK"
FT   gene            553908..555839
FT                   /locus_tag="COB47_0469"
FT   CDS_pept        553908..555839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0469"
FT                   /product="aconitate hydratase"
FT                   /note="KEGG: ate:Athe_0524 aconitate hydratase; TIGRFAM:
FT                   aconitate hydratase; PFAM: aconitate hydratase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41792"
FT                   /db_xref="GOA:D9TIG0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG0"
FT                   /inference="protein motif:TFAM:TIGR01342"
FT                   /protein_id="ADL41792.1"
FT                   /translation="MGLTVAQKIIKQHLVKGEMIPGKEIAIRIDQTLTQDSTGTMAYLQ
FT                   FEAMGIDRVKTKRSVAYIDHNTLQTGPENADDHLYIQTVAKKHGIYFSKPGNGICHQVH
FT                   LERFAVPGQTLLGSDSHTPTAGGIGMLAIGAGGLDVAVAMGGGEYYLIMPKIVKVNLKG
FT                   KLQSWVSAKDIILELLRRLTVKGGVGKIFEYTGEGVKTLSIPERATITNMGAELGATTS
FT                   IFPSDEVTYEFLKAQGREADFVEILPDPDAQYDEEIEIDLSSLVPLAACPHSPDNVVPV
FT                   SELKGIKVDQVAIGSCTNSSYKDLMKVAKILEGKTIAEHVSLVISPGSKQVLNMLAQNG
FT                   ALSSLVAAGARILECACGPCIGMGQAPRTNGISLRTFNRNFEGRSGTPSAKVYLVSPET
FT                   AAASAITGYITDPRILGDEPQVEMPKSFLINDNLIVPPAENPDEVEVIRGPNIKQFPQG
FT                   KPLPEVVVGKVLIKLGDNITTDHIMPSNAKLLPYRSNIPYLSDYCLTPCDPDFPKKARE
FT                   NGGGFIVGGVNYGQGSSREHAALVPLYLGIKGVLAKSFARIHMANLINNGIIPMVFENP
FT                   SDYDTIEEMDELKIENAREQIEKSDVLIIENVTKGLKYKMILNLTDRQRQMILHGGLLN
FT                   LTKAMGMK"
FT   gene            555911..556918
FT                   /locus_tag="COB47_0470"
FT   CDS_pept        555911..556918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0470"
FT                   /product="Isocitrate dehydrogenase (NAD(+))"
FT                   /EC_number="1.1.1.41"
FT                   /note="KEGG: ate:Athe_0525 isocitrate dehydrogenase
FT                   (NAD(+)); PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41793"
FT                   /db_xref="GOA:D9TIG1"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG1"
FT                   /inference="protein motif:PRIAM:1.1.1.41"
FT                   /protein_id="ADL41793.1"
FT                   /translation="MAYRITLIPGDGIGPEVTEAARRVLDASGVKIEWEIVEAGEKVMG
FT                   QYGTPLPDYVLESVKRNKVALKGPITTPVGTGFRSVNVALRQALNLYANVRPVKSYEGV
FT                   PARYTNVDLIIVRENTEDLYAGIEYMAGDDAAVGVKIITRKASERIVRYAFELARREKR
FT                   RKVTAVHKANIQKLTDGLFLECARKVAQDYPDIEFEDMIVDAMSMKLVQSPENYDVLVM
FT                   PNMYGDILSDLAAGLVGGLGIAPGANIGEDGAVFEPIHGSAPKRAGQNLANPTATILSG
FT                   VMMLRYLGELEAADRVEKAVAKVIKEGKEVTYDLGGSTGTKEFADAVIREMEKI"
FT   gene            556947..557645
FT                   /locus_tag="COB47_0471"
FT   CDS_pept        556947..557645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_0526 transcriptional regulator, GntR
FT                   family; PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41794"
FT                   /db_xref="GOA:D9TIG2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG2"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADL41794.1"
FT                   /translation="MVYNNYSDDKDTRYSPLYEKIFEVIKEKILMGILKPGDPLVEVKL
FT                   AEELGVSRTPIREALRQLELEGLVYSIPHKGAFVAGVTAQDIEDIYTIRMLLDGLAARW
FT                   AAQKITKDEEDELTEIITLMELYTKKKDIPKVMKTDSQFHQLIYKASKSKPLEHVLSTF
FT                   HSYIIRARATSFETPGRLEEAMEEHKLIFEAIVSRDPDKAEEYMKLHVKNAAKNLIEQK
FT                   KIEERTTAGK"
FT   gene            557742..559967
FT                   /locus_tag="COB47_0472"
FT   CDS_pept        557742..559967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0472"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; Mur ligase middle domain protein; KEGG:
FT                   ate:Athe_0527 Mur ligase middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41795"
FT                   /db_xref="GOA:D9TIG3"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG3"
FT                   /inference="protein motif:PFAM:PF02222"
FT                   /protein_id="ADL41795.1"
FT                   /translation="MKIENIKVYNNRNIYSDKKVAVLKVKGKPEEASSFAKLCIHIQNL
FT                   IGYNLVEYWECFSVEDYIDVLIEHDNPIIVYKVIEFALECMGKGFIPEDFPDKISKLKK
FT                   LTIETELSPNTRLLKNACMKRGIRFTRIGYTDTFILGEGKYAKLFAGLISEQDFSVVSI
FT                   SNDREMEREFLKLNFFPVAPFEVIFTSDQLMESIKKLGFPISIKGCKKDSPNIGNIRTN
FT                   QQALEAFNMVKNVENRVIVERYVPGNSYKILVVNGKVVAAIERTSPYIIGDGKRRILEL
FT                   LDQGEKNNKYIQKNILKQGFTLDDILPKGMRVFLKEPTSFKTGCITTDVTEKVAYENQQ
FT                   LFVKIAEKLGYVTTVLDFVTEDISLPYTIIGGYVVDIETNCDLRIFSQTCNNDVFNTIL
FT                   DVYFEKIPNPSVPIIAVSGTYGKSTILQIMRYIFQRCGLEASIDSEMENFYLRSFGDLS
FT                   DIKLVEFNPEKGIEEIEIEPEAGIITNTFSQNQIEKNLLFTRSIKENGYLILNVNDAYK
FT                   YLYSAKAKCRIVFTSTSSHHPDLKAHMEMKKPCVYLENDIIKIFDGKELFSFCNIKEIP
FT                   YSYDGKLIFAVDNILQTVAALYFYGVDSEIIYKFLIEYKNDSHQNPGKFNIFDINGVKV
FT                   IIDSLRKKEHVKMLTLSLSSIGIRNLYFVCEQRQKQILDFVEDKSRIISKQIEKFSDVV
FT                   EMVSDAIRKANKGDGVFIVLPEPLNRDVTFEIREGLAKRKKNFVNNA"
FT   gene            560045..560332
FT                   /locus_tag="COB47_0473"
FT   CDS_pept        560045..560332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41796"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0528"
FT                   /protein_id="ADL41796.1"
FT                   /translation="MSLPQVFRYRGREVYKIRNNLIHYGNPDDKFVAVFVVLGTEEYKG
FT                   YKISSPISVELQINNPKLTVRERVVKKAEADNLYKALELAHVWLVQANGK"
FT   gene            560502..560588
FT                   /gene="ffs"
FT                   /locus_tag="COB47_R0010"
FT   ncRNA           560502..560588
FT                   /gene="ffs"
FT                   /locus_tag="COB47_R0010"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            560787..561194
FT                   /locus_tag="COB47_0474"
FT   CDS_pept        560787..561194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41797"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0529"
FT                   /protein_id="ADL41797.1"
FT                   /translation="MIVLEGHELVTSRALTVLKPYVGEAHLISSILVLAHLLELEKFSF
FT                   FGSEKSYQRLKKLLFPNVCVEFWQESLEVVFIDITAIKKYFVDLGHLKGWIEALHANKK
FT                   ILLYELFVEGSLLFDLSNFILIADELFMVEG"
FT   gene            561335..563011
FT                   /locus_tag="COB47_0475"
FT   CDS_pept        561335..563011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0475"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ate:Athe_0530 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41798"
FT                   /db_xref="GOA:D9TIG6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL41798.1"
FT                   /translation="MNVELEFCLYKLFEIIGVIAVSGIYILSVFLGNELKNALIYNFSK
FT                   IFLSLVVFKFLYVLNLEKEVVSKSEGVQVVVFLNLLSKFLIIYALIFSVLCRERLKEFL
FT                   SKASIWINITLIIVVFLISEKIKNAKINILLQSTLSTTKLYFISELLIVFGILFLIYLS
FT                   FYNSYFKQNNSFKVFVLAFAVGELILSLFKRKGILFTEAVQNGAMLYLFVAIFLAIAKQ
FT                   RVKFLHSLAKFSTEVLKEKLDLQKSFELLVDFIYEAYSKVFPRICFYYIIEDGNYKLIV
FT                   FKSEEVSDKFEDSSAEVKVVSKLLEEENISTFDIKDFENFFECKALKNRVFNSFQTVVY
FT                   VPVHRYNRLVGFLICYSKIKNFNITDELQDGFTIFMNFSQALLSQIERIEKIKNLSTED
FT                   ELTGLYNRRYFMKELILESIAADRYKNKFCVAFFDMDNLKLLNDVYGHGVGDKAIKIIA
FT                   RIIRDNIRKTDIAARLGGDEFAVIFKNCSKDAIEDRIKNIKQLIEKESELQLPKKIRVS
FT                   CGIAVYPDDTTSLDELIKIADMRMYEEKLKNKGGDFDAERQ"
FT   gene            562995..564659
FT                   /locus_tag="COB47_0476"
FT   CDS_pept        562995..564659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0476"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: ate:Athe_0531 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41799"
FT                   /db_xref="GOA:D9TIG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG7"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADL41799.1"
FT                   /translation="MQKGSSTVRVFFEDVNICEDVEVGTNLLSFVPRFESYFKSPIVAA
FT                   KVDNEIKELKYVISRDCRVKFIDMTQEDGMRIYRRSLIFVLIVATRMLFKEAVNVQHSL
FT                   SKGLYCEVENRKLSSQDIELIKQKMKWIIEQDFQFKREKVSKEDAVKLFEEKGFYDKAR
FT                   TIKFSENEYVYIYYCGDYVDYFYGHLVPSTGYLKIFDLIQYHDGMVLMYPDKSDPFKLQ
FT                   EFVENKKLFAVYHEYKNWGRILGVSSIGELNEVIASGKIREFIRVSEALHEKKIAYIAD
FT                   QISQNPLIKVVLISGPSSSGKTTFAQRLSIQLKVNGKNPVYIGLDDYFFEDKVPLDENG
FT                   KPDYESIEAIDVELFNGQLKDLIEGKEVVLPRFNFIERKRTFERRVRLEKNDIIIIEGI
FT                   HGLNNRLTPMIPDENKFKIYVSALTHLNLDKHNRIQTTDYRILRRIVRDARTRGASAKR
FT                   TISMWPSVRNGEEKNIFPYQEMADAMFNSALIYELAVLKKYAVPLLKTITREDEEYSEA
FT                   QRLLHFLSFILTIEDEREIPPQSIIREFIGGSCFYDF"
FT   gene            complement(564708..565595)
FT                   /locus_tag="COB47_0477"
FT   CDS_pept        complement(564708..565595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41800"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0532"
FT                   /protein_id="ADL41800.1"
FT                   /translation="MKRIKTIIGIGLIVILILSVSLAFAGSSKASLPVAFKGNLTKLCF
FT                   GKFEKGAAGINLDIAGTIESILGMKKEDIQKQIQSGKAFSDILKDKGLTLDQFKSKLLE
FT                   SLYAKIDEAVKNNKITSDKAAQLKQSLKQKIDSWDGKLPFFGFKIKAFSKDIYNLDMFS
FT                   DIATILGMTKDSLFNELKNGKTIADLIKSKNISESDFKNKLISMQITKIDKLLNEGKIT
FT                   KDQADKMKEAIKTKISNWDLSKGFAPRGFGRKFKGAAGMDGTMRRGFSIKMRGFWPNQG
FT                   TNQNTNNSSTNVTF"
FT   sig_peptide     complement(565518..565595)
FT                   /locus_tag="COB47_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.733 at
FT                   residue 26"
FT   gene            565788..567482
FT                   /locus_tag="COB47_0478"
FT   CDS_pept        565788..567482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0478"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="KEGG: ate:Athe_0533 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41801"
FT                   /db_xref="GOA:D9TIG9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIG9"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADL41801.1"
FT                   /translation="MKYIVIGAVAGGMTAAMKIRRNDDKAEIIVYDKDTDISYSGCSLT
FT                   YYISGVIDNRKNIVPRDSQYFKKFNVDVKTAHEVLKVDTQNKKVIVKDLTTGNTFEDGF
FT                   DKLIIATGAHPVVPKIDGIELEGIFVLRNVKDADRIKEFINTYFPKKALIVGGGYIGLE
FT                   MAEALKVLGIDVVIIEKQENILPNLDSDMARLVENYLKEKGITVKTSTSVLKFEGDKRV
FT                   TTAILSDGSRLNVDFVLIAVGVRPSTQFLEGSGIQLLPNGAIKVDEYMRTNIEGIFAAG
FT                   DCASVYFKLNGKTMYMPLGSTANKMGRIAGENATGGSMKFSGILATSIFKVFDLTVAQT
FT                   GYTEKMAQQDGIEYEVGHVTKPHITTAYPGAEKMTIKAIAELSSRKIIGAQIIGTKGVD
FT                   KRIDILATAIFAGLTTDHLFQLDLAYAPPFSSAKDPVHYVGMVMSNFLDKRKFNCTQEK
FT                   LLEKMQKGEDFVVLDVRTPDQYKIKHIKGAVNIPLEMLQEKMNLLPKDKQIIVYCNSGV
FT                   SSNIAQNILQQNGFRKVYNLSGGILNVTLEQLLERNTSDSSPSSPDL"
FT   gene            complement(567450..568055)
FT                   /locus_tag="COB47_0479"
FT   CDS_pept        complement(567450..568055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0479"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ate:Athe_0534 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41802"
FT                   /db_xref="GOA:D9TIH0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH0"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADL41802.1"
FT                   /translation="MIEFLKYMIDNFGLWGIFLILAIEGLGIPFPTQIAYLGAVALLNS
FT                   RKFTLFTLIMVIALGNLCGNVAVNLLLRSGRKKIISLFERLLRIKKETLESVNNFFVKY
FT                   GIFAVPIARIIGVPRTPVIFLAGISKMNFYEYIISSFIGNTIWATFYVYFYWYGFNFFK
FT                   FLYKKDIFLFWLAILVLVCIVIIAWIIFLKVWRRRRRV"
FT   gene            568415..569443
FT                   /locus_tag="COB47_0480"
FT   CDS_pept        568415..569443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0480"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; G5 domain
FT                   protein; protein of unknown function DUF348; KEGG:
FT                   ate:Athe_0535 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41803"
FT                   /db_xref="GOA:D9TIH1"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH1"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADL41803.1"
FT                   /translation="MNKLRCLVARPRDMKKLILAFVIVFVLSVLLGAMTAQALVKEVSI
FT                   TIDGKTFYYKTIKSTVREVLEENQIYLTKDDYISPSLDSKINENTQIIIKRAFEVKILV
FT                   GDEEKVVYIPSGTVEDAIKKAGVVLGKLDKVNLPLSQLLDRPTVIKITKVTEKVVVEKQ
FT                   KIPFSTVTKTNYNMDYGKQKVVQQGQDGIKERRYKLILEDGNEVERKLLGEKIVKPPKP
FT                   KIVEVGTIRWFKTSRGEVVRYRKVYTMIATAYSLTPSDTGKSPSHPDYGRTATGHRVRR
FT                   GVVAVDPRVIPLGTRLYVEGYGFATALDTGSAIKGNRIDVFVEKDAYKFGVRRVKVYVL
FT                   AN"
FT   sig_peptide     568415..568531
FT                   /locus_tag="COB47_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.846 at
FT                   residue 39"
FT   gene            569651..570544
FT                   /locus_tag="COB47_0481"
FT   CDS_pept        569651..570544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0481"
FT                   /product="glycosidase related protein"
FT                   /note="PFAM: glycosidase related protein; KEGG:
FT                   ate:Athe_0536 glycosidase PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41804"
FT                   /db_xref="GOA:D9TIH2"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH2"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADL41804.1"
FT                   /translation="MFKLQRVTDKPVLKPKQENEWERAAVFNAAAIFHRGLFHLIYRAT
FT                   NIPPHKDYGDYVSTIGYAVSTDGINFYRLDKPVMVAENEQERRGIEDPRIVEIDGTFYM
FT                   TYTGFGGRYEGDFRIMLAKSKNLIKWERIGIALDEPNKDAALFPEKINGRYVMFHRRYP
FT                   NMWLAFSDDMINWTDHVEIMTVRENSWESSRIGIAGPPIKVKFGWLVIYHAADHKNVYR
FT                   LGAVLLDAKDPTKILSRFSEPILEPELSWEVDGYIPNVVFSCGHAEVGDEVWVYYGGAD
FT                   TVIGVAKFNKEKIKFD"
FT   gene            570620..571597
FT                   /locus_tag="COB47_0482"
FT   CDS_pept        570620..571597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0482"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   ate:Athe_0537 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41805"
FT                   /db_xref="GOA:D9TIH3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADL41805.1"
FT                   /translation="MKAAIFYGKRSLKVEDVSLPTIKEGEILVKVEACGICGTDVHIFN
FT                   GEEGSAKVTPPIILGHEFCGTVVETKSKLFNVGDKVSIDPNIYCGVCKFCRSGRPQLCE
FT                   NLTALGVNINGGFAQYAAVPEKQAIRFENIDFAEAALAEPLACCLHGLDRIKIFPTDKV
FT                   LIIGFGPIGLIMLELVKMYGVDNIFGYEVDDFRKNVAKNYGVKDIVDEDCKEGSFDVVI
FT                   ECAGTKESIEMAFEKIGKGGRVLVFSVPSPLVATEICPFEMFRKEAQIFWSFVNPFTQK
FT                   LAIELLQQGKINLKHVVTHKISLAQLPEALSKKFENQLKVIVQP"
FT   gene            571648..571739
FT                   /locus_tag="COB47_R0011"
FT                   /note="tRNA-Ser1"
FT   tRNA            571648..571739
FT                   /locus_tag="COB47_R0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(571803..572675)
FT                   /locus_tag="COB47_0483"
FT   CDS_pept        complement(571803..572675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0483"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: ate:Athe_0538 signal transduction histidine
FT                   kinase regulating citrate/malate metabolism; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41806"
FT                   /db_xref="GOA:D9TIH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL41806.1"
FT                   /translation="MKKNDHIKLLISMLFLLALIMFLLIYSIYFINTEFIKHQKIPQWQ
FT                   RTLVIYSFTLLAILNLYTVKNLFSALSILKTTQVYKDNIKSLDNFINILRAQRHEFNNH
FT                   LQIIWGLICVEKYNDAVRYIEQISENLKNTSKFYGLGCAELSALIFAKSALAEKYDINF
FT                   EFHYSIDFSNLKFDSMDLINICGNLIDNALYYAKSSFSKYVGLNIEDEGNQIEITVTNS
FT                   GSYIDKCKKDKIFELGYSTKNSSGLGLFIVKSTVEKYKGKIDVFSEYRALDKMEEGYTT
FT                   FRVILPKKI"
FT   gene            complement(572662..573168)
FT                   /locus_tag="COB47_0484"
FT   CDS_pept        complement(572662..573168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41807"
FT                   /db_xref="GOA:D9TIH5"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0539"
FT                   /protein_id="ADL41807.1"
FT                   /translation="MVTYAVLYSLYFLKVFFLVSLILSLFGICYSTKKILVVSFIQAFW
FT                   DTIVFNNHINLMLGLLLMTLCLILLYIMYLKLLPLYGIILGLISQSLCLTLKFGGYSII
FT                   STLISNLSFTPSVFVCDVTTLVIEITIMSILLTVIKSKNYLVFEICKILPTQSEKGNEV
FT                   NYEEK"
FT   gene            573275..574171
FT                   /locus_tag="COB47_0485"
FT   CDS_pept        573275..574171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0485"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ate:Athe_0540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41808"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0540"
FT                   /protein_id="ADL41808.1"
FT                   /translation="MKFFKIDISNKHIFDEYFAIFEPEIADLTFTNLFIWDPFYDIHFT
FT                   EEDGFLLIMAKPYNQPPFLHGPVGIDLNKLPIVIEKARKYFESEGYSFIIKRASKKTVD
FT                   MLSECGLKFESIFERDISDYVYRVEDLVQLKGKKYHPKKNHINKFLRLYSDRYEWKKID
FT                   EEIVKLCWDFECEWYEKRNGKEDIGLTFEKMAIERAIKNFDKLSYEGMVIFIDGRIKAF
FT                   TFGEPLNKNTVVIHIEKADPDIEGLYAFVNQKFLAEFWQDFEFVNREEDLGKEGIRKAK
FT                   MSYHPFKFAEKFTILFD"
FT   gene            574228..575229
FT                   /locus_tag="COB47_0486"
FT   CDS_pept        574228..575229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0486"
FT                   /product="spore coat protein, CotS family"
FT                   /note="KEGG: ate:Athe_0541 spore coat protein, CotS family;
FT                   TIGRFAM: spore coat protein, CotS family; PFAM:
FT                   aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41809"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH7"
FT                   /inference="protein motif:TFAM:TIGR02906"
FT                   /protein_id="ADL41809.1"
FT                   /translation="MRTLELKLVEDNYSIRIERIKQIKSNAYFIKTKDDKEYFLKVSRV
FT                   DKEHVDFILKIFSHLKNTSFKSHLIDFQKTVDGGFYFLDGPKRVYLLCKWIDGRSADFR
FT                   NVFDLKVAVSVLHHLHKASLSFAEKMEDSSYPSYQEVFRRKYSQVIQMKNIIHQKDNLG
FT                   YFDEMFLKVLSRFEGRFVESIYMMKKVEEHFKKENQRVLIHHDPAHHNFIFSETGVYLI
FT                   DFDYAMVDYDVHEFVNLGVRVLKTNDWDINVFRIYLKCLDDKNIIKKFWLQTFWILMYF
FT                   PQEIWQVGLQYYFEKQPWTEEYFLKRLKGAERIQVGKEMIIKKIAGGIFKWH"
FT   gene            575220..576188
FT                   /locus_tag="COB47_0487"
FT   CDS_pept        575220..576188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41810"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0542"
FT                   /protein_id="ADL41810.1"
FT                   /translation="MALKNIIKLHYGFDIKTLKQSKDGLLVKTIRSEYLLKKTKMSPAE
FT                   IVFIFHCHQHLKDNKFVNFEKIVPTKDGCPYLIFNRNTYVLIEHFKKEPVEFSEKQLAN
FT                   LVEFINAFHSASINLKSAVGARYKVQYGKDRIAARNMYSMFTKLKENPQLIKNERLRNI
FT                   ILSTIDTNIEYVKKALEILEDDRYLEVISRSMQENRFIHGKLGIYNIHKCYDKLRLANM
FT                   FDLELNVREKDIATFVKSLLKIDKNFDFEDCISKFYVTSYDNYKKWLVLAMILLPYEYF
FT                   SLLKKIIRFRDLDWASEGFEEKIKKICEKDQYKYKILASLH"
FT   gene            576235..577227
FT                   /locus_tag="COB47_0488"
FT   CDS_pept        576235..577227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0488"
FT                   /product="spore coat protein, CotS family"
FT                   /note="KEGG: ate:Athe_0543 spore coat protein, CotS family;
FT                   TIGRFAM: spore coat protein, CotS family; PFAM:
FT                   aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41811"
FT                   /db_xref="GOA:D9TIH9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIH9"
FT                   /inference="protein motif:TFAM:TIGR02906"
FT                   /protein_id="ADL41811.1"
FT                   /translation="MIALREEITQFFDIEVFYFMPIRDILVLSTDSGLKCFKRVDYSVE
FT                   TLLFIHGGKEHLVSRGFIDIDRFNLSKEGLPYVMLNDEIYVLTDWIDARECELENPIEL
FT                   KAATEKLAMMHEASIGYTNVPEGARVRDDLGKLLTKFEKRCNEFLRMRKMADRKRSMFD
FT                   YEYLFTYSYYFDLAKEALEKLKNSNYLILCDEAREKRGFIHRDYSYHNILYTHDGDVYI
FT                   IDFDYLTYDLRIVDLTSFMQKVLKRIHWDIKTGESILNWYSNVSPLSKDELELVYIILL
FT                   FPYRYWKTCNRYYNGKKSWSEKAFTNKLHEVIAEKEFHYDFVRWLEKQI"
FT   gene            complement(577295..578083)
FT                   /locus_tag="COB47_0489"
FT   CDS_pept        complement(577295..578083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0489"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="KEGG: ate:Athe_0544 putative transcriptional
FT                   acitvator, Baf family; TIGRFAM: transcriptional activator,
FT                   Baf family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41812"
FT                   /db_xref="GOA:D9TII0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII0"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADL41812.1"
FT                   /translation="MKDKLLVVDIGNTNIVFGVYKGKDLIASYRMKTDKEKAADEFGIL
FT                   MTQMLFYNGINPAEIMDVIISSVVPPIMYSFERAIQKYFGTNPMVVGPGIKTGLNIKTE
FT                   NPKEVGSDRIVNAVAANELYGGPAVIIDFGTATTFCALSRKSEYLGGAIAPGIKISAEA
FT                   LFSHASRLHRIELQKPPSVIGKNTVHAMQSGILYGYVGLVDYMVNRIKEEMDEANAKVI
FT                   ATGGLARLIAEESKTIQIVNPTLTLEGLRIIYYKNKQMSV"
FT   gene            complement(578106..578425)
FT                   /pseudo
FT                   /locus_tag="COB47_0490"
FT   gene            complement(578439..579674)
FT                   /locus_tag="COB47_0491"
FT   CDS_pept        complement(578439..579674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0491"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ate:Athe_0546 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41813"
FT                   /db_xref="GOA:D9TII1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADL41813.1"
FT                   /translation="MESFIQNMFAERIGGNKFGKETVLYKFEKIKRAKAKAKELHPDME
FT                   LIDMGVGEPDEKADMGIIGTLAYEAGKDENRGYADNGIYEFKVAAAKYLERVYGVKGIN
FT                   PDTEVNHAIGSKSALALLPYAFINPGDVTIMTVPGYPVLGTITKWLGGEVYNVPLLKEN
FT                   NFLPDLSSIPADIRKRAKLMYLNYPNNPCGAVATKEFFEEVVKFASENNIIVVHDAAYA
FT                   ALVFDGYKPLSFLSVEGAKEVGVEIHSLSKAYNMTGWRLAFVAGNELVVKAFAAVKDNN
FT                   DSGQFKAIQKAGIYALEHPEITEKINEKYSRRHDLLVKTLRELGFDAQKPKGSFYLYVE
FT                   IPKGIKNGRRFETAEEFSEYLITEKCISTVPWDDAGHFVRFSVTFEAKTPEDEIRVMEE
FT                   LKKRLSDVEFEF"
FT   gene            580003..580677
FT                   /locus_tag="COB47_0492"
FT   CDS_pept        580003..580677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0492"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ate:Athe_0547 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41814"
FT                   /db_xref="GOA:D9TII2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0547"
FT                   /protein_id="ADL41814.1"
FT                   /translation="MEVLERKNEKRLKMDKSHIAKIFLTFVFFGVLIGGLFYPKVGLFA
FT                   FVCMIGSVLLSLYKGRYWCYRFCPRGAFLDEFVAKASFNKNIPSVLKSKVAKAFMLTFF
FT                   VVMMSANALLSWGDLERFGKGVVMLLWVTTLIGIILGILFRARTWCVLCPMGTVSGVVG
FT                   KKRGTLKIDAQKCVSCKLCNKNCPMEVEVCYFKENGNIESVNCIRCESCAVICPKNAIE
FT                   IA"
FT   gene            580896..582983
FT                   /locus_tag="COB47_0493"
FT   CDS_pept        580896..582983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0493"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: ate:Athe_0548 anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: ATP-cone
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41815"
FT                   /db_xref="GOA:D9TII3"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII3"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADL41815.1"
FT                   /translation="MITKVMKRDGTIVDFDRKKIENAIFKAAKAVGGSDYSIAEKLTDQ
FT                   VIEILEQKFGYSIPHVEDIQDIVEKVLIENGHAKTAKAYILYRKQHQDMREFKNLFLDI
FT                   ENTVDQYIGKMDWRVNENSNMSYSLQGLNNHISTAVISKYWLNKIYPKEVAEAHINGDF
FT                   HLHDLGVLGVYCCGWDLRDLLLNGFTGVEGKVASKPAKHFRSALGQIVNFFYTLQGEAA
FT                   GAQAFSNFDTYLAPFIYYDKLTYSDVKQALQEFVFNTNVPTRVGFQSPFTNITLDLVPP
FT                   STLKDEPVIIGGKIMDRTYKEFQREMDMFNMAFAEVMMEGDAKGRIFSFPIPTYNITKD
FT                   FDWNSPVVNKIMEMTAKYGLPYFSNFVNSDMKPEDARSMCCRLRLDNRELRKRGGGLFG
FT                   ANPLTGSIGVVTINLPRIGYLSKSEDEYFERLARLMDIAKTSLEIKREVLEDLTKKGLY
FT                   PYSRFYLRDIYARYGEYWKNHFNTIGIVGMHESLLNFMGVGIDTKEGREFAIKVLDFMR
FT                   ERIRKYQEETGILYNLEATPAEGTSYRLARKDKQMFPDIITSGKDEPFYTNSTQLPVDY
FT                   TDDIFTALDHQEELQIRYTGGTVLHGFVGEKIDDIEVCKEIVKKIAYNYRIPYYTITPT
FT                   FSVCPDHGYVAGEHFSCPTCGKECEVYSRVVGYYRPVQCWNKGKQEEFKFRKEYKIAVR
FT                   R"
FT   gene            complement(583045..583449)
FT                   /locus_tag="COB47_0494"
FT   CDS_pept        complement(583045..583449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41816"
FT                   /db_xref="GOA:D9TII4"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0549"
FT                   /protein_id="ADL41816.1"
FT                   /translation="MRNQKLSKSSIVKLLRIFVWTTQILLLIFGIYFSITSKNMLFIEI
FT                   FLIVSISGILFFESIVKNFTTNIPVKLKMWNMSKISWFIACAIIAVVLVNYKPKILLAY
FT                   ILLAITIIILSIAAVLIIDIKIKSRNMKKS"
FT   gene            complement(583427..583909)
FT                   /locus_tag="COB47_0495"
FT   CDS_pept        complement(583427..583909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41817"
FT                   /db_xref="GOA:D9TII5"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0550"
FT                   /protein_id="ADL41817.1"
FT                   /translation="MKLISKIFESFFKYFALVPAFIGFIGGTILSIINKSIGGLLLMLS
FT                   VLVIYLFLPELALLIGRQGFEEVWKQFGIQAKPDFLRSWRLTRIALLISSCTAALIFIL
FT                   KTIETKNFFYLFGIPISGLLFYLVLIADKLIHKLISKNLQNKNLEGTEKFEKPKAF"
FT   gene            complement(583952..584473)
FT                   /locus_tag="COB47_0496"
FT   CDS_pept        complement(583952..584473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_0496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41818"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII6"
FT                   /inference="similar to AA sequence:KEGG:Xcel_0496"
FT                   /protein_id="ADL41818.1"
FT                   /translation="MHAVYAYAGSSKNNQTITFPLSVSGGGKSGAINYNASGSVLKTET
FT                   KLSAQANTQKIGVEAKAGATLVEAKASVGVGPVSWNTALAQGKAEIGGKAEINFKDANF
FT                   GFNGKVGAYLIDWKNTIGVKIGGVSVEVGGSLNAGRGGEFKVEAGKNGIKFKLGGTLGI
FT                   GGAAIIDIRW"
FT   gene            complement(584489..584743)
FT                   /locus_tag="COB47_0497"
FT   CDS_pept        complement(584489..584743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41819"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0551"
FT                   /protein_id="ADL41819.1"
FT                   /translation="MKIEKWLPLGSVVILKNGSKPLMIFGRKQINVKTQKEFDYVGCLW
FT                   PEGNIASDFNFFFNNEDIEKILFRGFENEVEIEFRKMLK"
FT   gene            584950..585900
FT                   /locus_tag="COB47_0498"
FT   CDS_pept        584950..585900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0498"
FT                   /product="glucokinase, ROK family"
FT                   /note="KEGG: ate:Athe_0552 glucokinase, ROK family;
FT                   TIGRFAM: glucokinase, ROK family; PFAM: ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41820"
FT                   /db_xref="GOA:D9TII8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII8"
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /protein_id="ADL41820.1"
FT                   /translation="MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEIMKDM
FT                   AELSLNLVKECGLSLDDIHSVGIGSPGAPDNEKGMILYSNNIAFLNVPMRDEIQKYIPK
FT                   PVNIENDANCAAYGEYVAGGAKGARISVTITLGTGIGGGIIIDGRIYTGSHHAGAELGH
FT                   MVICVDGEQCTCGRKGCWEAYASATALIRMTREAAARNINGTIMKLVNGDISKIDAKTA
FT                   FDAKRMGDSIGAEIVDKYVKYLAEGLANICNIFEPEVICIGGGVSKEGEYLLEPVRKLV
FT                   YEKFYCKQVPMPKIIPAVLGNDAGIIGAALLAKQL"
FT   gene            585940..586584
FT                   /locus_tag="COB47_0499"
FT   CDS_pept        585940..586584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0499"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   csc:Csac_0779 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41821"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9TII9"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADL41821.1"
FT                   /translation="MKIENGSKLLFIGDSITDCGRARPVGEGLHWNNLGNGYVSIVQAQ
FT                   ILTKYPESRIRVINMGVGGDTVRHLKARWQTDVLDLKPDWLSIMIGINDVWRQFDNPLI
FT                   PECHVYLDEYKSTLDELINLTKPNLKGLVLMSPFIIEDNKEDAMRKKIDEYRFAMKEIA
FT                   QKHGAIFVDVQEEFDNFLKHYHSYALALDRIHPNLTGHMIIANAFLKAIEF"
FT   gene            complement(586654..589116)
FT                   /locus_tag="COB47_0500"
FT   CDS_pept        complement(586654..589116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0500"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /note="KEGG: ate:Athe_0554 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41822"
FT                   /db_xref="GOA:D9TIJ0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ0"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADL41822.1"
FT                   /translation="MIGGIKGLSKQELKEKIKQDFQRKIISMFAIDPKEATTYQQYLAL
FT                   GEVIKEYSFERWLQTNKYYKQNDVKQVYYFSIEFLLGKLLVNNLINLGIRDVCKEALNE
FT                   LGITLEDIEEAEREPGLGNGGLGRLAACFLDSMASMGLPGHGNGIRYRYGLFEQKIQNG
FT                   YQVEVPDNWLAEEYVWEVKRSDRACIVKFGGTVRFDIVDGKLKAFHENYEPVWAIPYDI
FT                   PIIGYGCNTVNTLRLWSAEPFENVFDFASFSRGDYIKAVEYRYMVQSITQVLYPDDTNE
FT                   QNRILRLKQEYFFVSAGVQSIIRTFKKRGKPIYELPNYVMIQINDTHPALVIPELMRIL
FT                   IDEEGLPWEDAWDITTKTVAYTNHTIMVEALEKWPIDMVKTLLPRIYTIIEEINRRFCG
FT                   EMLEKTNGDWQNVCNIAIIHDGQINMAHLAVIGSSSVNGVSKLHTEILKNEVLKCFYTL
FT                   YPEKFNSKTNGITHRRWLVEANPDLARLISETLQTDRWIKEPMLMLRFKDFAEDKLTQE
FT                   LAANIKFNNKVKLAKYIKEKYNIVVDPRSIFDVQAKRLHAYKRQLLNALHILHLYNMLK
FT                   ENPGLDIYPRTFIFAAKAAPGYILAKKIIKLINSIADKVNKDPDVKDKLKVVFLENYCV
FT                   SLAEKIIPAADVSEQISTASKEASGTGNMKFMMNGAITIGTLDGANVEIKEAVGDENII
FT                   IFGLRAEEVLDYYKNGGYSATQLYQKDLRIRKIIDQLIGNFFDVPPGEFMDIYNHLITY
FT                   NDEYFVLKDFDSYHEAQMKIDKIYRDTKRWRKMMIINIGASGIFSSDNTIQKYADEIWH
FT                   IKRVEIPD"
FT   gene            complement(589143..590579)
FT                   /locus_tag="COB47_0501"
FT   CDS_pept        complement(589143..590579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0501"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="KEGG: ate:Athe_0555 glycogen/starch synthase,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: Starch synthase catalytic
FT                   domain-containing protein; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41823"
FT                   /db_xref="GOA:D9TIJ1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ1"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADL41823.1"
FT                   /translation="MKVLFAAAEAFPFAKSGGLADVAYSLPKALRKLGIDVRVIMPKYA
FT                   DISPDFSTKMKHLCHFTVPVGWRNQYCGIEYLNLDGIPFYFIDNEYYFKRPGYYGYFDD
FT                   GERFSFFSRAVCEAVYHLDFDVDIIHVNDWHTSIIPVLLKAHYMHSEKHQKIKTVLTIH
FT                   NLKYQGIFPKEVMYDLLSLTDEYFDENKLKYYDAISFLKGGIIYSDKVVTVSKTYANEI
FT                   RTLSYGEGLHGLLSGIGEKLIGIVNGIDYDVYNPATDKFIFVNYDSNTFENRKKENKFK
FT                   LQQMLNLPVSDEIVVIGMVSRLIKEKGIDLIERILSKILTLPIQLVILGAGDYHYEQMF
FT                   RHYALAFPSKVSANICYSEELARKIYAGSDMYLMPSLTEPCGISQLIAMRYGSVPIVRE
FT                   TGGLKDTVKPYNQFTGEGWGFSFANYDPSELFAIIKYALSIYPDKAQWRSIVHQAMTRD
FT                   NSWNASACEYQKVYENLLNS"
FT   gene            complement(590576..591718)
FT                   /locus_tag="COB47_0502"
FT   CDS_pept        complement(590576..591718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0502"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /note="KEGG: ate:Athe_0556 glucose-1-phosphate
FT                   adenylyltransferase, GlgD subunit; TIGRFAM:
FT                   glucose-1-phosphate adenylyltransferase, GlgD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41824"
FT                   /db_xref="GOA:D9TIJ2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ2"
FT                   /inference="protein motif:TFAM:TIGR02092"
FT                   /protein_id="ADL41824.1"
FT                   /translation="MLTNYLGIVSLTENENRLKSLTATRPLASIPIFGRYRVIDFVLSN
FT                   LVNAGVTNVGILVPTKSRSLIDHVGTGKPWDLNRKVDGLYIFNYSYEPPSTSDIKLLKS
FT                   NMEFLLRSKKEMVIFASSYMICNIDFEDVAKFHEESGAEVTVVYKKIANEDEFFLELPT
FT                   LIIDQNSNVMGVGKNIGRRTTVNISLDMFVLSKEFLIDCILTCLENGNCTTFRDFIYKN
FT                   VQNINLKAYEFKGYVGCINSISSYFKVSMDMLNVDIQRELFSKQRPIYTKSNDSPPTRY
FT                   FSTCEVENSFISNGCLIAGKVKNSIISRGVIIEKDTIVENSIIFSKCIIKNGAILKNVI
FT                   LDKNVVIDENATLIGHNKNPLVMEKQSFINLSQLKEVKRI"
FT   gene            complement(591738..592916)
FT                   /locus_tag="COB47_0503"
FT   CDS_pept        complement(591738..592916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0503"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="KEGG: ate:Athe_0557 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41825"
FT                   /db_xref="GOA:D9TIJ3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ3"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADL41825.1"
FT                   /translation="MNGPKREIIAMILAGGQGSRLKELTKTNAKPAVEFGGKYRIIDFT
FT                   LSNCTNSSIDVVGVLTQYQPFTLHTHIGIGTAWDLDRTKGGVYILPPHTNDSGGNWYKG
FT                   TADAIYQNMNFVELFSPEYLLVLSGDHIYIMDYQEMFKFHKEKKADVTIACIEVPIQEA
FT                   SRFGIMNTKEDGRIYEFEEKPKHPKNNLASMGIYIFNWEKLKKYLKEDAKDEESAHDFG
FT                   KNIIPKMLKGGEKLFAYRFKGYWKDVGTVESYWEANMDLLNEECLLDIPSCTLDLYNEE
FT                   TKVYTSSIAYPPQYIAPCAKVKKSMVVEGCSIWGEVYNSVLSYNVYVGQNAKVISSVLL
FT                   SSASIEDGAIVENAIVCSGARVTKGCKVIGKPGKIAVVPENKKVTSDIIISE"
FT   gene            complement(592930..594882)
FT                   /locus_tag="COB47_0504"
FT   CDS_pept        complement(592930..594882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0504"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; KEGG:
FT                   ate:Athe_0558 1,4-alpha-glucan branching enzyme; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41826"
FT                   /db_xref="GOA:D9TIJ4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ4"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ADL41826.1"
FT                   /translation="MIKKVKSTIYLSDIKKFESGEHFESYKFLGSKVVNYRGKVGTVFC
FT                   VWAPNAKSVSVVGNFNNWCGEKHKMIRVYGSGFWWLFVEGIGEGELYKYEIIGADGKRV
FT                   LKADPYAIYSELRPNTASIVKNIPDYEWHDQEWMEKRKTTPPYDKPINIYEVHLASWKM
FT                   KKDGSIEKAGEFYNYRELAHMLVDYLKEMNYNYIELLPVLEHPLDMSWGYQPTGYFSLT
FT                   SRYGNIEDFMYFIDFMHQNGIGVIVDWVPAHFCKDEHGLYRFDGTFLYEYENELLRENY
FT                   TWGTATFDFSKPQVHSFLISSAMFWFDVYHIDGIRVDAVSHIIYMNNNQKNRYGGHENI
FT                   EGIEFIKKLNCAIFSKHPNVLMIAEESTAFPLVTYPTYDGGLGFNYKWNMGWMNDTLKY
FT                   MQKHPDERKHHHNLLTFSIMYAFSENFILPFSHDEVVHGKKSLLDKMPGDYNQKFANLR
FT                   LLYGYMYTHPGKKLLFMGGEFGQFIEWRFYASLDWLLLDYPMHRTLQHYVKTLNRFYLE
FT                   NKALWELDHKMDGFRWIDVHNWQQSIISYLRFSKDPDDFLVVICNFGLASYENYKIGVP
FT                   RKGMYLEVFNSDKAEFGGNNIVNTEKLKTIDEVWHGYNQCIEFRLPALSCLIFKPVEFF
FT                   NTQEEKNKNDNNIQT"
FT   gene            595191..595883
FT                   /locus_tag="COB47_0505"
FT   CDS_pept        595191..595883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0505"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: ate:Athe_0559 DNA repair protein RadC;
FT                   TIGRFAM: DNA repair protein RadC; PFAM: DNA repair protein
FT                   RadC"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41827"
FT                   /db_xref="GOA:D9TIJ5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ5"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ADL41827.1"
FT                   /translation="MANNLHEGHRERLKRRFIEQGLDGFEDHQVLELLLFFSIPRKDTN
FT                   DIAHRLISTFGSISNVFEAHPKDLQKVNGVGENSAILISLISQISRRYLADKNRKTFQL
FT                   RNVEVASEYIKSLFVGRKNEVFYVICLDTQLNVIYSAPLFEGTVKEAVVYPRKVVECVI
FT                   RYNASSVILAHNHPGGSVRPSMDDINTTQKIVNALSTIGVTVNDHFIVAGDKYYSFAQN
FT                   GILPQPQI"
FT   gene            complement(595946..597034)
FT                   /locus_tag="COB47_0506"
FT   CDS_pept        complement(595946..597034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0506"
FT                   /product="Peptidoglycan-binding lysin domain"
FT                   /note="KEGG: csc:Csac_0788 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SH3 type 3 domain
FT                   protein; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41828"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ6"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADL41828.1"
FT                   /translation="MIFKPNGNYIVYSVQSGDSLWILSQTFGTSIETLKSFNNLTNDTL
FT                   YVGQKLIVKKVSLNPVQINGTIKWWTYVKSAPSSSSQNLFYLTQGQTVNVIGKQLDFYK
FT                   ILTSKGTGYVSIWAVDIKQDITDNSKPSNFFYSFIPVDTSGDYVTYSYYKVQSGDTIWS
FT                   IAVKFGIPDYELMSVNNLNENSYIYVGQTLKVPVHTIAVHSNENGVEMLDWFSQGNYVF
FT                   PIGSVGKFIDIQTGKYFFAKRTMGASHADVETLSYKDTQIMKEIFGGSWTWERRPFILE
FT                   VKGRRIAVSVSGMPHAGVDGVPYNQNVANRSGGYGYGPNLDTIVNGMDGHFDVYTLNGL
FT                   RHKDNQIDPQHQLTVSIAAGLR"
FT   gene            597210..598154
FT                   /locus_tag="COB47_0507"
FT   CDS_pept        597210..598154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0507"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ate:Athe_2221 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41829"
FT                   /db_xref="GOA:D9TGS3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D9TGS3"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADL41829.1"
FT                   /translation="MSKIIKAQNEKFLKLLCIIKKIAETTVQRRKNSKRGRPRKFSLFQ
FT                   IIACLVYKVKRGIASFRELEYRINQDTEFKKSIGLEKSPDYSYIAKLAAKIEEDLLQAI
FT                   RDVLIAEINPDVSITIVDSTPLRSSKQDKEAKIGIHVTIGFYKGYKLHLLCTGKEEVIP
FT                   LFWILTTANKHDSTQEELLYRAWNYNSKILLADAGYDCNRWFDIANRLEIKFVAGVNRR
FT                   NMRNEENVKNRFRAENIKFLGTEEGKKLYKLRMKIEKLFSKLKGEYNLENIRLRGFKSY
FT                   KRHTDWILITFLFEQFLRKLEGKKFSFAYEWNQ"
FT   gene            complement(598174..598596)
FT                   /locus_tag="COB47_0508"
FT   CDS_pept        complement(598174..598596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0508"
FT                   /product="peptidoglycan-binding LysM"
FT                   /note="KEGG: ate:Athe_0560 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41830"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0560"
FT                   /protein_id="ADL41830.1"
FT                   /translation="MKSLLRFWLFVVIIIILSLVIVSPSFASDMQKEEALFFDANGNPS
FT                   YITIINKSSVEYIYLYEISRLMGGSFTFDSKDYNFLQSKFLIDQNEFIFKLDSNVVIFN
FT                   GKNFYMDGPMQIIQNRICVPYSTLKTYSLLNKNYCQ"
FT   sig_peptide     complement(598513..598596)
FT                   /locus_tag="COB47_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(598702..599169)
FT                   /locus_tag="COB47_0509"
FT   CDS_pept        complement(598702..599169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0509"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="KEGG: ate:Athe_0561 6,7-dimethyl-8-ribityllumazine
FT                   synthase; TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41831"
FT                   /db_xref="GOA:D9TIJ9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIJ9"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ADL41831.1"
FT                   /translation="MRTFEGSFCGKDLKFAIVISRFNSFITDELLKGCLDGLKRHDVDS
FT                   ENIDIYYVPGAFEIPLVCKKLAKSKKYNAIIALGAVIRGSTPHFEYVSAEVSKGIANVS
FT                   LEQEVPVIFGVLTCDTVDQAIERAGTKAGNKGFDAALSALEMANLMKNISL"
FT   gene            complement(599156..600364)
FT                   /locus_tag="COB47_0510"
FT   CDS_pept        complement(599156..600364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0510"
FT                   /product="GTP cyclohydrolase II"
FT                   /note="PFAM: GTP cyclohydrolase II; 34-dihydroxy-2-butanone
FT                   4-phosphate synthase; KEGG: ate:Athe_0562
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41832"
FT                   /db_xref="GOA:D9TIK0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK0"
FT                   /inference="protein motif:PFAM:PF00925"
FT                   /protein_id="ADL41832.1"
FT                   /translation="MYDLKDVIQKFKNGEFVIVFDSQNREDEADLILGAQFSTADKISF
FT                   VLNHAKGMFCVAIDKEIQRRLNLYVPYNTQNTCTFTVTVDHKNTKTGISAEERSITCKE
FT                   LANPNAAASDFKIPGHVSPVVAHEKGILARKGHTEAAVDLCRLSSLFPAAVMVEILDEK
FT                   GDSHNKEYVKSLAKRFSIPVTTIEEIEKYILLNHPTVQKEAEAELPTQYGKFKIFAFKN
FT                   YFSQKEHAVLINKTFNPSQTVNVRIHSSCKTGDIFHSLRCDCHQQLEFFLQFMSENKNC
FT                   MLIYLDQEGRGIGFANKIKAYAYQEQGFDTYEANNILGFDDDLRDYFDALHILRFFGIS
FT                   KINLATSNPEKISFLQDCGIEILKRIPTPIVVNPYNRKYIHSKILKKKHEILIKGEDSF
FT                   ENF"
FT   gene            complement(600370..600948)
FT                   /locus_tag="COB47_0511"
FT   CDS_pept        complement(600370..600948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0511"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; KEGG:
FT                   csc:Csac_0793 riboflavin synthase subunit alpha; PFAM:
FT                   Lumazine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41833"
FT                   /db_xref="GOA:D9TIK1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK1"
FT                   /inference="protein motif:TFAM:TIGR00187"
FT                   /protein_id="ADL41833.1"
FT                   /translation="MFSGIVEEVGRVITMKKIEDIAKLSIEVKKIEAKIGDSIAVDGVC
FT                   LTVTNIANSKFDFDLSPETIERTTLKFLKEGMPVNLQPALKMGDRIGGHIVLGHVDCIG
FT                   TVCMQKIHGKSRIIGIKPFENFKGLIVKKGSVAIDGISLTVVDSFDTYFTISLIPHTLE
FT                   NTTLKYKKVGDYVNIEFDYIAKIVKENLR"
FT   gene            complement(600941..602056)
FT                   /locus_tag="COB47_0512"
FT   CDS_pept        complement(600941..602056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0512"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="KEGG: ate:Athe_0564 riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41834"
FT                   /db_xref="GOA:D9TIK2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK2"
FT                   /inference="protein motif:TFAM:TIGR00326"
FT                   /protein_id="ADL41834.1"
FT                   /translation="MKCLSHSYYMNMALELAKKASPLVLPNPRVGCVIVKNGTIIGKGY
FT                   HQKYGEKHAEVLAIEDAIKNGNSLKNATMYVSLEPCCHFGKQPPCTEAIIKSGIKKVII
FT                   ATRDPNPLVNGKGIQILKQHGIEVVEGVLQKEAESVNKEFFKYMKKGIPYIAIKVAQSI
FT                   DGKIATPSNKRFLFNTDDENVFVHSLRQKYMATLVSVNTVISDNPILNVRYGEIIRQPI
FT                   RVVIDTNLRIPLECNIVKTSDEYSTYIVCSENVNDTQKIKLLSQKGIKIIFAKQSEDGH
FT                   LELSDVFSKLAQQKIISVLVEGGSMLNFSLLKKRIADYWYSLIFNVFIGGQNTKGVVGA
FT                   EGFEEFFPKLVNPKVTIFKNSTIIEGDISYV"
FT   misc_binding    complement(602176..602304)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 115.91"
FT   gene            602559..603695
FT                   /locus_tag="COB47_0513"
FT   CDS_pept        602559..603695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0513"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ate:Athe_1984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41835"
FT                   /db_xref="GOA:D9TIK3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADL41835.1"
FT                   /translation="MNIIPYHELRKISPEKARELIRKVFEANNKNISKTAKILGVSRHT
FT                   VRRAVYGPVEDKSRKPKTCPKKLSSELENLIIQEAKKTGFRYRRLSLYLFRKYGVKISE
FT                   NTIKSILKRNSVPRKTRKTKKGERSLYDYESLIPFSEFQLDTKHLLDKESLPKEVYEHM
FT                   IKYNLPCYEWNMIDVATRTRFTAYSYELSSTFGFMFITLVVLWLRTHNVRNPIRIRLDN
FT                   GAEFCGGSEKKLKEWNEMLSFLGVELNPIPPKAKHLMGIIENSHRADDEYFLMIHAERC
FT                   ITKDEFMTRAQKWQDTWNFYRPHNGKGMNGRTPFEKFRDSKILVSSHVFQFPTLLLEDL
FT                   LKKVGTFYSLFCNKLGGKYVFTTCQNLPYTKFVDYSKA"
FT   gene            604083..604642
FT                   /pseudo
FT                   /locus_tag="COB47_0514"
FT   gene            604653..606191
FT                   /locus_tag="COB47_0515"
FT   CDS_pept        604653..606191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0515"
FT                   /product="transposase"
FT                   /note="KEGG: ate:Athe_0076 transposase; TIGRFAM:
FT                   transposase ; transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41836"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK4"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADL41836.1"
FT                   /translation="MVTVQAKLIFEGSEDKQRVLDLMRRWSSCMRYAYKRLLEGHKRNE
FT                   LKKQLQGIFNLNSRYVDDAIMKAKSILTSCKERGENPKKVVFGGRQLFEKLQKRHINGK
FT                   AYKKLQLKWQEKRKGNLYSRGDRSKKGNLNTRIEIDEDCTRLRINVGEREYVYARIQPG
FT                   WKIKDGRYIDRNQLLEAISICGQPYSVQLKLKSGVVYAYFAIEEVFPQPAITRANGVIG
FT                   IDTNAYPRHVAWVETDEHGQLLGYGRIPMPELESGSFEKKEYYRWQYAHMIVQMAKEKQ
FT                   KAIVIESLSIKDRGRREDFSGRRSRRIRHYFGYRSLLEKVKLLAKREGIEVIEVNPAYT
FT                   SVIGMLKYAPQFMVSKDVASSYVIARRGLGLRDRIPHNYMMFLGRLDVNELEELKEYVR
FT                   KVVKNTYVRKKQLREIGRVIKFLQSLESEAERLSVPLDGTSTGSRGKNHNLWQVLKVAV
FT                   VTPLSPERVLRDLSVLKSLLVSGQVGKTYKGASSCFLGQGLWLSQIPPAGAGKA"
FT   gene            606238..606507
FT                   /pseudo
FT                   /locus_tag="COB47_0516"
FT   gene            606527..607195
FT                   /locus_tag="COB47_0517"
FT   CDS_pept        606527..607195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0517"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ate:Athe_0668 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41837"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0668"
FT                   /protein_id="ADL41837.1"
FT                   /translation="MKKRKLFVLGLLALITIVATIISYNAKSIQQLNNEEEIKRVVKSA
FT                   LNIYSKIVYPSEYTKSPDIKIPSQLIDRKMNEVTQECEKYYSAKSGILANKIKVFQTAV
FT                   LGDAYSPSDIRTVEWKINNIKFLETRIEGDTATVIADVYCENKMIALIPIDNINENVKP
FT                   EEMTIEYQKRLYEETQKLPKKLVTYNPKGVMRYYFNLTKENGIWKITSENFNYLPGYEP
FT                   "
FT   sig_peptide     606527..606607
FT                   /locus_tag="COB47_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.721 at
FT                   residue 27"
FT   gene            complement(607453..607742)
FT                   /pseudo
FT                   /locus_tag="COB47_0518"
FT   gene            607774..608454
FT                   /locus_tag="COB47_0519"
FT   CDS_pept        607774..608454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00035875001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41838"
FT                   /db_xref="GOA:D9TIK6"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK6"
FT                   /inference="similar to AA sequence:KEGG:GSPATT00035875001"
FT                   /protein_id="ADL41838.1"
FT                   /translation="MKIKIFLMILFFILLGIILFFGNGEPRYFIVFLLAFFPIGTFLFF
FT                   AGAYKFLILFLQKKGNTQNVSKIKKWVDENLNFLLKMIIYHFVCILIFIIYTSAAWDSL
FT                   LNSSSIDSFVIYTPILIYEIRNNSFVLVLILFYIFALPFWISIDIYIYSVGFLITFIQH
FT                   KINMLKFNTKMIGPLSPWEYCIASFLQFDSPLTILNTILLYLFTLILTFAFVKLSFSKL
FT                   RKII"
FT   sig_peptide     607774..607848
FT                   /locus_tag="COB47_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.767) with cleavage site probability 0.764 at
FT                   residue 25"
FT   gene            608715..609701
FT                   /locus_tag="COB47_0520"
FT   CDS_pept        608715..609701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0520"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_0566 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41839"
FT                   /db_xref="GOA:D9TIK7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK7"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADL41839.1"
FT                   /translation="MPSIEDVAKRAGVSKATVSRVINGTANVSEKKKKAVLEAIKALNY
FT                   TPNVTAKNLARRKTDTIGIIIQQLSSWFYSEVVALLNQYITQRGYGAIFCQLIDNIDYF
FT                   KFLVGRVDGVIVFGYKTINKQALKLLYANNVPVVLAENNTEFPNVPRVNVNNLQGGYIA
FT                   TKYLIEKGCRKIVHISGPLESFESIARYEGYKAALRDFGVDFDEELLIEGDFMFQKAYE
FT                   SIKKLLKNKKIDGIFAANDLMAYASMYALDEMGISVPDDVKVVGFDDVDLVGLQLSKMP
FT                   RLTTVRQPIDLMAKTACDILFGKIDDPTKKFESEYILDTQLIVRQSA"
FT   gene            609739..611247
FT                   /locus_tag="COB47_0521"
FT   CDS_pept        609739..611247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0521"
FT                   /product="xylulokinase"
FT                   /note="KEGG: ate:Athe_0567 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41840"
FT                   /db_xref="GOA:D9TIK8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK8"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADL41840.1"
FT                   /translation="MYFIGIDVGTSGTKTILTDSKGNILATATFEYPLYQPQIGWAEQN
FT                   PEDWWDASVKGIKAVLEKSKVNPEEVKAVGLTGQMHGLVMLDKNYNVIRPSIIWCDQRT
FT                   AKECDEITEKVGKERLIEITANPALTGFTASKILWVRNNEPQNYEKVYKILLPKDYIRF
FT                   KLTGEFATDVSDASGMQLLDIKNRCWSDEVLEKLEIDKELLGKVYESPQVTGKVSRQAS
FT                   EITGLCEGTLVVAGGGDQAAGAVGNGIVKTGVISSTIGSSGVVFAHLDEFKIDPQGRVH
FT                   TFCHAVPGKWHVMGVTQGAGLSLKWFRDNFAHIEKAAFEFIDKDPYILMDQEAELANPG
FT                   ADGLIFLPYLMGERTPILDPYAKGIFFGITAKHTRREFIRAVMEGVVFSLKNCLDILYE
FT                   MGIEVKEVRVSGGGAKSKLWRQMQADIFEMDVWTLNSKEGPAFGAAILAAVGAGEYQKV
FT                   EEACDTMIQKVDSCRPNEKLFEIYRKTYKLYNSIYPRVKDLFNI"
FT   gene            611352..612839
FT                   /locus_tag="COB47_0522"
FT   CDS_pept        611352..612839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0522"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   ate:Athe_0568 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41841"
FT                   /db_xref="GOA:D9TIK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIK9"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADL41841.1"
FT                   /translation="MKLRRSLWLGVFEFFLFFLIGFPLAVQVAELFFHIRKPIIEYFQI
FT                   VTLFLAIVFFTVFYIIRYSGMLKKYEVFEKKQKFIIKKLKEEKDNIEKSYFDSIQLNKE
FT                   MTNIVKRLIETERDLREKNEWLKNFFELSTRIISLSTVENIVATVGEYSLGSLQFFRMS
FT                   VYHDGDDRTFRILGQFGQKDAHEHLLLNRAKEDTNIAYKIENKNIVKIAIPVVSEEKCE
FT                   GICFYGIKCKSTLSEDIEYYISLCNFITIAIKNAIYYSNLKKQKSEIEDLYEKSTYMNE
FT                   KLRETVEELNKSKAELEKKNKEIEKFFYETILCLSKAIEYKDVYTKGHCERVQNIALKI
FT                   ADELSLSQEEKDVLKVACLLHDIGKIGVKEDILNKRGSLEAHEYVEIQKHPLIGYNILK
FT                   DLDFTERIKKVVLQHHERVDGRGYPFGLKDKEIDLLAKIVAVADAYDAMTSDRPYRKAF
FT                   DKETALSEMKRCAGSQFDTTIVEKLLNLAQKGLVMFL"
FT   gene            612901..613485
FT                   /locus_tag="COB47_0523"
FT   CDS_pept        612901..613485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0523"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: ate:Athe_0569
FT                   response regulator receiver and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41842"
FT                   /db_xref="GOA:D9TIL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL0"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADL41842.1"
FT                   /translation="MFKVILAIKNQRLFSIVKNTFIENGYTIADTATDFADCLRKIRVL
FT                   KPDIVIMEYGFSVGSMVEMIDILKNDRICPVVILANQAQRSNIESVILEDDEFNIFLYS
FT                   PFNKWAFISFVETIIKNWMRLRKLEEQIRKLQDDLETRKLVERAKGILMKELKLDEESA
FT                   MKKLQKLSMDRQMPIKEVAKRIIEWKLKNKK"
FT   gene            613461..614183
FT                   /locus_tag="COB47_0524"
FT   CDS_pept        613461..614183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0524"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; KEGG: ate:Athe_0570 peptidase
FT                   C26"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41843"
FT                   /db_xref="GOA:D9TIL1"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL1"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ADL41843.1"
FT                   /translation="METEEQKVNKVSLMNVLIFGGFDTESGKLYVMNEYIEVLVMLNAK
FT                   PIIFPISILSTELLKEYIQVCECVLFCGGEDVHPKFYGKEPQWGIRRINLLRDKIELEA
FT                   MKISYEMDRRVLAICRGVQVMNVAFGGTLIQDIERKSSISHYQNLNGMYGYHTVEVVGG
FT                   LFTCIFGSQKILVNSFHHQAIDQLAPGFEIEAVSTDGIVEAISKKDRSFFVGVQWHPEL
FT                   MAKDDMFQRRLFERFLKE"
FT   gene            614190..614972
FT                   /locus_tag="COB47_0525"
FT   CDS_pept        614190..614972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0525"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   ate:Athe_0571 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41844"
FT                   /db_xref="GOA:D9TIL2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL2"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADL41844.1"
FT                   /translation="MSIDKISEIILKYSGKIIYSLIVLIAGFLILKFSNRMLEKWKKKQ
FT                   RSSVFPINQKRIDTLAALFKSIIKYSIYFLIVVLILENFNVSIKTILAVAGIGGLAIGF
FT                   GAQSLIKDVIAGLFLIIEDQLSVGDYVTIDGRSGTVKEMGIKTIKILDYNGSIHIIPNG
FT                   SIGAITNWSRHNSKAIVDVKLNTKMNFDEVSLKLQEVFKEIEEEFKEDIVTPPQIVGIV
FT                   DTNWIEYTLRIVTETKPLRHWDLERAMRKKIIEKLFVS"
FT   gene            615012..616730
FT                   /locus_tag="COB47_0526"
FT   CDS_pept        615012..616730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0526"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="manually curated; TIGRFAM: prolyl-tRNA synthetase;
FT                   KEGG: ate:Athe_0572 prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); YbaK/prolyl-tRNA
FT                   synthetase associated region; Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41845"
FT                   /db_xref="GOA:D9TIL3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL3"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADL41845.1"
FT                   /translation="MKVSELFMPTLKETPSDAEIESHKLMLRSGFMRQLSSGIYVYLPL
FT                   GYRVLRKIENIVREEMDRSGAQEVHMSALMPKELWEESGRWAIFGPEMFRIKDRNEREY
FT                   CLGPTHEEAFTYIVRNEISSYRDLPKILYQIQTKFRDERRPRFGVMRCREFTMKDAYSF
FT                   DIDEKGLDISYQKMYDAYVRIFKRCGLDVKIVEADTGAMGGASSHEFMVPSSVGEAEIA
FT                   YCKACGYAANLEKAECLDIPVETNEDLKEKQEVYTPNVRTIEELVNFLSIDSTKFVKTM
FT                   IYKADDKFVAVLVRGDREVNETKLKNLLGATELELASAEDVERITGAKVGFAGPISLSI
FT                   DVYADNEIKYLKNFVVGANKTDYHIKNVNLSDFKVTRFADLRNITQDDLCPKCRSQKVT
FT                   IERGIEVGHIFKLGTKYTEAFGCVYTDEKGEKKFMIMGCYGIGINRTAAAIIEQMHDED
FT                   GIIWPITVAPYEVIVVPVNVKDENQSKIAFEIYENLQKNGVEVLIDDRDERAGVKFKDA
FT                   DLIGIPFRVTVGKKVSEGKIEIRNRRTKESFEFEIDNAVEFIINLIKQEKAKYQV"
FT   gene            616822..617451
FT                   /locus_tag="COB47_0527"
FT   CDS_pept        616822..617451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0527"
FT                   /product="Arylformamidase"
FT                   /EC_number="3.5.1.9"
FT                   /note="KEGG: ate:Athe_0573 cyclase family protein; PFAM:
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41846"
FT                   /db_xref="GOA:D9TIL4"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL4"
FT                   /inference="protein motif:PRIAM:3.5.1.9"
FT                   /protein_id="ADL41846.1"
FT                   /translation="MRIIDVSIPISNDMVYFPGDPKPQISRVYSMENKDPANVSKIILS
FT                   SHTGTHIDAPAHFIKNGNTIDKIPLERLIGKVRVLDVGKEDSITKKFLESKDIQYNERI
FT                   FFKTKNSWYLKRDTKFFKNFVYLSADAAEYLVEKKVEVVGIDYLSIEEFNSNNFPVHRL
FT                   LLSNDVVIVEGLCLLDVNEGRYKYVALPLKIEECDGAPARVIIIED"
FT   gene            617546..617968
FT                   /locus_tag="COB47_0528"
FT   CDS_pept        617546..617968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0528"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tex:Teth514_0702 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41847"
FT                   /db_xref="GOA:D9TIL5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL41847.1"
FT                   /translation="MIALDERKRLEELGLKIGILREEKRISQKELAKRLEISPQALANY
FT                   EKGKRMPGINILVRLSEELDVSIDFLLGLTDIRKPRSRMVKEQLEMLESIQEKEEILSL
FT                   IEELSNWEPEAVKIIERFLKRVRKNIESRDKGRHIQ"
FT   gene            618378..619133
FT                   /locus_tag="COB47_0529"
FT   CDS_pept        618378..619133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0529"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ate:Athe_0574 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41848"
FT                   /db_xref="GOA:D9TIL6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL41848.1"
FT                   /translation="MELSKIQTPRNPLKSGGQSATISSPVQGGVQEQPSAGSIFDSVKK
FT                   KERRDELKKNTIIERLAAASAETQAAVAQATRNVNELQVAVQEIAASAQEASKAANESL
FT                   KAIQEIEKVAKVSDEKAAELSNSIANLQTLIQDISDEIEEMIRGIELAAQTSLESAENV
FT                   LQLERQANEIRSTAQAVMEVADQTNLLALNAAIEAARAGKHGRGFAVVADEVRSLAEIT
FT                   NKAAIEIQNIIEEIQKDVNVVAEDIRAFL"
FT   gene            619254..620540
FT                   /locus_tag="COB47_0530"
FT   CDS_pept        619254..620540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0530"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: csc:Csac_2393 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41849"
FT                   /db_xref="GOA:D9TIL7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL7"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADL41849.1"
FT                   /translation="MKYTQNEKILQVTEKTLVVGVDIAKERHVGRAFDFRGVELGKRIE
FT                   FENRKEGMEKFLDWANKIMKANGKDNMIVGIEPTGHYWLCFEQYLRENGIKVVLVNPFH
FT                   VKRSKELDDNTQTKSDIKDPKTIAMLVKDGRYTEPNIPAGIYAEMRVAMNIYERLQKRL
FT                   SVLKNQIINWLDIYFPEFLEVFSDWEGKVALLTLKEMPLPCDVVEKGVEGIIECWRDKV
FT                   DKRAISRKRAMELVEAAKRSIGKKEGRKLARQEMRYLLEEYELLRKQLEGIEDEMAKLL
FT                   KDVPNGEKLLEIKGVGVKTAVGFISEVGDIMRYEDAKQIQKLAGLNIVENSSGKHKGQT
FT                   CISKRGRGRLRSSLFKAMITIVAKNEEFKKLHMYYTMRQNNPLKKKQSLIALCCKLIRI
FT                   FYAILKKGIKYDGNKMLSDIKREALATTA"
FT   gene            621088..621252
FT                   /pseudo
FT                   /locus_tag="COB47_0531"
FT   gene            621279..622265
FT                   /locus_tag="COB47_0532"
FT   CDS_pept        621279..622265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0532"
FT                   /product="CheW protein"
FT                   /note="KEGG: ate:Athe_0581 CheW protein; PFAM: CheW domain
FT                   protein; Hpt domain protein; SMART: Hpt domain protein;
FT                   CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41850"
FT                   /db_xref="GOA:D9TIL8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL8"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADL41850.1"
FT                   /translation="MTDQLFSAAELEEIKKEFVVETYEHLENAQDALLQLESDPKNYET
FT                   LNFIFREIHSIKGGANFLGLQDIINVSHEMESLLDKMRNYEINPTSEVINTILEGIDII
FT                   RRLADIINSGSGQVFDYSAYIERLKEITNSSQSSQVVLDKESNDKNPNRFELERNFDYS
FT                   QNSNVLKTFDLNEIDETTDEDYYKIIVSFEYGNVVYGIEVEFVREIVKPADVTPIPFAP
FT                   EHVMGLMNLRGDVVTIVDFGKLLGVEGNDGCNHKVLIIGDEAMTFGLFVDNVKEVLSVL
FT                   PDEIKEANIASVSTEILKGIVERDGEFVQVIDIKKIIERTKNSVELI"
FT   gene            622266..623267
FT                   /locus_tag="COB47_0533"
FT   CDS_pept        622266..623267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0533"
FT                   /product="chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   ate:Athe_0582 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41851"
FT                   /db_xref="GOA:D9TIL9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIL9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL41851.1"
FT                   /translation="MAWYIYAFSVLMLIVIVAEGFLIVKKSKEIQNIIYFMATRVDESK
FT                   VPKEFINLYKNRIQMIEKPLKDEIYKLRSENESLKDEIEKSNFESYRNEIYQRFKTLFM
FT                   SLGEVTEAFKMVLDEINEALIKNLDDMNIRSTTVESDLVKGKNKISKSVEDINLILNQM
FT                   RDLSKDVLNLSNHIEKMERVAGIINDIVKEISFISLNAQIEANKMKDSLTFSLLASEMR
FT                   KLADGGKQNLKEISKAMANVVDDINANNKKIENFVNRIKELENSTREITDEIDSLSNLI
FT                   SSVLGYQEELYNQIKQHFAGIQEIVGVLENIHTEAVQIVEQEFKENKEFVKV"
FT   gene            623288..623731
FT                   /locus_tag="COB47_0534"
FT   CDS_pept        623288..623731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0534"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ate:Athe_0583 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41852"
FT                   /db_xref="GOA:D9TIM0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41852.1"
FT                   /translation="MGRITFLIVDDSPVWRRIIRKFVEEKLKGIVVAEASDGLEAINLY
FT                   NKLKPNVVTMDIEMPELDGIRAMEEILRYDKNAKIIVISSKGEEDTVRKALLKGAKDFI
FT                   VKDLETEKWLKRFENVIKNDETKNSKNTFFDNIRRYIDRFKRR"
FT   gene            623759..625597
FT                   /locus_tag="COB47_0535"
FT   CDS_pept        623759..625597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0535"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   KEGG: ate:Athe_0584 diguanylate cyclase/phosphodiesterase
FT                   with PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF
FT                   domain containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41853"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL41853.1"
FT                   /translation="MSLRKEIYEKIQGGKIEVFVENLKGYFGNISDYVIVIWTEDGTIL
FT                   EFKESGDKLLGYLPEQVEGKKWIDIFIDEKEKEEMNWVYKKLVNNEQIKYYVNPVKDVN
FT                   GIKKTFLWCNSRVEIAESNRKVFLSIGFSLDEIERLNKKIQKYEREFNKINEESESLKF
FT                   RLSKQDIVLKQKDEIIKDYKNKLEFLAFFDELTKLPNKNSLIRWLNLRISNVDRDNTYL
FT                   IFLEVRNLEKLNVMYGYDLVDELIVQISKRIEDILSKESKVFKIGFDRFAIICKVENVS
FT                   DHIENLLSQLTVIYNINGNLIRVNYNIGATVIDDANDSTASILRKCDLALIKAKEKGLN
FT                   EYEVFKPSLEIQTLKEGIIEKELRNGMDLNEFILFYQPIINLYNRQIYGLEALLRWHYL
FT                   KSVFVSPLEFIPIAEKCGLIVDLGKIVLKQSLESAKIFSNYFNRDFVISINISPRQFSD
FT                   KEFISSIIQIVENEKIKNLKLQFEITEKVAIENINYAIEVINELKKYNITFALDDFGVD
FT                   YSSLNYLRKLPIEAVKIDKSFVQEIENEETYFVVETIIKLCNKLGLKVVVEGVETENQY
FT                   KILKELGCDYVQGYFISKPLNFEEIVKFIKENEFGK"
FT   gene            625702..626328
FT                   /locus_tag="COB47_0536"
FT   CDS_pept        625702..626328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0536"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: ate:Athe_0585 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41854"
FT                   /db_xref="GOA:D9TIM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0585"
FT                   /protein_id="ADL41854.1"
FT                   /translation="MIFKDRIDAGEKLAQKLEVFKERQDAVLFAVPKGGVVVSKVVADR
FT                   LKIPFDIVIAKKIGAPFNKEFAIAAVDINGDVILNSEYIEYFSITEEYIEHQKKKVLEN
FT                   IREQLISYRGSVEYKSLENKVAIIVDDGIATGATTKACIRFLSKLNPKKIYVATPVIAP
FT                   STLKELEKECDGIFYIVSSEPFWAVGQFYLDFSQVSKEDIKKMLS"
FT   gene            626422..626946
FT                   /locus_tag="COB47_0537"
FT   CDS_pept        626422..626946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0537"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ate:Athe_0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41855"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL41855.1"
FT                   /translation="MDFYRVGDKVISLQKIVDEVKKILDLRQKGFSQIEVAEKLKIDRS
FT                   FISKLEGLGEVRKGKNIAAIGFPVKNKHEVEQVLKSYGINYYLLMTEEERNSFINSLSA
FT                   AQLLNIMGEYINNFKMFDIVIAMGSDFRLNWFKAFLDCEVITIPLGKSPLKYDVEVDVE
FT                   ELKRILDSIVE"
FT   gene            626972..627883
FT                   /locus_tag="COB47_0538"
FT   CDS_pept        626972..627883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41856"
FT                   /db_xref="GOA:D9TIM4"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0587"
FT                   /protein_id="ADL41856.1"
FT                   /translation="MKRVVSVSIGSSKRNHKTVAKIMGIDFEIERIGTDGDIKKAIEII
FT                   KSLDGKVDAFGMGGIDIVLYGGGKNYVIREAIPIKNAAKKTPLVDGTGVKNTFEKWVIK
FT                   YLQDNSIIDFKGKTALVVCALDRYKLAEGLYEAGCKLLLGDALFALGIPLMIKSLRVFY
FT                   YLAALLVPLIIKLPFSMLYPNDDKKEENPKKLRKYWKYFEIADIIAGDYKYIQKYMPDN
FT                   LEGKIIITNTITKEDVEELKRRKLKMLVTTTPEFEGRSFGTNVVEAILVALTGKKLEDM
FT                   SQEEIEKLIKEIDFKPRIEIFY"
FT   gene            627903..628772
FT                   /locus_tag="COB47_0539"
FT   CDS_pept        627903..628772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41857"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0588"
FT                   /protein_id="ADL41857.1"
FT                   /translation="MIKIYTITFVLEGESRIFLPEYAKFFPLFLRKFLVVNSQPKFEEY
FT                   IRLINGIEMRLEFFIFPKTVNLSKRYKKIKLAIDQQRRGRVIHFDWTYEENVHINCFIA
FT                   YYIVREILKKYGQRLKNRKIGIIGLEKAKKNGLLYELAENTDILYTSFDSFQETKIADE
FT                   LLGEFGTVIINCWEEEKLFENVDIVFVFRELDKKAYGLKRGIVCYPEKGVVEDFEFLKK
FT                   SFFLSEICVDFLPLKDICIYNVTPFINLPINMVEIICEKLLFTTINSFSDAKKVFTKDL
FT                   FDVKIKLK"
FT   gene            628979..629836
FT                   /locus_tag="COB47_0540"
FT   CDS_pept        628979..629836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0540"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: ate:Athe_0589 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41858"
FT                   /db_xref="GOA:D9TIM6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM6"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADL41858.1"
FT                   /translation="MEKQGAALLSVFSNTALVLFKLIAGSIMGSVSVISEAIHSGIDLL
FT                   ASLVAYFSIKQARKPADSDHPFGHGKFENVSGAFEAILIFLAAAMIIYEAVKKFVKGAE
FT                   IEKIEAGLVVMLISGVVNLFISTKLFRVAKKTDSVALEADAMHLFTDVFTSFGVFLGLV
FT                   AIKLTHVYIIDPIIAIIVALMIIKASVDLTKKALCDLVDKSLPQNEIEIIENIIKRYSQ
FT                   VTSFHKLRTRKSGDRREIDVHIRMENSTTLIDAHNLCNQIEKDIKSVLPNSYITIHIEP
FT                   EDER"
FT   gene            complement(629743..630948)
FT                   /locus_tag="COB47_0541"
FT   CDS_pept        complement(629743..630948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0541"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ate:Athe_1984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41859"
FT                   /db_xref="GOA:D9TIM7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADL41859.1"
FT                   /translation="MNIIPYHELRKISPEKARELIRKVFEANNKNISKTAKILGVSRHT
FT                   VRRAVYGPVEDKSRKPKTCPKKLSSELENLIIQEAKKTGFRYRRLSLYLFRKYGVKISE
FT                   NTIKSILKRNSVPRKTRKTKKGERSLYDYESLIPFSEFQLDTKHLLDKESLPKEVYEHM
FT                   IKYNLPCYEWNMIDVATRTRFTAYSYELSSTFGFMFITLVVLWLRTHNVRNPIRIRLDN
FT                   GAEFCGGSEKKLKEWNEMLSFLGVELNPIPPKAKHLMGIIENSHRADDEYFLMIHAERC
FT                   ITKDEFMTRAQKWQDTWNFYRPHNGKGMNGRTPFEKFRDSKILVSSHVFQFPTLLLEDL
FT                   LKKVGTFYSLFCNKLGGKYVFTTCRVFVTLSYLSSSGSMWIVIYEFGRTDFISFSIWLQ
FT                   RL"
FT   gene            631329..631727
FT                   /locus_tag="COB47_0542"
FT   CDS_pept        631329..631727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0542"
FT                   /product="CrcB protein"
FT                   /note="KEGG: ate:Athe_0590 CrcB protein; TIGRFAM: CrcB
FT                   protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41860"
FT                   /db_xref="GOA:D9TIM8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM8"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADL41860.1"
FT                   /translation="MRNILAIAIGAFFGAVSRFFISQMSISHFPFATLFINVVGSFVLC
FT                   FVAEITVEHIKISAALRHMITTGFISSFTTFSTFVLEIVKFLMKREFTIAVIYPLLSIV
FT                   LGLLASIFGFELARAISERQQKEEYGVA"
FT   gene            631724..632080
FT                   /locus_tag="COB47_0543"
FT   CDS_pept        631724..632080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0543"
FT                   /product="CrcB protein"
FT                   /note="KEGG: ate:Athe_0591 CrcB protein; TIGRFAM: CrcB
FT                   protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41861"
FT                   /db_xref="GOA:D9TIM9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIM9"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADL41861.1"
FT                   /translation="MNYLIVGVGGVIGAILRYTIGKIFREVMDKDHPVSTLFINVIGSF
FT                   LIGYLSTKHLSGEYKLFLMTGLLGGFTTYSTFMLETSRYIKREKHMKAFIYVLVSIIFG
FT                   IVAAGVGIWLASFV"
FT   gene            632201..633466
FT                   /locus_tag="COB47_0544"
FT   CDS_pept        632201..633466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0544"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; KEGG:
FT                   ate:Athe_0592 histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41862"
FT                   /db_xref="GOA:D9TIN0"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN0"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ADL41862.1"
FT                   /translation="MKIQAPKGTKDVLPEESYMWQYVENKFREICKLYGYQEVRFPTFE
FT                   YTELFQRGVGETTDIVQKEMYTFLDKGGRSITLRPEGTASTARLFIEHGFASRPMPQRF
FT                   YYIISAFRYENTQGGRFREFHQFGIENFGSSSPVTDAEVISLAYNFFTSIGLDNITVNI
FT                   NSIGCPVCRKEYVKNLKEYFSANSQKLCATCHQRLDKNPMRILDCKEENCKLVAKDAPK
FT                   PIDYLCDDCKNHFEKVKTYLDSAMVAYKVDPFIVRGLDYYTKTVFEVVVTVSDKELAIC
FT                   GGGRYDNLIEQIGGPSIAGIGFAIGVERLLMLLEQNGLLPVKPQIPEVFVAVVGDNSIR
FT                   KAFEIANKLRFEGISTVIEEMSRSLKSQMKYADKLGCQFSIIIGDDEIAKGVCKIRNMR
FT                   TSSEEIVEIKNACHYLKKQVQK"
FT   gene            633514..635298
FT                   /locus_tag="COB47_0545"
FT   CDS_pept        633514..635298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0545"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="KEGG: csc:Csac_0677 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type; GAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41863"
FT                   /db_xref="GOA:D9TIN1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN1"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ADL41863.1"
FT                   /translation="MESIKDFKRTKYCGEVSLEDVGKEVVLTGWVDTRRDLGGIIFVDL
FT                   RDRTGIVQVVFDEKMGEELLDKADSLRSEYCIGIRGIVEKRPPETINPKIKTGEVEVRA
FT                   QELRIFSKSETPPFPIEEGINVNEAVRLKYRYLDLRRPDMQKNLMFRHKLYQVVRNFLS
FT                   QNGFIEIETPMLTKSTPEGARDYLVPSRIFPGKFFALPQSPQLFKQLLMVAGFDRYFQI
FT                   VKCFRDEDLRADRQPEFTQIDIEMSFVDVDDVIEINERLLQTIFGEMLGIDLKLPLPRL
FT                   TYKEAMERFGSDKPDTRFGMELVNLTDIAKNCEFKVFADAANKGGSVRAINAKGCAITF
FT                   SRREIDALVEYAKNFGAKGLAWIAVESDGLKSPIVKFLKEEEINEILKRLGAEVGDLLL
FT                   FSADKDEIVFDVLGNIRLEIARKLNLLDKSKFNLLWVTEFPLFEYSEEEGRYVAKHHPF
FT                   TSPMDEDIEFLETDPAKVRSKAYDIVLNGTEIGGGSIRIHSTELQKRMFKALGFTEERA
FT                   QDRFGFLLEAFKYGTPPHGGIAYGFDRLCMLLLGLDSIRDTIAFPKVKDSSCPLTDAPS
FT                   EVEPKQLRELHIKVDVVK"
FT   gene            635534..637240
FT                   /locus_tag="COB47_0546"
FT   CDS_pept        635534..637240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0546"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; S-layer
FT                   domain-containing protein; KEGG: ate:Athe_0594 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41864"
FT                   /db_xref="GOA:D9TIN2"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR005086"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN2"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADL41864.1"
FT                   /translation="MKRTILRFSKFLKIVILITFTLQIFTVFAKNTPYESRKYPHLLGN
FT                   QAVKKPSVAGRLRIIEKNGKKYLADKKGEIIQLRGMSTHGLQWYGDIVNRNAFAALSKD
FT                   WGCNVIRLAMYVGEGGYASNPGIKEKVVKGIKLAIENDMYVIVDWHVLNPGDPNAQIYK
FT                   RAKDFFKEIATSFPNDYHIIYELCNEPNPNEPGVENSLDGWKKVKAYAQSIIKMLRSLG
FT                   NQNIIIVGSPNWSQRPDFAIQDPIDDKNVMYSVHFYSGSHPVGGYVFENMKKAFENGVP
FT                   IFVSEWGTSLASGDGGPYLDEADKWLEYLNANYISWVNWSLSNKNETSAAFVPYVSGMH
FT                   YATSLDPGNDKKWDMKELSISGEYVRARIKGIAYNPIKRDKGIKCPFKDLNEDNIFYEQ
FT                   VVKLYSKGIIKGTLSSKYLPDKNITRAELAALCVRLLNLKIEKYDGRFSDVKSSDWYAD
FT                   VVYTAYKNGLFKQEEEKKFFPERITKREEVATLAIEVYKRLIGKLEVNVDDIQVVDEDL
FT                   IKPQYRECVKLAVYLGIIDLDSDGTFAPSKSVSRGEAATIFYNVLNLAGKL"
FT   sig_peptide     635534..635623
FT                   /locus_tag="COB47_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.967 at
FT                   residue 30"
FT   gene            637487..638428
FT                   /locus_tag="COB47_0547"
FT   CDS_pept        637487..638428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0547"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0595
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41865"
FT                   /db_xref="GOA:D9TIN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41865.1"
FT                   /translation="MANGQRTYRSGFLRELNKNFPLFLMALPGVLLLIAFSYLPLFGLI
FT                   IAFKDVHYDLGILKSPWVGLKNFEFLFKTPDAFIITRNTLLYNFAFIVFGNLAAIATAI
FT                   ALSEMRARFMAKFYQSVMFLPYFLSWVVVAYMAFAFLSIDLGILNTMILPKLGLQPIAW
FT                   YFETKPWPVILILANLWKYTGYNAVIYLAAITGIDPEYYEAALIDGASKWQQIRHITIP
FT                   LLSPLVVVLVLLGIGRIFYADFGLFYQLPMNSGALFDVTNVIDTYVYRTLMGMNDIGMA
FT                   SAASFYQSIMGFILVLTSNLIVRRLDPEKALF"
FT   gene            638480..639385
FT                   /locus_tag="COB47_0548"
FT   CDS_pept        638480..639385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0548"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0596
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41866"
FT                   /db_xref="GOA:D9TIN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41866.1"
FT                   /translation="MHTKSRFLQISMFSEVILHIFFGIVTLACLVPLWAVIAISLSDDN
FT                   KIRQSGYRLWPVGLSTKSYEFVVSQGKAIWHAYGITIFVTLVGTVLCVLVVSMYAYILF
FT                   RKDFKYRKFFTFLGFFTMLINAGLVPWYIVCVNVLHLKDTIYALILPYVMNMWYVLIFR
FT                   TYLSMSLPDSIIESAKIDGAGEFTTFFRIVIPLVKPGLATIALFAAITYWNDWWLPFML
FT                   VETEKLYNLQYMMYRVQQKIQYLAEIAAKLGASGIVPTDLPTESARMAMAVLGMGPIVL
FT                   AYPFFQRYFVQGLTIGAIKG"
FT   gene            639487..640989
FT                   /locus_tag="COB47_0549"
FT   CDS_pept        639487..640989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0549"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_0597 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41867"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41867.1"
FT                   /translation="MKLKKFFVMMLVVAFVLTSVVGVVTGLGASSSKLPYVKLTWYVIG
FT                   TPQKDWDLINQKVNEYIKPKLNAEIKMTMFDWGEYNDKLQTKIAAGEPFDICFTAIWTN
FT                   NYRTNVAKGAFLPLNKPGNDLLSKYAPKTKKLLGDDFIKGASINGILYAIPANKEKAHN
FT                   WGFIVRMDLVKKYKLDDMFKKVKKLEDLEPYLKIIKQKEPGVYPLGAYAGESPRFLLDW
FT                   DKVVDDDVPVSLYPNNKSTKIVNELEQPNTKALFKTVRKYYLAGYIRKDAASVTDWMSD
FT                   LKAGKVFVMPQSLKPGKDAEMSISTGYQWKQIDITPPVMSTRECIGSMQAINAKSKNPE
FT                   RALMFLELFNTDKYLNNLVNFGIEGQHYVFKDKAKGIIAPGPKAKDYSPGLGWMFGNQF
FT                   INYIYENEDPNKWKNFEEYNKKALPLLSLGFNFDDSKVKTQVAACKNVWKQYIPMLETG
FT                   SVDPDRYIPAAIDKFKRAGVDIIINEAQKQYDEFLKKTGRKK"
FT   sig_peptide     639487..639555
FT                   /locus_tag="COB47_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.224 at
FT                   residue 23"
FT   gene            641151..642491
FT                   /locus_tag="COB47_0550"
FT   CDS_pept        641151..642491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0550"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_0598 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41868"
FT                   /db_xref="GOA:D9TIN6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41868.1"
FT                   /translation="MKDSFNKRHILSIGFLVPLISTLALIIILILNTQKTVEESVTIEN
FT                   EEFEVSKKIRFLSSWGGNDPYADTLSFVLQKFQEENAGITIINESLFGDDFLIKLQTDF
FT                   ASGNPPDVFGLFPGSVRDILIQRYQIADLTDVLKKDVKWYQSFYPNMWRYVTFNGRIYG
FT                   VPLETIVECLFVNKDIFERYSLKVPQTFDELINVSKILKSKGIIPIAFNAQPEGTYIYQ
FT                   NIIVSIGTKHDVENPLKSGKFSSPYVKALDYLKILYKAGAFPDNYYSLTSKQRNDLFLT
FT                   KKAAMIVQGSWFIPKCDPKTVDIYFFPQISNTGKKHLIYGLGGGTFYISSQAWQDETKR
FT                   SWAIKLLKFLTSEKIARIFVERTGLISNIKIINPPNVNNPLRSKAEGFIKEADVLVAPP
FT                   DHFVDRMVWEEVITKNIPYYLQGTISSKLFWEKAIKAWEENMEKLGE"
FT   gene            642488..644359
FT                   /locus_tag="COB47_0551"
FT   CDS_pept        642488..644359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0551"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ate:Athe_0599 putative sensor with HAMP
FT                   domain; PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41869"
FT                   /db_xref="GOA:D9TIN7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN7"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL41869.1"
FT                   /translation="MRMFKIKMIFRNLIKYYRTISIDKKFLAVSYIQIFIPIILIGVLS
FT                   FRISSDLIFKKYVGYTSDVIKTARLRIVDKINELNSITQDILYQTELYNVLDKSMKNVD
FT                   YYDEVASLTNKFRKIILGHLDVQSIGVFTKEKKLCIVDNTSKKVGLDEIIPSQISFEKV
FT                   YDIAAKGNGKPVWYVASLKKDKESKVVILVFRSINNPQTLKFEGILAVMINTELFDKTF
FT                   SELVAEKSQAIAVVGDDIFISTKGEMNEKKILKFMSGVKNENGVVTYTSNEYIVNVLPI
FT                   KQVNWYIVTSIPVKILFEDIDKLRMWLIILCFLSFVITSAMSLMLSMDFLKPINAIVEA
FT                   TKRIRKGEYKTIENLDRKDELGILIDNFNNMVIKINHLINSIYKEQITRKEAELKVLQT
FT                   QLNPHFLFNILESINWLAQLNGVSQISDVVIALSKLLEVNLKEEKFLTLEEEIKYITSY
FT                   VSILKINFGEENLKLEVDVDRKALKLRIPKLLIQPLVENSIFHGIRPKGFGKIFLGGYI
FT                   WNDKLTIIVKDDGVGITPEKLKGIRQDLEEDNEVFLEQEGRSYTRIGLLNVVKRLKLIY
FT                   GKDASFSIESLPQRGTTIKIEIFMDALSKAVEESLQEFSDEGEEEDV"
FT   gene            644352..645989
FT                   /locus_tag="COB47_0552"
FT   CDS_pept        644352..645989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0552"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_0600 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41870"
FT                   /db_xref="GOA:D9TIN8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41870.1"
FT                   /translation="MYKIVIVDDDMLIRKGIRNVIRWKDLECEICAEASSGDEALKVIE
FT                   EVKPDIIITDIKMPNMDGIELIDKIKNIIPRCKIVILTAYREFEYAQKAIKSGAFDFLL
FT                   KPTKVEDIINVVQKAINEIKKEKTIVEELEKINSILKEKLPILRENFLFNVIFEMISNE
FT                   DEVLQMASFYEIEIGSFLMILAECSTKEKGKHNTHLYLLGISNMLNDFFGQDFTIYTIY
FT                   LNNSQAVYIVSSKRELEKSEERKFFELLSQLKRAAVGCFNIDLTLAVSTWGRGIIQLPD
FT                   KYKECIDAINYKFYFNEEDIIYYKDLSHFFMYVDDKRLKNLKNEILMSVRYGNYSNVNN
FT                   LLIELEETLKKSKADKQYIFNFYYLLLIEIDMIKAQLSSTINKHDNQEMFESIDYFNEI
FT                   IKCKSLSELSNILRVSIQRTIEEIQKHNLNKMGSLIKKVVDYIKENYHSGEISLSDISE
FT                   KFFVSPSYLSRLFKKETGKNLSDFINEYRIEKAKQLLITTDLKTYEVADRVGIPDPHYF
FT                   SRLFKRYTGYSPSEYKEGAKQKGEKVSE"
FT   gene            646425..647741
FT                   /locus_tag="COB47_0553"
FT   CDS_pept        646425..647741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0553"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="TIGRFAM: xylose isomerase; KEGG: ate:Athe_0603
FT                   xylose isomerase; PFAM: Xylose isomerase domain-containing
FT                   protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41871"
FT                   /db_xref="GOA:D9TIN9"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIN9"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ADL41871.1"
FT                   /translation="MKYFKDIPEVKYEGPKSDNPFAFKYYNPDEIIDGKPLKDHLRFAV
FT                   AYWHTFCATGSDPFGQPTITRPWDRFSNPMDNAKARVEAAFEFFEKLNVPFFCFHDRDI
FT                   APEGENLRETNKNLDEIVSMIKEYLNTSKTKVLWGTANLFSHPRYVHGAATSCNADVFA
FT                   YAAAQVKKALEVTKELGGENYVFWGGREGYETLLNTDMELELDNLARFLRMAVDYAKEI
FT                   GFDGQFLIEPKPKEPTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHE
FT                   LRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEVIKMGGFDKGGLNFDAK
FT                   VRRSSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVS
FT                   GQADFKTLEEYALNLSQIENKSGKQELLEMILNKYMFSQ"
FT   gene            complement(647786..648493)
FT                   /locus_tag="COB47_0554"
FT   CDS_pept        complement(647786..648493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41872"
FT                   /db_xref="GOA:D9TIP0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0604"
FT                   /protein_id="ADL41872.1"
FT                   /translation="MKRLLSSSYILMFDEYYSFQPRLKEMCTCIDLKSLSSTKYMCSKK
FT                   VLDSISEKIKKVENSLFFLGAGEYHHFTYMLLKKINKTFSLIVIDKHVDYSNSYPGFIT
FT                   CGSWLKDAAGLNQIAEIFVLSEDKKNVSSSKIKILSPLDYKKIKPNLPVYISIDKDILT
FT                   KSSINTTWDQGHCKPKTLIEIVSHFSSAFEIVGADICGEPPAQYFSPEHKKSEDINLKL
FT                   LLLLTEKSQSIVA"
FT   gene            648640..648816
FT                   /locus_tag="COB47_0555"
FT   CDS_pept        648640..648816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41873"
FT                   /db_xref="GOA:D9TIP1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0605"
FT                   /protein_id="ADL41873.1"
FT                   /translation="MSAKDMVLEALKSSPEPMKIQDIVQKTGLDKKEVEKAIKELKSEG
FT                   LIESPKRCFYKAK"
FT   gene            648994..650556
FT                   /locus_tag="COB47_0556"
FT   CDS_pept        648994..650556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0556"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: pjd:Pjdr2_0905 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41874"
FT                   /db_xref="GOA:D9TIP2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL41874.1"
FT                   /translation="MFKLLIVEDEKITRESLETLIPWNELGIGEIKSAKNGQEALETVK
FT                   NYIPDILLCDVRMPRMDGIEFSKRLKNIFPKCKIVFISGYAEKEYLLSAIRLNAIDYIE
FT                   KPLDIEKIKSTMKKVVEIIEFERKEEEEKERLKEHYNESIYYAATQLVQQLLKDHTDYS
FT                   VFQKYAAEDFLTSTLDVIVGFVDWKAEEDHLDEMVSKEIYNQVLGQDLTSRIAVLFSFL
FT                   SQNSFVLICSEKSEIDINKAANILKEVFLQKGEICLMVATSIKASQVKESIENMLKILK
FT                   KNVFYNGFGNSYTYEGFVDKREQEISFDFEKFEEYLKRDDIKRAKEEIEKLYFWLKSNQ
FT                   GIEIEKVKNIFFEMLLIAYQIGRQRKITQFLDEAGRAKKWSEIEQKLTLNQLKEVIYET
FT                   LDGIFELFTTRGNLNRKVYQIIRFIEENFYDKHLSVQKIANHFYFSPNYLCSMFKKATG
FT                   KTINDYITEVRIEKAKQLLKDNSIKLYEIAEKVGFGDPNYFSALFKKKVGMTPSEFRER
FT                   YYV"
FT   gene            650553..652337
FT                   /locus_tag="COB47_0557"
FT   CDS_pept        650553..652337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0557"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; KEGG: pjd:Pjdr2_0906 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41875"
FT                   /db_xref="GOA:D9TIP3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP3"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL41875.1"
FT                   /translation="MKRVANIFSNMSIKYKLFASYMFVILISFGIFSFMNYVIVGRDVE
FT                   KQAIYSSGKIVDQTASFLENRVSSVKNVLNILALDSTVQELVNRPDDYYYENIGNWLVD
FT                   SQRFTKLFYSTCQNFDILSISIYMTQGLARLSETDSYFLFERIEKLPWYQQMVLKGELF
FT                   AWVTPKMLNVARKDVVSLIRLIPDPKNISEYKAALRADISIAEIERILNQALFTSRTLA
FT                   FIVNSNGEVVARSLNKTNLSLGEIIKGIEKNISSQEANVVEMEVGGEKLLVRTRNISDT
FT                   DWYLVLVTPYKEIHELNIKTIKQVFFMIFLIAPFTLIFAFWAATSSTSRIKRLTHNMKK
FT                   VIEKGDFNIELDTHSQDEVGQLIYTFNYMLKKIKELLHEQYQLGKEKKNLELKALQSQI
FT                   NPHFLYNTLDLINWIAIKNKNEDISRLVTSLSQFYKLSLSKGEDVVTVENEIEHVKAYV
FT                   MIQNYRFDNCIDLKIDVPQKLLQARIPKLTLQPLVENSIHHGILEKEDQKGTIIIKGEI
FT                   IDGKMAAIYVIDDGVGICEEVLEKIKKGEVETTRGHGFGIKNINERLKIYFGNEAGLFY
FT                   ESKINEKTVAKVLFPVEE"
FT   gene            652521..653477
FT                   /locus_tag="COB47_0558"
FT   CDS_pept        652521..653477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0558"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pjd:Pjdr2_0908
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41876"
FT                   /db_xref="GOA:D9TIP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41876.1"
FT                   /translation="MICSITTKGVAELKKNGFWYEIKKNKILYAMFLPVAIYYILFAYI
FT                   PMGGIVLAFKEFNYRDGILFSPWNGFKNFEYFFASGRAWLVTKNTILYNLAFLAAYTVF
FT                   SVACSIFIAELAGKIFKKFIQSVMFLPYFVSWVVVAAMMYNFFNYDYGLINTLIKNLGG
FT                   EPIDIYSNPTYWYFLLPMLYVWKWVGYGSVLYLAAIMGFDEECYEAAIIDGANIFQRIF
FT                   YITIPMLKPTMIILILLALGRILRGEFDMFYQIIGNNGLLLDYTDIIDTLVFRSLMQVQ
FT                   DIGMASAAGAYQSVLCFVIIMLVNWLVRRYDKDYALF"
FT   gene            653504..654382
FT                   /locus_tag="COB47_0559"
FT   CDS_pept        653504..654382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0559"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pjd:Pjdr2_0909
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41877"
FT                   /db_xref="GOA:D9TIP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41877.1"
FT                   /translation="MRKGKDYILFNIIGYIFITIIGLFTFIPFVVLVVSSFASENYIIN
FT                   HGYTLIPKEFSLSAYKLIFQNPQRIFRAYLVTIVVTSVGTSLSLFLSTMAAYVMYRKDV
FT                   KYRNALAFFLYFTTLFNGGLAPYYIILANYYHLKNNVLVLILVPLFNVFYILILRNFIR
FT                   GSIPDSLIESAKIDGAGDFTIFLKIILPLSKPALASIGLFIALNYWNDWWTPMMFIEKQ
FT                   TLYPLQYTLYLILSSVNVAANILQNVVRIDMPKETLKLAMTVVATGPIIFLYPFVQRYF
FT                   VRGITLGAVKG"
FT   gene            654457..656037
FT                   /locus_tag="COB47_0560"
FT   CDS_pept        654457..656037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0560"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="KEGG: pjd:Pjdr2_0910 extracellular solute-binding
FT                   protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41878"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP6"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_0910"
FT                   /protein_id="ADL41878.1"
FT                   /translation="MKKNFRLLALILTVCFVFSTILVSMFVVGFGAQSKRTAPGFDPSI
FT                   DVSKPVKIVGYLLGDAPAEFPNVMKELNKKLQKDINATMEINYIGWGDLNYKYPLILAS
FT                   GENVDWMYAANWCFYFQEAAKGGFKELTMDMIKKYMPRHYKATPSVAWQEAKVKGKIYM
FT                   IPTATPDRKADVVIIRGDLREKYKVPPIKKYNDIEPFLAAIKKNEKSMMPMNLDNQYDL
FT                   NSVMWRLLVEKTDYLEDVARVSTGGTGLFTTIYDTKPKVYYIMDKEILPAFKDAAKKVK
FT                   SWYDKGYINRNAYANKVRSKDAFDQGKSAVAFGNSQDIQSNLANAKTKGWKVEIIPIFD
FT                   KRGHRPADPYINNGVALVAKTKNAERTLMALDLIMEEKSYNYLVYFGIQGKNYIIKDNK
FT                   IDLPKGVTADNNTYPPDAAGFWFTNKDQFLPLASWDDNYIALRNTIKKALVSSLLSSFS
FT                   LDQTKVKTEIANLNSVMTQYYNPICLGMVKNVDEAFATLDKKLKAAGVEKVKAEALRQL
FT                   EQYFRERNQ"
FT   sig_peptide     654457..654546
FT                   /locus_tag="COB47_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.353 at
FT                   residue 30"
FT   gene            656248..659502
FT                   /locus_tag="COB47_0561"
FT   CDS_pept        656248..659502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0561"
FT                   /product="Arabinogalactan endo-1,4-beta-galactosidase"
FT                   /EC_number="3.2.1.89"
FT                   /note="KEGG: ate:Athe_0607 Ig domain protein; PFAM:
FT                   glycosyl hydrolase 53 domain protein; coagulation factor
FT                   5/8 type domain protein; Ig domain protein;
FT                   Carbohydrate-binding CenC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41879"
FT                   /db_xref="GOA:D9TIP7"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP7"
FT                   /inference="protein motif:PRIAM:3.2.1.89"
FT                   /protein_id="ADL41879.1"
FT                   /translation="MKRVFAIFILLIFVISFAFPLLSTKVFAQNSAQVKKQIGIKVDPI
FT                   GPNIAVGKNIFSDSEATTNPATLANDGDETTFWSAQDAGIHWLKIDLGDVYANLFATEI
FT                   VFNGNGSYQYKIEYSIDDNRWTVLVDKSNNIDTSQTQYDKFIPPASGIRYIRVTITSTP
FT                   NNQPASIKEFKVYKMVDDTFIKGADVSMLKQIEDCGGKFYLNGVQMDALEILKYFGVNW
FT                   IRLRIWNHPYYTEDKSQPMGGGNCDAENMLVIAKRAKGLGMKLLLDFHYSDFWADPGKQ
FT                   DKPRAWANLSFDQLKQAVYQYTYDVIKMYKDQGALPDMVQVGNEVNGGMLWPDGKTWGE
FT                   DAGGYDNFAELLKAGIRGVRDAAGPDNQVKIMIHLANGGDNELYRRVFDNLTQRGVEFD
FT                   VIGLSYYPYWHGKLSDLIYNMNDISKRYNKEVVIAETAYAYTLENGDGLNNIFGTREAA
FT                   TAGYEPSVQNQALVIRNIANAVAQVPGGKGLGIFYWEPDWIPVEGAGWKTGEGNGWDNQ
FT                   AMFDFNGNALDSLYVFKMLNNIMIVDYKPVVVGTAPGEMPKLPVKITAVLSNGLTKEVD
FT                   VTWDSIDPSEYAQTGSFEVCGHVEGSEVTPVAKVKVANLIQNSGFEDDLNGWNVEGQTG
FT                   AANANSSAPVRSGNKKLNIWYGSPYNLVISQTITGLGQGKYTFKAWFVNTGSAQKRDIV
FT                   IKDYGGQEIKIQIPQSAAWDAWTPAEINDINVTTGKCTISFEIAADSGFWCAIDDVLFY
FT                   RQDPDIEKNIVSVQRLDITTEVGQKPQLPPTVMVVYDDDTSSEANVTWEAIDESKYSAI
FT                   GEFTVTGVVEGTTLKAYAKVKVINSKNLVKNYSFEEGLKYWISEGNTNAVKTESGGHSG
FT                   GTQLTHWSDKPYKAVTYQTIENIPNGIYIFRAFANGGGGQNANYLFVKDYGGEELRINM
FT                   PTKWVAEWHKMVIANIKVTTGRVTIGLYSDSENAGGTWCNLDDVEFFKVADREFEISNA
FT                   SLQKDKGLIASVTVKQSEGIQHDGKEVVVFELLKGTTPISIVAVEKDIVGVEDFKAYFN
FT                   VNDYLSTDYRVKVFVFDKFDTSLTTPNSLAEPIELR"
FT   gene            659595..661238
FT                   /locus_tag="COB47_0562"
FT   CDS_pept        659595..661238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0562"
FT                   /product="S-layer domain-containing protein"
FT                   /note="KEGG: ate:Athe_0608 S-layer domain protein; manually
FT                   curated; PFAM: S-layer domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41880"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP8"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADL41880.1"
FT                   /translation="MKKGTRIASGILLVFVFLFSLLSVGFSAQEVILNSIPDKSPGEDV
FT                   VISGQTVFDEIVVKVLRPNSTMLYINTVKGKNFSDKFTLPADSPEGTYTVVAGKGSVVD
FT                   IKTFNVVKKQSSLPSSSSEVLIPNIKEAEKQVGAQSSQKEDIKQTDKTALPEITIDNSG
FT                   IIRPKISQLSEERLDVKLDESSVTKALQMQVSKKKILTLDLKISKPLVQYNIALPSRVF
FT                   TASFDIQEVLVNTDELSLKLPADLLKEKNIDNNKQIEILIKKVENSNIPSEIRTAVGKR
FT                   PIYEIGFYQDLKKLNVERPTNSIKISIAYTPGVEELSGIENLVMLHINDDGKAEVVSNS
FT                   KYVANSKRMVANVNSFSKFAVGYISKKFDDLKNYSWAEKAVSSLATRNIISGADQNSFR
FT                   PQEYIKRGEFVKWLVNALGLDAQYSSNFEDVKKDSIYWREVAIAKALGIAKGYANKFKP
FT                   EDYITREDMMVLVVRALEVANKPMVKTKSSLATKFYDSSDISSYAQDSISVLVANDLIK
FT                   GNSKNQILPRKFATRAEAAQLLFRIFFKWE"
FT   sig_peptide     659595..659672
FT                   /locus_tag="COB47_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.860) with cleavage site probability 0.511 at
FT                   residue 26"
FT   gene            661493..664903
FT                   /locus_tag="COB47_0563"
FT   CDS_pept        661493..664903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0563"
FT                   /product="pullulanase, type I"
FT                   /note="TIGRFAM: pullulanase, type I; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; glycoside hydrolase starch-binding; KEGG:
FT                   ate:Athe_0609 pullulanase, type I; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41881"
FT                   /db_xref="GOA:D9TIP9"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011840"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIP9"
FT                   /inference="protein motif:TFAM:TIGR02104"
FT                   /protein_id="ADL41881.1"
FT                   /translation="MVKKFESKRFISLLMVALFIATLIFPISILGAGEKTTLIIHYYRY
FT                   NEDYQGWNLWIWPVEPVGAEGKAYEFTSKDDFGVKAVVELPGKVTKVGIIVRKGNWEAK
FT                   DVAVDRFISGISGSKEVWLIEGEEQIYTSQPQKTPKMTAFVDGLNTIVVKLAKKADILS
FT                   NNKTQGFKVTAFYDEVPIKNVEPVLPKINKNFKPEEAGYELIDGGTKVRFILKPGAGDF
FT                   KFTDTSGKLEVYVSGTMNDWGGTASSEGKYKPLPAWKMTWNAQKGYYELVKELGKDGVV
FT                   IGAKFKFTSWDGTSAKWYPDGMGNDKVIEELYTGNEKITKVDTFRITTVDELEPQVPYL
FT                   ISKEGFKPTIAQPRNILDNPKYYYKGNDLGCTYTKAYSAFRLWAPTAIGVVMRLYDDYK
FT                   TTKYKEYEMEQSVNGTWYLKINGDLKGKYYQYEVWHASNSITDDTIRKYVVPDPYSRAT
FT                   SANSERTLIFDPKDTNPVGWEKDTFVTLKNQEDAIIYETHVRDFTIDDSSGIRPEYRGK
FT                   YLGFTQTGTKGPNSVKTGIDHLKELGITHVHLLPTYDFGSVDETNPNKTYNWGYDPVLY
FT                   QNVEGSYATNPNTIARIKEYKQMVMALHKAGIGVIQDVVFNHTFQIGDAKFSIFDKVVP
FT                   GYFYRKDKDGNYSNASGCGNEIATEKPMVRKFIIDTLTYLTKEYHIDGFRFDLMAAIDR
FT                   VTMAKVQEEVRKINPSAVIYGEGWLAGATPLDSSLRMEIGSFNQAGLHIGFFNDRIREA
FT                   IRGNLDNESKGFMQGNYSYRLDDLKRGIQGGLGDFATDPDECINYVSAHDNLTLWDKLQ
FT                   KSVPNEPDYIKDKMGRLANAIVLTAQGVPFLHGGVEFNRTKFMNSNSYNAGDRINKYDW
FT                   NLKVKWYNTFKYYQGLIALRKAHPAFRMTTAEDIQKYLTFIPTPKGTLGFRLTYPKDTW
FT                   NDIIVVYNSTKKVQEITLPVGNWVVVANGDEVGTTPIKKLTNYVAGKALVAPISMFVAY
FT                   KSDEFPQGFVKVVSKDPVSLETATTILTPKVYGTGNVAVTFNVKVPAGTDDDVIYLAGS
FT                   FGKAGLSDWNPGDKDGAIELVKTQDGTYTVTLRLNSGDTFEYKYTRGSWSTVEKGANKE
FT                   EIENRKFTVKDDGSGKMTINDIVLNWADK"
FT   gene            665000..668293
FT                   /locus_tag="COB47_0564"
FT   CDS_pept        665000..668293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0564"
FT                   /product="glycoside hydrolase starch-binding"
FT                   /note="PFAM: glycoside hydrolase starch-binding; S-layer
FT                   domain-containing protein; KEGG: ate:Athe_0610 glycoside
FT                   hydrolase starch-binding"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41882"
FT                   /db_xref="GOA:D9TIQ0"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ0"
FT                   /inference="protein motif:PFAM:PF00686"
FT                   /protein_id="ADL41882.1"
FT                   /translation="MKKNLERFLALLVSFAFVFSLVLNILPQQARAADTIKIVGNWPDA
FT                   GNWNFDASTIVLNETSTPGLYYGEYTFLNAGNYEFKVAENGVNWFATATTVGYSGENIK
FT                   YTAQVNDVIKFWYFKNSHLLLLSPDFPNGPSDIGVTHSLKMFGVNDDWNDANDNYILQS
FT                   VNGATYTYVFDATNQDLSLPWGFKVAFNKMNGNWWKWSATGDNGKITFRDNGGDNINIS
FT                   ELKDNGNLLKTKYYVDLINGWLFTEKDLTNIQPRDFANNSSVIGGSSIHLAWDPYTPNA
FT                   NPLSAKLYYKIVDVSNNSELVSLTDYSTSNRIDIPREWIGKTIKIVANTQIGEITGPNV
FT                   EFTLNVVDLPQDQIVAAANYITYNCIDETFLKLAEGDSFQSITSNFSVVTSYVYEVAYE
FT                   GNNYPLTFAIDWESNNSDILAINGTTVTVTRPTLGDLQVDLKAKARFGSVVADGQKTFT
FT                   LTVKKFLLGVDGGVPVTFNVTVPDYTPAGDNLYIAGDFKTNKLPYWDPAGIKLMKTGDK
FT                   TYSITLYLPQGAVIEYKYTRGNWSKVEKNAYGQEIPNRVLIVTGPSMTKSDVIEAFADL
FT                   GPTKQGGLPSINLVINLPQQTVIDTGDGGKVIKAEGGAISVANSKNAVLIDSRSVLNAI
FT                   IKGENYSIAVKSSQQVYPVVNIEREAVETLKEKGVKRIEIKYPDTSVFVDIYKSVTSDI
FT                   QVQAFQSSKEENKTAESLLLKNVDDYTTVKVIGMKEFKIIRGEELDTSSNTIYVFKFNS
FT                   PVEEGVVPCIINNDNITPVKDYYTEDSYLVVKAKGSQKIAFAKVEKKFDDSDSLSHEVA
FT                   TLVSLGLVTGDNTNRINLDRHISRAELAALIGKAFDLYQRYYRNYFADVSKYEWYAPYA
FT                   EALKEKGILDGYNNKFNPKGLVTREQLAKIAVNIAEQYISKEQQPKTIADFDKISLWAK
FT                   EYVQKALAYEIMSVDDQGNFRPQDYATREEVFNTIYNLIVVKNKNLKDYITADLKPYGV
FT                   EVTFKVKVPQNTPDDNIHIAGTFSAVGYSDWNPSDNNLKLSKNADGTYSITMYIPEGTT
FT                   IEYKYVRGEWSKVEKGPNGEELSNRSVTIKKGADNKMFIEDTVSKWADK"
FT   gene            668425..670380
FT                   /locus_tag="COB47_0565"
FT   CDS_pept        668425..670380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbb:CLD_1769 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41883"
FT                   /db_xref="GOA:D9TIQ1"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ1"
FT                   /inference="similar to AA sequence:KEGG:CLD_1769"
FT                   /protein_id="ADL41883.1"
FT                   /translation="MKFFKSISKRLKEYMKNKLNFAKVISFLLIVLFACLIVFSTYSVA
FT                   KNIAVSAELKSAKNIVASVNKYLEYKLNLVEVQADSFASNPQVVKLVTQYDSLDDYEKY
FT                   AIDNAIQQYLNAISDTAKVISFILYIPKHPNITPQLRGQSPYNVNYIGQNRNLISQLKE
FT                   EGWGNLPSDLEIKFGADKDTVNQSICYFKWIGDKNKKEGIVIFGVSFELLNELLDEAYG
FT                   SSADKFLLVSNQKVVYSKTKMSLNAVKHIGLDEFIVKDKKLIYRYRVANFPLDIYVVKQ
FT                   VEFKGLTYIPFIIFLFIALLAWRILSMIMKNIKKELTAIETYMNTLQPTNEIKLLNEFY
FT                   NSAQELIETKEEISRMNVDITKKFSVYLENALKSVNIMIEEIHGIEDNLESINGIWYKM
FT                   KELFLSISDNINKIMVTEDKFSKRFIEDNQKIQEEAQKLRDIISDYKHKIKDIINKKKV
FT                   ALTKIDQISTQLEKLKELENFNRQSINSVEQLDIISLNSIIKTAKEESNRTLNMISQQL
FT                   IYQTKLLKSDLVNITKIIQNIIKSTPSISKYNNIMNNMDLYTSYDMHFDEIKRVLHEMS
FT                   ENVIEVNDKTKQQKDVLRKMIDNYNIAFDEITNMKDYFYELTSSLRAYRTSVDSLKNQL
FT                   QEIVEIITKLKKHWSE"
FT   sig_peptide     668425..668562
FT                   /locus_tag="COB47_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 46"
FT   gene            670383..672287
FT                   /locus_tag="COB47_0566"
FT   CDS_pept        670383..672287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0566"
FT                   /product="histidine kinase HAMP region domain protein"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: nam:NAMH_1064 mcp-signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41884"
FT                   /db_xref="GOA:D9TIQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ2"
FT                   /inference="protein motif:PFAM:PF00672"
FT                   /protein_id="ADL41884.1"
FT                   /translation="MVGTSRLLRRQVSGFLFFLYTILLIVSILTNYAVPKRTLEKELKK
FT                   SFEGDAKAISEQFESYFKFVNDMLLSFSLNREVSRILTLSQEDAKSKDNIASYEIILSS
FT                   LKDAAQRLGGDLYLHVKDTYLFANLKGEIGNAKFEELAMLEKVASIEADIPLTVYSDKD
FT                   KLVFEMPVLNFMTFNKIGEIYLVVNKASILQNVLKTYEHYQFVVKTKDGEVLISKGKAG
FT                   REQFVYSQNVVGGNFNLSVGGAKDYIFRQISFVRWLFLILTFISMIFIIVLSLFISNVV
FT                   VNPLKGLEQLFKKIKEKDLSVEKKISQINDEIDKIYNSFFRILQSLKKPIMYFNEIINN
FT                   PNISKSKFENVIQQSEDINKEINEKSIKFLNSLERQRDCLKVLSESMDMYMHNLEDIKV
FT                   YLLNQGNRLKTLDSLCSSFKLEVRKVENYTDEIEEILSHYSSIVSDLSNKIKELIKLSD
FT                   NSGRLARGLKMVQISVKIELMNNKIANFIDVSALEKLISGIEQLITRFYDVLKNIDDTN
FT                   QDVIREIWNLHSDLKRDEDLQEQFLSVLNKMESNILGVYQKINDVTNEIDILKSKIQEV
FT                   NNEIAIDIAKLNNTKNNVQQVLTDCFSIKENIEHMMNEIAKVEQLAKEIKKYASAYKL"
FT   gene            complement(672336..673040)
FT                   /locus_tag="COB47_0567"
FT   CDS_pept        complement(672336..673040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0567"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: ate:Athe_0612 HhH-GPD family protein; PFAM:
FT                   HhH-GPD family protein; SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41885"
FT                   /db_xref="GOA:D9TIQ3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ3"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADL41885.1"
FT                   /translation="MKQEDIKKLALPTDISQFLYNIYNKLYEFWGPQNWWPAETKFEMV
FT                   IGAILAQNISWNSAEKAICNLKRANILSVEGILQTPDEKLAELIKPAGYYNQKAKRLKE
FT                   FCNFLKREFNSDLEKLFALDILSLRKILLSQKGIGFETADSIILYGAEKPIFVVDSYTK
FT                   RLFYRLGLIESEKISYSDLQAIIMAKLTPQTKFFNEFHALIVKHCKEICKSKKPICNKC
FT                   CLRLICNYFDEN"
FT   gene            complement(673050..673742)
FT                   /locus_tag="COB47_0568"
FT   CDS_pept        complement(673050..673742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41886"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0613"
FT                   /protein_id="ADL41886.1"
FT                   /translation="MNKSIVKIFTILAFLLVPMYIITAIVNNVKLKDEVQTSSNRQYYI
FT                   TAPKTSDKNTQLPAAVYSKMYENPQQTENVTISDAVYTQKVSDSIYIVSSKNSDGKTTQ
FT                   KIYYKNKVSKSEMKYYNPVITFIKSQILMSSVFEKGIYDVYIEKIDLKSKYINAAVMYY
FT                   PLEKIDSSKNSLIEGNMIVITIFVDRNKKPEEYSLLSVIKDHSPNDFFNVFLKSVYKFT
FT                   VIKKGEED"
FT   gene            674035..675342
FT                   /locus_tag="COB47_0569"
FT   CDS_pept        674035..675342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0569"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_0614 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41887"
FT                   /db_xref="GOA:D9TIQ5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL41887.1"
FT                   /translation="MKRLVKIIAWVTAVVFMLSLVLVFYPSEKAFSSAGSTKKIVFWHI
FT                   TTDDNGKKMIQGQVDRFVKAHPDFKVEVVPLQNDSFKTKLKIAMGSNQAPDVFVTWGGG
FT                   PFFEYVRAGKVKDITAYMNENNYKSRFVEAAFGPITYNNKIWAVPVEGAGVALVWYNKE
FT                   IFKKYNLKVPTTYDEFLNIVKTLKAKGIIPITLANKTKWPGCFWYWNFVNKLGGASAFE
FT                   KAAERTGGSFADQPFIKAGEMLQELVKIGAFPKGFNGLDWDTGQSRMLLYSGKAAMELM
FT                   GTWQIPIVKAENKKFYDNNLDFFPFPSIKGGKGDPTSLVGMASSNYYAVTTTCKYPKEA
FT                   FNMIQYLIDDQAVKERINYGQIPPVKGLKFSDPMLQKVYNIVAKAKSIQLWWDQYLPPQ
FT                   LAETHKDIVQSLFGLTLTPKAAAEKMEKAAKDYFKK"
FT   gene            675454..676344
FT                   /locus_tag="COB47_0570"
FT   CDS_pept        675454..676344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0570"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0615
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41888"
FT                   /db_xref="GOA:D9TIQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41888.1"
FT                   /translation="MQRDRTSKLAQNIGIFLFLAPALILIGIYIIWPIIMSFNLSMFEW
FT                   DGVSPQKIYIGLKNWKDLLHDSIFWHALGNNIKFIFLSIIIEMPIAILIAVLLDRGGKK
FT                   FDLFKSLFYLPMLMSSVAIGVLFKYIYDPSFGLLSGILSFLHLDFLNQDWLGDPNVAFY
FT                   SVVAVICWQYIPFYMIFFIAALSNIPHELYEAAKIDGATQGQYFWKIELPLLSPSIKTA
FT                   CILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAFASFKMGYGSTIASAMFIIIT
FT                   TAGVLAYFATKKNEG"
FT   gene            676384..677211
FT                   /locus_tag="COB47_0571"
FT   CDS_pept        676384..677211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0571"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0616
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41889"
FT                   /db_xref="GOA:D9TIQ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL41889.1"
FT                   /translation="MGSIKETKKWYFIFLAIWTLIADIPFLFMFFTSIKTQTELLMGNT
FT                   WQVPKQPTIGNYSTVIQGSFFTYLKNSVIAVSISVILILIVSSMAAYVFARMKFALNNL
FT                   LYSIIIAGMAIPIHVTLIPIYVLTNKIKLYDTIFALIGPYVALSLPMSIFILTEFMREI
FT                   PIELEEAAKIDGCSMFRLYSDILLPLSRPALITVGIYNGTYLWNEFVFALVLTSSPQKR
FT                   TLPLGIWDFQARYGSDIPAIMAFLTLSLLPMLIAYILGQDKIIKGMMAGAVKG"
FT   gene            677306..678505
FT                   /locus_tag="COB47_0572"
FT   CDS_pept        677306..678505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0572"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ate:Athe_0617 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41890"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ8"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADL41890.1"
FT                   /translation="MGNHALLKQINKLLILKTILDNKMISRAKISRLVDLNKATVSNLT
FT                   DELIKEGYIVEKGYGKSKGGRRPVLLQVNKDVGSIIGIDLGVDYIHVILSNFIGEIIFE
FT                   EYVNIKMEEPKEKLLNLLFDMIEKAIDKAPPTPKGILGIGIGVPGIVEKESGIVLIAPN
FT                   LKWKNVHLKSIIEQRFNLPVYIDNEANAGALGEKWFGEWGKVSDLIYLSVGIGLGAGII
FT                   IDNKLFRGAAGFAGEVGHTTINFQDDVCSCGNIGCLENFASERALLSVIKKLVKEGAED
FT                   RYISCENVDEITPSQIIQAAMDGSRICRMAVLEVAEKMAIGIANLVNIFNPEIVIVGNK
FT                   ASFFGDLFLEKLREVVNQKSFIAQFYDLKIEVSKLKDRAVVLGCIAMVISDMLSFPEYV
FT                   "
FT   gene            678520..680586
FT                   /locus_tag="COB47_0573"
FT   CDS_pept        678520..680586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0573"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PFAM: glycoside hydrolase family 10;
FT                   Carbohydrate-binding CenC domain protein; KEGG:
FT                   ate:Athe_0618 endo-1,4-beta-xylanase; SMART: glycoside
FT                   hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41891"
FT                   /db_xref="GOA:D9TIQ9"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIQ9"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADL41891.1"
FT                   /translation="MKSYVYKKLKRFSIMALAILFLVATLIGIGSTKVSKVSGATKKNF
FT                   VEFNFENKLVAPFKASGKSTTLKIDSTAAAEGTFSLFISGRKQANDGVLLDVTNIIDYS
FT                   NEYTITLYVYHKSSKPQRFVVSSEIETKSGKESKLLCEKVIMPNSWKKLDASLNLTELK
FT                   GIKKVWLKVYVPTSTTNFYVDLFTLKVSESSNLIKFESFEDKSIAGFIPQDKKCKLSVS
FT                   KEKAYQGTYSIKFQQTAKKQNTAVNLPVKGTFEKGKSYSISFYVYQPILKSLNLAVGVR
FT                   FLENGKNTKEIVLGKVTVPKNKWTEVFASYTPSLDSKIKDFVIFIRPLSDISYYYFDNF
FT                   TISDDSLYSAVPDLDIPSLCDKYKNYFKIGVAVPYKALTNPIDVALIKRHFNSITPENE
FT                   MKPEALQPYEGGFNFSISDEYMDFCKKNGIAIRGHTLVWHQQTPSWFFQNPQTGEKLTN
FT                   SEKDKKILLERLKKHIQTVVGRYKGKVYAWDVVNEAIDENQPDGFRRSDWFNILGPEYI
FT                   EKAFIWAHEADPKAKLFYNDYNTEDPYKREYIYNLIKSLKAKGIPIHGVGVQCHISLNW
FT                   PDVNEIEETIKLFSKIPGIEIHFTEIDISISKNMVEGDDMYNRSLLIEQAKKLEKIFNV
FT                   LKKYKNVVKSVTFWGLKDDYSWLQGDFPLLFDKDYQPKFAFWSLIDPSVVPEQ"
FT   gene            680742..681806
FT                   /locus_tag="COB47_0574"
FT   CDS_pept        680742..681806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0574"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: bifunctional phosphoglucose/phosphomannose
FT                   isomerase; KEGG: ate:Athe_0619 bifunctional
FT                   phosphoglucose/phosphomannose isomerase; PFAM: Bifunctional
FT                   glucose-6-phosphate/mannose-6-phosphate isomerase-like;
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41892"
FT                   /db_xref="GOA:D9TIR0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR0"
FT                   /inference="protein motif:TFAM:TIGR02128"
FT                   /protein_id="ADL41892.1"
FT                   /translation="MLDNLETIAQNDPSGMFEAVYNLPEQIQKAYEIGKNINVNVKAED
FT                   IDKVVITGLGGSAIGGNLLRVFVLDKCKIPVIVNRDYVLPAYVDSKTLVIASSYSGNTE
FT                   ETLSAYQDAKAKGAKIIAITTGGKLKEFAEKDGFDVITIPSGLQPRAALGYSFIPLLML
FT                   FVKLGLIEPVDDQIEETVKVLSDLRERYKPEVPEEKNLAKRLTLKLWNKLPIIYGISGT
FT                   TEVIAERWKGQICENSKSPAYFNVFSELNHNEIVGTESPKHILGLFEIVMLHDTEDHKR
FT                   NAIRMDITKDLVKGVVSGVNDIYSIGNSRLARMFSLIYLGDYVSLYLATLYQNDPTPVK
FT                   KIDILKNKLAEIKD"
FT   gene            681852..682574
FT                   /locus_tag="COB47_0575"
FT   CDS_pept        681852..682574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0575"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: ate:Athe_0620 PHP domain protein; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41893"
FT                   /db_xref="GOA:D9TIR1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023710"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR1"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADL41893.1"
FT                   /translation="MFLEVETHCHTIASGHAYNTLEEMVLEAQRKGLKGICITDHGPEM
FT                   PGSCSSLYFYNLVVVPRKINGIMVFRGCEANIVDYEGNIDIPQAALMRLDFVIASLHDV
FT                   CIPSGTVSDHTRALIGAIKNPYIHCIGHPGNPLYEIDKEEVVLAAKEYKKAIEINNSSF
FT                   YVREKSKENCIEILKLCKKHGVYIAMGSDAHYKADIGRCEITQKLVTDYEFPPELIVNK
FT                   SLESFISFLKLHGKDIEI"
FT   gene            682603..683574
FT                   /locus_tag="COB47_0576"
FT   CDS_pept        682603..683574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0576"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; KEGG: ate:Athe_0621
FT                   fructose-1,6-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41894"
FT                   /db_xref="GOA:D9TIR2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR2"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ADL41894.1"
FT                   /translation="MPLVTTREMFKKAAEGKYAIGAFNVNNMEIIQGIVEAAKEEQAPL
FT                   ILQVSAGARKYAKHIYLIKLVEAALEDSGDLPIALHLDHGEDFEICKACIDGGFTSVMI
FT                   DGSRLPFEENIALTKKVVEYAHERGVVVEAELGKLAGIEDNVKVAEHEAAFTDPDQAAE
FT                   FVERTGVDSLAVAIGTSHGAYKFKGDPRLDFERLQKIVEKLPKDFPIVLHGASTVLPEF
FT                   VEMCNKYGGNIPGAKGVPEDMLRKAAELGVRKINIDTDLRLAMTAAIRKHLYEHPDHFD
FT                   PRQYLKDGRDAIKEMVKHKLRNVLGCAGKAPEILEEIKKNRG"
FT   gene            683763..684989
FT                   /locus_tag="COB47_0577"
FT   CDS_pept        683763..684989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0577"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: csc:Csac_2480 IS605 family transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB; transposase IS891/IS1136/IS1341 family"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41895"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR3"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADL41895.1"
FT                   /translation="MYKTQKNHIRCDKQTYKLLRMLCHFSKNLYNYALYHIRQHYFKTQ
FT                   EYLPYESVYHLVKENENYRLLPSQVAQQTLISVDEAFKSFLSLLKAKKEGRIDKKISIP
FT                   TYLPKEGMYQIVFPKDQFKVEGNKLRLSLGRNFYKEFGVRYLYFDLPQNIRGKKIKEVR
FT                   IVPRFHGKWFEIEYVYEEEEEEEQNYNLDKSRYLSIDLGLDNFAAVVDTIGTAFLIEGR
FT                   YIKSVNRWYNKQKARLQSIYSKQNIKYGKKLARICLRRQHIIDNFLNQAVNYIIKHCLN
FT                   NQIGTVVIGEMKDIKQKINLGVVNNQNFVNIPYERFKRKLEAKCEYYGLEYVEVDESYT
FT                   SQRCNRCGTVKKSNRKHRGLYVCKDCGYVVNADINGALNILAKVAGESAKKQIVSSGCV
FT                   NHPVRIRVA"
FT   gene            685122..685265
FT                   /locus_tag="COB47_0578"
FT   CDS_pept        685122..685265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41896"
FT                   /db_xref="InterPro:IPR023975"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0622"
FT                   /protein_id="ADL41896.1"
FT                   /translation="MKHIKVVVKNALSKTVVSGGCGECQASCQSACKTSCTVGNQICKN
FT                   RK"
FT   gene            685369..686730
FT                   /locus_tag="COB47_0579"
FT   CDS_pept        685369..686730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0579"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ate:Athe_0623 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41897"
FT                   /db_xref="GOA:D9TIR5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024025"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL41897.1"
FT                   /translation="MVHTFEKFGLKIVVDVASGSIFTVDSVAYEVIKYYKENGSFDGVE
FT                   DALEFDKQQIAEAVFEVKSLIEQGVLFSEDNYKDMNLIEKRNPVIKAMCLHVAHDCDLR
FT                   CRYCFASSGSFKQERKLMSFDVGKKAIDFLLQNSGSRQNLEVDFFGGEPLLNFDVVKKI
FT                   VEYAREEEKKYNKKISFTLTTNATNLSDDIIEYLNQNIENVVLSHDGRPQVNDFMRIDR
FT                   NGNGTYSKITNNILRFIQKRNGKTYYVRGTFTAKNLDFSKDVLHLYSLGIKEISVEPVV
FT                   LDKSSPWAIRESHIERIKEEYDILAEEYINAKLKGEGFSFFHFNIDLTGGPCVSKRLSG
FT                   CGAGFEYVAVDPVGNIFPCHQFVDKPDFKIGDVFKGLQRFDLVEEFKKNTVYEKDECSK
FT                   CWARFYCSGGCAAANYNMNGDVKKSYIVGCELERKRVENAIAIKLYLMEKGIES"
FT   gene            686732..687247
FT                   /locus_tag="COB47_0580"
FT   CDS_pept        686732..687247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0580"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: ate:Athe_0624 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41898"
FT                   /db_xref="GOA:D9TIR6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR6"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ADL41898.1"
FT                   /translation="MIISYKGKTPKIAPSAFVAENAVIIGDVEIGENSSVWFGCVIRCE
FT                   ENKIVIGKNTNIQDLTTIHTDHCCSVIIGDNVTVGHNVVLHGCEIGNNVLIGMGTIIMN
FT                   GSKIGDNSLIGAGSLITQNMVIPPNTLVFGRPAKVIRELTSEEIEKIAISAKEYIELSN
FT                   EYKKIKDY"
FT   gene            687373..688620
FT                   /locus_tag="COB47_0581"
FT   CDS_pept        687373..688620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0581"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="KEGG: ate:Athe_0625 protein-export membrane protein
FT                   SecD; TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41899"
FT                   /db_xref="GOA:D9TIR7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR7"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ADL41899.1"
FT                   /translation="MQNKSLAKFLIGCLVIAFAFYIVFFGLEIGTASIPSVQKVIRYGL
FT                   DLKGGVYIVYEAAKENPTRREMESALQLIRTRLDMRNFYDATATIQGSKRIRVEIPGVK
FT                   DPDEAIQYIGRTALIEFKGPSGDLIVSGRNVVDAYAQQTASGYVVALKFDKEGTKKFAE
FT                   GTKKYLGQNIGIYLDGKLISNPVVRSEIDNGEAVIEGMKDLEEAKTLAQQIKAGALPFA
FT                   LNVIESKAIGPSLGNEAFKSTLKAGIIGILLVFLFMIIFYRLPGLVADIALVAYIVILV
FT                   AIVGYAKITLTLPGIAGIILSAGMAVDANILIFARLKEELRSGKTLRAAMDAGFRRALN
FT                   AVIDSNVTTIIAGIVLLFLGTGPIKGFAWTLTIGIVVSFFTAITVTRFLLTSIINTGLF
FT                   KDIRWYGGKKTREEDV"
FT   gene            688621..689553
FT                   /locus_tag="COB47_0582"
FT   CDS_pept        688621..689553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0582"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="KEGG: ate:Athe_0626 protein-export membrane protein
FT                   SecF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41900"
FT                   /db_xref="GOA:D9TIR8"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR8"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ADL41900.1"
FT                   /translation="MTKIDFMGKRKYFYIVSILIMVIGLISYFVQGFNYDIDFTGGTVL
FT                   EINLHKVPSAAEIADLEKLTKQITGTQTPIVRKVEDGKKIMINAHEVHGKNKTELSKET
FT                   RDKLFEEIAKRYNLKKEDLISYQNVGATISSELKSQAIWAVVIASILMLIYIAIRFEFR
FT                   FGTTAVAALIHDLLIVLTVYTLFKIPLNSTFIAAILTVLGYSINDTIVVFDRIRENRRI
FT                   AGKMELKDLVNLSMNQTIGRSIATAMSVIIVLVVLYIMGVQSIKEFTFPLLIGVISGTY
FT                   SSIFIATALWFDWELSTRKKKLQAKPKRA"
FT   gene            689673..691340
FT                   /locus_tag="COB47_0583"
FT   CDS_pept        689673..691340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0583"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="KEGG: ate:Athe_0627 beta-lactamase domain protein;
FT                   manually curated; PFAM: RNA-metabolising
FT                   metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41901"
FT                   /db_xref="GOA:D9TIR9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIR9"
FT                   /inference="protein motif:PFAM:PF07521"
FT                   /protein_id="ADL41901.1"
FT                   /translation="MKKKQEHRIRIIPLGGLNEIGKNMLVIEVNDEIVVIDCGLAFPED
FT                   EMLGIDLVIPDISYLIKNKEKVRALILTHGHEDHIGAIPYVLRDLNIPIYGTKLTLGLV
FT                   EIKLIEFGIDLNSVKLFTVRAGDVISFNNMRIEFIRTTHSIADSVAVAIHTPLGPIVHT
FT                   GDFKVDFTPIEGEPIDLIRFAELGKQGVLALLCDSTNAERPGFTLSEKTVGATFDRIFS
FT                   QAQGRVIVATFSSHIHRVQQVINSAEKQGRKICVLGRSMVNVVNKALELGYLKMPDGML
FT                   IDVDELDNYPLNKIVLITTGSQGEPMSALSRMASAEHKKVGIIPGDVVIISATPIPGNE
FT                   KFVNRVINDLFRQGAQVIYEDIDDIHVSGHACQEEIKLIHNLTKPKYSIPVHGEFKHLI
FT                   HHAKLAMELGEKNVFVLENGKVLEITKDGAKVVGMVQAGNVLVDGLGVGDVGNVVLRDR
FT                   RHLAQDGLFIVVLTIDSSTRDVLSGPDIITRGFIYIKESEPLIEEAKRVIKDVLYFCYK
FT                   NDITEPNAIKVILKDNLRNFLFEKTRRNPMIIPIITEI"
FT   gene            691482..691712
FT                   /locus_tag="COB47_0584"
FT   CDS_pept        691482..691712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0584"
FT                   /product="sporulation protein, YlmC/YmxH family"
FT                   /note="manually curated; TIGRFAM: sporulation protein,
FT                   YlmC/YmxH family; KEGG: csc:Csac_1196 PRC-barrel
FT                   domain-containing protein; PFAM: PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41902"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014238"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS0"
FT                   /inference="protein motif:TFAM:TIGR02888"
FT                   /protein_id="ADL41902.1"
FT                   /translation="MYKSSDLREKDVINISDGKKLGKVCDLEVDVKTGKVDAIVVPAPF
FT                   SVGNIFSKEKDYVIPWDKIKKIGEDVILVEI"
FT   gene            complement(691716..692432)
FT                   /locus_tag="COB47_0585"
FT   CDS_pept        complement(691716..692432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0585"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: ate:Athe_0629 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41903"
FT                   /db_xref="GOA:D9TIS1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS1"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADL41903.1"
FT                   /translation="MKVGVVQMKISNSIENNLIKITNFLEQAKVEEVDLICFPEMALTG
FT                   YNIQLLKSRVLNDLILSAIDKISQLASKYSICCIIGHPFFEGEKLKNRASVIFPDGRYK
FT                   KYDKLHPTELEMKIFSEGKDTLVFEYKQKRFGIAICRDQNFYNIFKEYKDNACDGVFVL
FT                   AAHYYNPKEARWKIDKNRSIPITRAVENEYYVFLANATGAHLNMISLGHSLIVDRNGCI
FT                   VCEANETEEVLLTAEI"
FT   gene            692638..693897
FT                   /locus_tag="COB47_0586"
FT   CDS_pept        692638..693897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0586"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: ate:Athe_0630 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41904"
FT                   /db_xref="GOA:D9TIS2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS2"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADL41904.1"
FT                   /translation="MKETYEKIVIEGGYPLEGEVVINGAKNAAVAVIPAALMSEGESVI
FT                   ENLPLIEDVFAMDDILLKLGAKIEYDNHSLKIDARNLHSYIAPYESVKKIRASYYLIGA
FT                   LLTRFGKAEVAMPGGCNFGSRPIDQHIKGFRALGADVRIENGMIKAYADRLVGTKIYLD
FT                   VVSVGATINLMLAAVKAKGITIIENAAKEPHVVDTANFLNSMGAKIKGAGTDVIRIEGV
FT                   DRLYPTKYAIIPDQIEAGTYMIAACATKGHIVVKNVIPKHLESLTAKLVEMGAEVITYE
FT                   DSIEVICKQKLRSSSIKTMPYPGFPTDLQPQMTVLLSLCSGTSIVTEGVWENRYQYVDE
FT                   LKKMGANIKVEGRVAVVEGVESLQGAEVVAVDLRAGAALIVAGLAAKGKTVIYNAKNVD
FT                   RGYENIDLKLSKLGAKISRR"
FT   gene            693920..694717
FT                   /locus_tag="COB47_0587"
FT   CDS_pept        693920..694717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0587"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: ate:Athe_0631 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41905"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0631"
FT                   /protein_id="ADL41905.1"
FT                   /translation="MSDKLIFCPLYSGSSGNSILISYKDTTIIVDAGVSFKKLVQALEK
FT                   IGFNKKIDAILLSHDHSDHVKCAGIYFRKLNVPIITNHKTWESIKRFLGKVDESYVKLI
FT                   ETGTSFSVGSIGVDTFSIPHDASDPMGFCFYVKNKKVSICTDVGHVNDSVATMIDFSDI
FT                   ILLESNHDVEMLMFGPYPYHLKQRIKSDKGHLSNEQAAQMILKLNLERTKRIYLGHLSE
FT                   ENNHPDVALMTVKSILKEKGVFDSFDFGLEVAQRYEPSLCSLL"
FT   gene            694689..695201
FT                   /locus_tag="COB47_0588"
FT   CDS_pept        694689..695201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0588"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /EC_number="5.3.1.26"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; KEGG: csc:Csac_1200
FT                   RpiB/LacA/LacB family sugar-phosphate isomerase; PFAM:
FT                   Ribose/galactose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41906"
FT                   /db_xref="GOA:D9TIS4"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS4"
FT                   /inference="protein motif:TFAM:TIGR00689"
FT                   /protein_id="ADL41906.1"
FT                   /translation="MSLLCALCYKCIYKVFERGEIKLKLAIGSDHAGFNLKEAVKKHLD
FT                   KKGIEYKDFGTYSEESCDYPDIAKDVALAVKNGQYDFGILICGTGIGISIAANKVRGIR
FT                   AALCHDTFSAKAARAHNNANILAMGARVIGEGLACEIVDAFLSSAFEGGRHQRRVDKIH
FT                   LIEDEQQ"
FT   gene            695242..695883
FT                   /locus_tag="COB47_0589"
FT   CDS_pept        695242..695883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0589"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="KEGG: ate:Athe_0633 uracil
FT                   phosphoribosyltransferase; TIGRFAM: uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41907"
FT                   /db_xref="GOA:D9TIS5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS5"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADL41907.1"
FT                   /translation="MVEYKKNVYVFDHPLIQHKLTLIRDKNTGVKEFRELVEEIAMLMA
FT                   YEVTRNLPLKEVEIETPVGVAKCKVISGRKLAIVPILRAGLGMVDGLLKLIPAAKVGHI
FT                   GLYRDPETLKPVEYYCKLPQDVHERDIIVLDPMLATGGSASAAFDYIKRYNPQSLRLMC
FT                   LIAAPEGIERLTQDHPEVEIYCAAVDEKLNDHGYIVPGLGDAGDRLFGTK"
FT   gene            695938..696402
FT                   /locus_tag="COB47_0590"
FT   CDS_pept        695938..696402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0590"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   ate:Athe_0634 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41908"
FT                   /db_xref="GOA:D9TIS6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADL41908.1"
FT                   /translation="MRPTWDEYFMQIVDIVKERSTCLRRKVGALIVKDKRILATGYNGA
FT                   PMGLPHCEEVGCVREKLNIPSGQRHELCRGLHAEQNAIIQAAKMGVVIDGSIIYTTTYP
FT                   CVICAKMIVNAGIKKVIYKGSYPDEMSQKIFDEAGIEVVKFEEIGEGDLK"
FT   gene            696399..697793
FT                   /locus_tag="COB47_0591"
FT   CDS_pept        696399..697793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0591"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: ate:Athe_0635 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41909"
FT                   /db_xref="GOA:D9TIS7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS7"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADL41909.1"
FT                   /translation="MKRQTFIVLAAGEGKRMKSKYSKVVQKIMGKPMILYLIDEIQKNF
FT                   EGSQIIVVVGNKKEDVYRVLDGRNIEFAHQKKQLGTAHAVMCAMDVVSKEAEDVFVLYG
FT                   DAPFIKADTLKRISEKRKKENASLCLLTAIFENPYGYGRIISDENGNVLKIVEEKDATD
FT                   EQKQIKEINPGFYCFAKDALEDVLAKIDNNNSQHEYYLTDSIEILNKEGKKVVKIACDD
FT                   NFEVMGINSRYELFLAEQELKIRINKKHLAEGVQMIDMYSVYIHPDVQIGKDTVIYPGT
FT                   FILGNTTIGEECVIGPNSYIVNSKIGNKCHVWFSVIEDSEIKDNVKVGPYAHLRPNSIL
FT                   EEGVKIGNFVEVKNSKVGRNTKSAHLTYIGDADIGENVNLGCGTIFVNYDGYKKHRTVV
FT                   EDNAFIGCNSNLIAPVRIGKNAYIAAGSTITDDVPADALAIARERQTVKEGWALRRKQM
FT                   YEGNNK"
FT   gene            697911..698888
FT                   /locus_tag="COB47_0592"
FT   CDS_pept        697911..698888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0592"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   ate:Athe_0636 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41910"
FT                   /db_xref="GOA:D9TIS8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS8"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADL41910.1"
FT                   /translation="MITHGKEIKIFTGNSNKELAEEIASHLGKKLGDAEIGRFSDGEIS
FT                   VRINETVRGADVFVVQSTCHPVNENLMELLIMIDAFKRASAGRITAVIPYYGYARQDRK
FT                   ARARDPITAKLVANLITSAGADRVLTMDLHAPQIQGFFDIPLDHLIGVPILAKYFMENV
FT                   NLENAVVVSPDLGSVTRARNFATKLDLPLAIVDKRRPKANVAEIMNIIGDVKDKTCLMV
FT                   DDMIDTAGTIVAAAQALMDYGAKEVYACCTHPVLSGPAIERIQQSPIKELVVLNTIPLP
FT                   PEKRIDKIKVLSVASLFAEAITRIYEDVAISTLFDEYISTKGDR"
FT   gene            698929..699552
FT                   /locus_tag="COB47_0593"
FT   CDS_pept        698929..699552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0593"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   ate:Athe_0637 peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41911"
FT                   /db_xref="GOA:D9TIS9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIS9"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADL41911.1"
FT                   /translation="MYFKRQPVFVGLKRSENRLDYIIAGLGNPGDRYTFTRHNVGFLTI
FT                   DYLAQFFNTKVDKIKFKGLVGSFEYAGKKVLLLKPMTYMNASGESIIEAVNFYKIKPEK
FT                   LIVIYDDIAFDVGVVKMRKKGSDGGHNGVKSIIQRLGTEEFPRIRIGIGVPKYDMVKYV
FT                   LSEFEDGEKEKIFRAIEKASNGIKILLESDIDRAMNYINGDVVV"
FT   gene            699556..702987
FT                   /locus_tag="COB47_0594"
FT   CDS_pept        699556..702987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0594"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; TRCF domain protein;
FT                   KEGG: ate:Athe_0638 transcription-repair coupling factor;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41912"
FT                   /db_xref="GOA:D9TIT0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT0"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADL41912.1"
FT                   /translation="MLKVLEKLESFKRLEEDVVKKSLPLVVTGVGEMGKALVVKSLCEK
FT                   FNKKALFITTQRAKLEWERRFMSLFNSVVSLQERENPFVVSFAKSRDSEINRMEQFVKI
FT                   FEDGFDVLILSSQNLFEKYTNLKFGYIHLTEGLDIQLEILIEKLLKFGYERVKTVEKKG
FT                   QFSQKGGIVDIYPVASRYPVRVEFFGDTIDTIRFFDVETQKSFERIDSVKIYKAIEWDL
FT                   EEDFSEGFKRVKEDYKKMKLKLKEDGRKNLEESFREVVEELQLNVERLYPYYYQQFFSV
FT                   VDIFDECLVFVDEYNQVYSSLKASEQEIQEMFSDLLEKGFVLPKMAECYFTMSEVLEKL
FT                   SSSIILQTFVSVVKELELKDIISFNFLREIPSYNGQKEILIDDLKYYMSKGYTINIFAG
FT                   SRTSLEDLADALLREDIQFSEAEEPEVERTGVYLIARSIEKGIEVQDLKWVYLSFFHLE
FT                   KKKESETKKRVKSKKDAFYTIEDLKPGDFVVHRTYGIGKFLGFEKITVEGTTKEYVKLE
FT                   YANSSYLYVPTTNLDMIEKYIGTDDVQPKLSRLGSQEWQKQKQKVRKSLEIVAKDLVEL
FT                   YAKRQLGQGFKFSKDTVWQKEFEEKFPYTETEGQLQAIEEIKRDMESEKPMDRILCGDV
FT                   GYGKTEVAMRAAFKAVMDSKQVAVLVPTTILAQQHYMTFSARMKDFPVTIEVLSRLKSE
FT                   TQQKKIIKGLRKGTIDIVIGTHRLLSSDVKFKDLGLLIIDEEHKFGVEAKEKIKKLKTN
FT                   VDVLTLTATPIPRTLNMALLGIRDLSVIEDPPEDRFPVQTFVLEYNERIIKEAILKEIS
FT                   RGGQVFYLYNRVKDIQEVAAKLQNLVGDSVKIACAHGQMEEEELEEVLIDFIEGRYDVL
FT                   VCTTIIESGVDMPNVNTLIVEDSDRLGLAQLYQLRGRVGRSSRLAYAYFTFRKDKVLSE
FT                   QAQKRLAAIKEFTELGSGFKIAMRDLEIRGAGSIVGKLQHGHINSVGYDMYIRLLSEEI
FT                   RRLKGENVQPEIEPQIDIKVSAFISSSYIDDEKERINMYKKISSIESKNDVNDIYDELI
FT                   DRFGDVPKEVDNLIKVAYLKCLCKKAGIISVLQLQEGLFKLQFLNREMLEAAKERFLQK
FT                   GLSCSQNKDDTLQVLVANNWLDTLVALLEDLEQKSF"
FT   gene            703070..704077
FT                   /locus_tag="COB47_0595"
FT   CDS_pept        703070..704077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0595"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: ate:Athe_0639 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41913"
FT                   /db_xref="GOA:D9TIT1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT1"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADL41913.1"
FT                   /translation="MDKRTKIAIFFITAIVLLIIVIAVTPEMVKYVDENRAVAIVNGEK
FT                   ITKKEFAINYRSQINYYGLDKAFLSQKVGDKTYEQQIKENVLDGLIVRQIELQQARKRN
FT                   ITLTSTEKKAIDQQIEQYKSDSQSGAEFKQYLQTIGATENEYKDQVIKSQIVSKLYDEV
FT                   TKSQKASDAEIESYYNSHKSDFVEVKASHILFKVNDSKEEAAKKRKAEEVLQMIKSGQS
FT                   FEKLAQKYSEDETTKQKSGDLGYFRKGQMVKEFEDAAFSLNIGEISSVVKTSYGFHIIK
FT                   VTDRKQLSLNEVKDEIKSTIESQKKDEYYQSLVEKWKKEAKIKKFEDVLKSVSI"
FT   gene            704116..705486
FT                   /locus_tag="COB47_0596"
FT   CDS_pept        704116..705486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0596"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: ate:Athe_0640 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41914"
FT                   /db_xref="GOA:D9TIT2"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT2"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADL41914.1"
FT                   /translation="MSLMEKVKSNIEKYGMLKKGFKVLIGCSGGVDSMVLLDCMYRLKD
FT                   EYSLDITVAHLNHMLRPEADDDEKFVIEMCKRYNIKCITRKVDVAKLKKEKGLSEEEAG
FT                   RSARYSFFYEIAKEISIDRIFLGHNKNDVVETFFLNLFRGSSLEGLASIPPVRDIIARP
FT                   LINISREEIEEFARVNNIPFVVDKTNYSLKYKRNIVRNEILPLIKERFGESVVSTIFRT
FT                   IEIIREENDQIEELAHNFFQECVQKEDFYYILNIEKTKNLPVFLQRRIIKMILECFNSS
FT                   ISYDMMKEIEELFSLSSGKKKVYKNLVVEKQNDSLVFYKKQVENFFCFEITLDKEHQIL
FT                   YRNFKFNIRTTYQIENQDSIYIDAQQIAENKIFLRTRRDGDFICLKAGKKKLKEWFIDK
FT                   KVPRRWRDSVLLLAKDSEVIAIFDIYSNIVTINQKYKIKPDTKTFLEIQFTKMEGDG"
FT   gene            705483..706022
FT                   /locus_tag="COB47_0597"
FT   CDS_pept        705483..706022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0597"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: ate:Athe_0641 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41915"
FT                   /db_xref="GOA:D9TIT3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT3"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADL41915.1"
FT                   /translation="MTVKDISLKVKEILITEEQIRQKVKELGQKISEDYKDSDDFLMVC
FT                   ILKGGVIFMADLLRQITIPVKIEFMAVSSYGNSTSSSGIVRILKDLDTSIEGKDVLLVE
FT                   DIVDTGLTLRYITEYLRGRKPRSLKICTMLDKPSRRKVDVEIHYKGFEIPDKFVIGYGL
FT                   DYAGLYRNLPYIGVLE"
FT   gene            706069..707919
FT                   /locus_tag="COB47_0598"
FT   CDS_pept        706069..707919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0598"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: ate:Athe_0642 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41916"
FT                   /db_xref="GOA:D9TIT4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT4"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADL41916.1"
FT                   /translation="MRNLFKTATIYILIALVILLLVDILSGGLSYNQLFSNLSERREVI
FT                   YSELINDINDGKVSRIVLSYNNVSGQYADGTKFDNVFVPSPDKFLDQIQPAIQAKKIQI
FT                   VTKEPPQVPWWLSTFLPMLIFAGLMIFVWIFMLQQTQGGGSKIMSFTKSRAKTIQDLKK
FT                   KVTFADVAGADEEKEELKEVIDFLKNPRKYIELGARIPKGILLVGPPGTGKTLLAKAVA
FT                   GEAGVPFFSISGSDFVEMFVGVGAARVRDLFDQAKRNSPCVVFIDEIDAVGRHRGAGLG
FT                   GGHDEREQTLNQLLVEMDGFGTNEGIIVMAATNRPDILDPALLRPGRFDRQIVVNVPDA
FT                   KAREEILKVHARNKPLGEDVDLSQIAKITAGFTGADLENLLNEAALLAARKGKRQINME
FT                   EVQEAVAKVLMGPEKRSRVYTEKEKKLTAYHEAGHAIVRTMIPDSEPVHEVSIIPRGYA
FT                   GGYTMYLPKEDKFYASKSDMMREIVTLLGGRVAEKLVLEDVSTGAASDIKRATKIARDM
FT                   VTKYGMSDKLGPMTFGTEQEEVFLGRDLALARNYSEEVAAEIDREIKSIIEEAYKKAEE
FT                   ILKQNIDKLHKVANALLEKEKLTGEEFRKLVFEDAQPQLA"
FT   gene            708075..709412
FT                   /locus_tag="COB47_0599"
FT   CDS_pept        708075..709412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0599"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="TIGRFAM: glutamine synthetase, type I; KEGG:
FT                   ate:Athe_0643 glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41917"
FT                   /db_xref="GOA:D9TIT5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT5"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADL41917.1"
FT                   /translation="MKNYTKEDIIRICKEQDVKFIRLQFVDIFGILKNVAITVDQLEAA
FT                   LNNEIMFDGSSIEGFVRIEESDMYLRPDFNTFTIFPWRPSPNRVARLICDVYLPDGTPF
FT                   PGCPRGVLKKTLQKAEEMGFKFFVGPELEFFLFLTDENGNPTLQTHDNAGYFDLGPVDL
FT                   GEDARRDMVLTLEEMGFEIEASHHEVAPGQHEIDFKYDDALYTADNVVTFKLVVKTIAQ
FT                   RHGLHATFMPKPIFGINGSGMHTNMSLARVSDGKNAFLDPNDKLQLSKEAYYFIGGLMK
FT                   HAREFALVTNPLVNSYKRLVPGYEAPVYIAWSPKNRSPLIRVPAKRGQATRIELRNPDP
FT                   AANPYLAFAAVLAAGLDGIKNKIEPPEPVEENIFEMSEEERAKRGIGSLPGSLEEAIKE
FT                   FENSTLMRETLGDHIFEKYLEAKKLEWDDYRTKVHQWEIDAYLTKY"
FT   gene            complement(709487..710872)
FT                   /locus_tag="COB47_0600"
FT   CDS_pept        complement(709487..710872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0600"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="KEGG: ate:Athe_0644 glutamate synthase (NADPH),
FT                   homotetrameric; TIGRFAM: glutamate synthase (NADPH),
FT                   homotetrameric; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41918"
FT                   /db_xref="GOA:D9TIT6"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT6"
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /protein_id="ADL41918.1"
FT                   /translation="MDVLKRVPIKEQEPIERIHNFDEVCFGYTPDEAVREAQRCLECKN
FT                   APCVKGCPVEVKIPEFIKLIKEKKFKESYLKILETNLLPAICGRVCPQETQCEQNCVRG
FT                   IKGEPIAIGKLERFVADWFRQNCEFEFSKPQPNKRKVAIIGSGPAGLSCASSLAKMGYN
FT                   VTIFEAFHKLGGVLYYGIPEFRLPKEVVEWEIENLKKMGVEFRTNMIFGKTFDLEDLKQ
FT                   EGFDAVFISSGAGLPNFLNIEGELLNGIYSANEFLTRINLMKAYKFPEYDTPIKLGKKV
FT                   GVIGGGNVAMDAARVARRLGSEVYILYRRTEAEMPARKEEILHAKEEGIKIIELVSPVK
FT                   FIGDETGHVKALELVKMQLSQPDSSGRRSVKPIDGSNFVFEADNFIVAIGQSPNPLVKK
FT                   AIPDLELNPNGSIKVDENLMTNIEGVFAGGDIVTGAATVILAMGMGKKAAQSIDRYLNA
FT                   KKV"
FT   gene            complement(710878..711720)
FT                   /locus_tag="COB47_0601"
FT   CDS_pept        complement(710878..711720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0601"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain; KEGG:
FT                   ate:Athe_0645 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41919"
FT                   /db_xref="GOA:D9TIT7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT7"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADL41919.1"
FT                   /translation="MNEIVIKQNLAPNVWLMGIYSPQVAKKSNPGQFVILRVAENGERI
FT                   PLTIADFDREKGVVYIIFQVVGKTTSLLSQLNIGDRIIDFVGPLGMPYEHNPEDKNYLF
FT                   VAGGLGIPAIFSKVKMLHSQGKNIDIIIGGRSKENIFFEDELKKYCNNLYISTNDGSYG
FT                   KKGFVTDILNELLESGKRYDEIFAVGPVPMMKAVVDITKKYQIKTLVSLNPIMVDGTGM
FT                   CGGCRVKIGNEVKFACVDGPIFDGFEVDFDGLMKRNSYYQDLENISYREHKCKIGLGE"
FT   gene            711890..712174
FT                   /locus_tag="COB47_0602"
FT   CDS_pept        711890..712174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41920"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0646"
FT                   /protein_id="ADL41920.1"
FT                   /translation="MKEDIEKRTLLAAEIMIKYNATVRKVARILGVSKSTIHNDLAERL
FT                   LYINKELYKQVRAILEKNKQERHIRGGLATKRKYLIKKSQLISKNSGII"
FT   gene            712209..712979
FT                   /locus_tag="COB47_0603"
FT   CDS_pept        712209..712979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0603"
FT                   /product="MazG family protein"
FT                   /note="KEGG: ate:Athe_0647 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41921"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIT9"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADL41921.1"
FT                   /translation="MRESFEELVKIMDILRNKCPWDKQQTHESLKKYLIEETYEVIEAI
FT                   DEGDFAKLKEELGDLLLQVVFHAKIAQENGKFDIYEVIYDICQKMKRRHTHVFGSDNFS
FT                   TAEEVLQNWDKIKNNEKEIETITDSMKRIPKHLPALMRSYKVQEKAAKVGFDWESFEGA
FT                   LNKVYEELEELKECLSKNDKKEKIEEEIGDILFAVVNIARFFEVDPEEALHNTVEKFIT
FT                   RFSYVEESASKQGKKLNEMTLEDMDKFWEEAKKV"
FT   gene            713068..713343
FT                   /locus_tag="COB47_0604"
FT   CDS_pept        713068..713343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0604"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: csc:Csac_1214 histone family protein
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41922"
FT                   /db_xref="GOA:D9TIU0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU0"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADL41922.1"
FT                   /translation="MNKTDLISAMAEKSGLTKKDAEKALNAFVDAVTEALSKGEKVQLV
FT                   GFGSFEVRERAERVGRNPQTQEEIKIPATKVPVFKAGKMLKDAVAK"
FT   gene            713495..713737
FT                   /locus_tag="COB47_0605"
FT   CDS_pept        713495..713737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0605"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: ate:Athe_0649 RNA-binding S4 domain protein;
FT                   PFAM: RNA-binding S4 domain protein; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41923"
FT                   /db_xref="GOA:D9TIU1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU1"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADL41923.1"
FT                   /translation="MRIDKYLKVSRIIKRRTLAQEACEAGRVFVNGKVAKPSTDIKVGD
FT                   VIEVHFGDRVFKCKVASVDEKVQKNLSSSMYEVIE"
FT   gene            713831..714106
FT                   /locus_tag="COB47_0606"
FT   CDS_pept        713831..714106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0606"
FT                   /product="YabP family protein"
FT                   /note="PFAM: YabP family protein; KEGG: ate:Athe_0650 YabP
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41924"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU2"
FT                   /inference="protein motif:PFAM:PF07873"
FT                   /protein_id="ADL41924.1"
FT                   /translation="MDERKNLKSKIHSVLIENREKITINGVDDVESFDENNIILVINDE
FT                   LLMIKGFDLRINKINTETGEVFIEGQIYSLEYGESPKKGLLSRLFK"
FT   gene            714120..714440
FT                   /locus_tag="COB47_0607"
FT   CDS_pept        714120..714440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41925"
FT                   /db_xref="GOA:D9TIU3"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0651"
FT                   /protein_id="ADL41925.1"
FT                   /translation="MPASIFVQISDFTSCFFLGFVVGVVFDSFFFKRILKRRTKELLFF
FT                   SSSILSTAVLIAGLMFINFYTLKWYTFLAIASGIYVYENTISPLYKGFLKKVNKVLSFN
FT                   KR"
FT   gene            714495..714794
FT                   /locus_tag="COB47_0608"
FT   CDS_pept        714495..714794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0608"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   ate:Athe_0652 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41926"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU4"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADL41926.1"
FT                   /translation="MKKLFKVLKRIFVLIFVISFLVYSATTVFKQQMILRQVKAQQREI
FT                   IVQIERIKKENEYLKRLAQYVGTKDYIQQVAREKLGLVGKDEIVFIDKNKKKKE"
FT   sig_peptide     714495..714569
FT                   /locus_tag="COB47_0608"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.700 at
FT                   residue 25"
FT   gene            714808..715170
FT                   /locus_tag="COB47_0609"
FT   CDS_pept        714808..715170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0609"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   ate:Athe_0653 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41927"
FT                   /db_xref="GOA:D9TIU5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU5"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADL41927.1"
FT                   /translation="MLIKRGQILEGVVKGITQFGAFVELPNGSVGLVHISEVAEEYVED
FT                   IKKYLKENQTVKVKVINVKEDGKISLSIKRAKETMKRENKTKRANDDFEAKLSKFLKDS
FT                   NQKLSEYNKRFDGKRR"
FT   gene            715255..715908
FT                   /locus_tag="COB47_0610"
FT   CDS_pept        715255..715908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0610"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: ate:Athe_0654 CoA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41928"
FT                   /db_xref="GOA:D9TIU6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU6"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADL41928.1"
FT                   /translation="MFKKKNISLAVIRRLPRYLRYVEDLLNHDVMRISSSELSQRMGYT
FT                   ASQVRQDFNNFGGFGQQGYGYSTQVLYENLVKILGLDRNFKMVIVGVGNLGQALANYAN
FT                   FYKKGFRLIGLFDIDPQKVGKAIRDIKIEHVDKLKDFIRKNDVDIGVLCVPANVAQEVA
FT                   DIMVEGGIKGIWNFTAKEIEVKGDVVVENVHLIDSLMVLSYKLNEKLLEKEKVK"
FT   gene            715926..717407
FT                   /locus_tag="COB47_0611"
FT   CDS_pept        715926..717407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0611"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; KEGG: ate:Athe_0655
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41929"
FT                   /db_xref="GOA:D9TIU7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU7"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADL41929.1"
FT                   /translation="MRYISTRGNKEVQAKEAIYRGIAEDGGLYTPVSIPSLDLSKIKNI
FT                   DSYENLAKYIFELYLTDFTNDEIADCIDKSYSRGKFDTKDVVTIKKLSSSLFALELWHG
FT                   PTYAFKDVALQVLPHLLLKSMPTFYKQALILVATSGDTGKAALEGFRDVDRTKIVVFYP
FT                   SEGVSEVQKRQMITQEGRNTFVAGIKGNFDDAQSGVKEIFTSKKCIDTIENLGFFFTSA
FT                   NSINFGRLLPQIVYYIWSYIVLLKNGDIREGEKINFVVPTGNFGNILAGFIAKIMGIPI
FT                   NKLIVASNINSVVADFIRTGLYDRRREFYKTISPSMDILVASNLERLLYLVTKDSEKVK
FT                   KYMLDLKTEGYFKVEEKVLKEIQESFWGDFSTDDQTRNSIKTIYSEYGYLVDPHSAVGF
FT                   DVYSKYQKQTLDSTKTVVLQTANPYKFAKDVLNALFDSEYNNIDPFEAVEVLYTKTCFE
FT                   VPEGIKNLISKPILHPDVIEKDKMFDFILEKIRDN"
FT   gene            717997..719250
FT                   /locus_tag="COB47_0612"
FT   CDS_pept        717997..719250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0612"
FT                   /product="MgtE intracellular region"
FT                   /note="KEGG: ate:Athe_0656 MgtE intracellular region; PFAM:
FT                   MgtE intracellular region; CBS domain containing protein;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41930"
FT                   /db_xref="GOA:D9TIU8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU8"
FT                   /inference="protein motif:PFAM:PF03448"
FT                   /protein_id="ADL41930.1"
FT                   /translation="MPNVTSFYLSRVIGNKVFSEEKKVVGRLLDLVVDASYIRPKVIAA
FT                   KVKSGGQTQIVDFSFFIIYKEKGQYVIETRNLKPINVKKEDTIMLVRHILDKQIVDMNG
FT                   RKVVRVNDIRLAVLSTGVYVIAVDIGLEGLLRRLGLAKPLKKVLKPLGKNIPSRLILWD
FT                   DVQPLASPRLDLKLSTTYSKLSTLHPSDLADIIEELDKKTQAYIFSTLDEEKAADVLEE
FT                   LDVEAQRNVLESLPVEKAADVLEKMPADEVADILDEIKEERAEELLNEMEKEASEEVKE
FT                   LMEYPENTVGAIMTTDFIAFKTHFTVEQTIEELRRLKPEPDEIYYLYVVDNEERLCGVV
FT                   SLRDLVISEPQTPLYEIMNRDVVCVKDTDNVNSLVEIISKYSLLAVPVIDENKKLIGVV
FT                   IINDIVYELLKMKRKLLL"
FT   gene            719284..720531
FT                   /locus_tag="COB47_0613"
FT   CDS_pept        719284..720531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0613"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="KEGG: ate:Athe_0657 natural resistance-associated
FT                   macrophage protein; manually curated; PFAM: natural
FT                   resistance-associated macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41931"
FT                   /db_xref="GOA:D9TIU9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIU9"
FT                   /inference="protein motif:PFAM:PF01566"
FT                   /protein_id="ADL41931.1"
FT                   /translation="MVQTTKSSRLKNILLILSVIGPGLVTATADNDASGIATYAMVGSM
FT                   FGYKMLWGLFLITISLAIIQEMAARMGVVTGKGLSDLIRENFGVKMTFFAMVTLLIANF
FT                   TTTVGEFAGIAASLEIFGISKYISVPITAIFVWYIINRGSYRKTERFFLGLMVIYVSYI
FT                   ISGFLAKPDWKEVFKNTFLPSFSFEPNFVLIFIAMIGTTITPWMQFYLQSSVVDKGVDV
FT                   KNLKYQRWDVFLGAFWTDFIAFFIVVATAATLYKHGVSIETAEDAAKALEPFAGKYASA
FT                   LFAIGLFGASLLGAFILPLSTAYAITEAFGFENGLDKKFKEAPAFYGIILFFIIIGAGI
FT                   ILFPNIPLIKLMIIAQEINGILLPIILIYMLRLTNDKEIMGEYVNSKVFNIIAWLTVVF
FT                   IIILTLILLVQPFLNI"
FT   sig_peptide     719284..719373
FT                   /locus_tag="COB47_0613"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.886) with cleavage site probability 0.470 at
FT                   residue 30"
FT   gene            720782..721270
FT                   /locus_tag="COB47_0614"
FT   CDS_pept        720782..721270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0614"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: ate:Athe_0658 transcription elongation factor
FT                   GreA; TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41932"
FT                   /db_xref="GOA:D9TIV0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV0"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADL41932.1"
FT                   /translation="MAREMDTAKYQLSREAYEKYLKELENLKTVKRKEVAEKIKVARSF
FT                   GDLSENSEYDEAKAEQAAVEERIAYLEQLINNAKIIDKDEVSTDFVGIGTNVKIQNLDT
FT                   GDVFEYSIVGSKEADPLNFKISDESPVGKALVGKKVGDVVEVNVPAGKFRYKILEISK"
FT   gene            721294..722781
FT                   /locus_tag="COB47_0615"
FT   CDS_pept        721294..722781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0615"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: ate:Athe_0659 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase; PFAM: tRNA synthetase class II (D K
FT                   and N); nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41933"
FT                   /db_xref="GOA:D9TIV1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV1"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADL41933.1"
FT                   /translation="MQDFEFTQDELNEQIQNRIKKLRELQQNKYNPYEKVKYDPTHYST
FT                   DIKENFDQFEGKFVCVAGRMLSKRGHGKASFVDILDTKGKIQIYIKIDEVGEEKYQEFK
FT                   EYYDIGDIIGVKGEVFKTHKGEVSIKAKEIEMLTKCLRPLPEKWHGLRDVDTRYRKRYL
FT                   DLIVNPQVRDTFIKRSLIIRSIRKFLDDRGFLEVETPVLSPIAGGAAARPFITHHNALD
FT                   IDLYLRIATELHLKRLIVGGFDKVYELGRVFRNEGISIKHNPEFTTIEIYQAYADYKDM
FT                   MDLTEELITTVAQEVLSTLKITYQGQEIDLTPPWQRLTMVEAIKKYVGVDFENVSSLDE
FT                   ARKIAKDLGIEVEENWQVGHIINEVFEKKVEDFLIQPTFIMDYPVEVSPLAKRKKDNPQ
FT                   FTERFELFITCREIANAFSELNDPFDQKERFLEQLKERQRGNQEAHMMDEDFIEALEYG
FT                   MPPTGGLGIGIDRLVMLLTDSYSIRDVLLFPTMRPKD"
FT   gene            722917..723918
FT                   /locus_tag="COB47_0616"
FT   CDS_pept        722917..723918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41934"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0660"
FT                   /protein_id="ADL41934.1"
FT                   /translation="MKIAIPHSLLYYYYFPLWDTFFKELGFEVVDTGPTTKGILDKGSK
FT                   AAVADICAPIKIFTGHVIEGLNVADYVFVPRFARIKKPEYFCPKFMGLPDIIEGTVEES
FT                   KGRVISPIINEKNNENISSPKIYEMLTEMFGFSHREIRLAMRKAEEVFKRFKNLMNKGL
FT                   SCDKALDSYRRGIWEENLKKVKKDGDITIAVLGYVYDVYDSFISMDVIKKLEALGVNIK
FT                   TFEMVPQEVAYNNLKHYRKRLFWTFSNRVLGAGLHYLKDPEVDGVIHVTAFGCGPDAIV
FT                   GRFLQYESDVAGKPFTTLRVDEHTGEGHMITRIEAFVDMLRRKKWAKLSEVL"
FT   gene            723921..725072
FT                   /locus_tag="COB47_0617"
FT   CDS_pept        723921..725072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0617"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41935"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0661"
FT                   /protein_id="ADL41935.1"
FT                   /translation="MKVSFPYMGSAIVYKKLFEFLEHEVIMPPKPTQRTMDLGVKYSPE
FT                   FACIPLKMVMGTYLEAIEKGAKVLVTSGGHGPCRAGFYGDTHRNILKSLGYDDVELIIF
FT                   DAPQDNWRAFFRNVQKIRNGVPWHKVINRMYTLYRFVQKLDELEKMVQKIRPYEINKGQ
FT                   TTQVWNQIQEKFDKIKTRKELYRVYEECKQMLLSIPTRKVEEKDRIRVGIVGEIYVVME
FT                   SSINFGIEEILGNLGVEVERSLYLFEWINDNLVPWILRPKRFKEIIKKGQRYIKILIGG
FT                   HAVETVGHIIDFKERGFDGIVHLMPFACLPELVTQSLIPKISKEVDIPILSLPIDEQTG
FT                   KANMLTRIEAFIDLLKNRKKGKTKEVFIDNVQEHVEEERVVMV"
FT   gene            725069..726028
FT                   /locus_tag="COB47_0618"
FT   CDS_pept        725069..726028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0618"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="KEGG: ate:Athe_0662 CoA-substrate-specific enzyme
FT                   activase; TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41936"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV4"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ADL41936.1"
FT                   /translation="MKEIYIGVDVGSVSTNVVAIDRNVNVLFKTYIRTNGQPIDSVKEG
FT                   VKQLKETLGDVEVLGVGTTGSGRQLAGAILGADVVKNEITAHATATIHFVPDVRTIFEI
FT                   GGQDSKIIIIKDQMVVDFAMNTVCAAGTGSFLDHQAERLKIPIEQFGDLALSATRPVRI
FT                   AGRCTVFAESDMIAKQQFGFSKAEIIRGLCDALVRNYLNNVGRGKNLEPPFVFQGGVAA
FT                   NKGIRAAFERELQSEVIVPEHFNVMGAIGSAILAKDYIEKTNAKTNFRGFDAADIDFST
FT                   SSFECKGCSNRCEVVKVSMEGKVIAMWGDRCGKWTNSL"
FT   gene            726203..726925
FT                   /locus_tag="COB47_0619"
FT   CDS_pept        726203..726925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0619"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; KEGG: ate:Athe_0663 peptidase
FT                   M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41937"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV5"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADL41937.1"
FT                   /translation="MCALESYPGKEEELKEFVENELSEMLIFYDDDVKNNLFGERGKNP
FT                   KVLLNAHLDSYGAEYLGKNWLFEVIYDEKTDKIKGNGIRPIGADDRCGIAIILALLRFT
FT                   DYQFKFLFTTSCEDEHQGVKFFIENHPEFFKGVNLVIGLDRRGFGDVVCSYGGKDVCFK
FT                   NECVDKVIEIGKSLGIPAKREKSPHVADIRFIADRFGISSFCLSVGYYNPHTTSEYAVL
FT                   DEVVKAYEWMCKILESVQ"
FT   gene            727184..728065
FT                   /locus_tag="COB47_0620"
FT   CDS_pept        727184..728065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0620"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.21"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   KEGG: ate:Athe_0664 branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41938"
FT                   /db_xref="GOA:D9TIV6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV6"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADL41938.1"
FT                   /translation="MEEKLIYIDGEFYKKSEAKISVFDHGFLYGDGVFEGIRVYNGKIF
FT                   KCKEHVDRLYQAAKAIYMEIPISKEEMIEALKKTCRINNIREGYIRLVVSRGVGDLGLS
FT                   PTKCPKPTIVIIADSIVLYPQEMYEKGMKVITASTRRNSPQCVDPQIKSLNYLNNILAK
FT                   IEANRAGVPEAIMLTQDGYVTECTGDNIFIVKDGELITPPVYLGALDGITRRTVMALAK
FT                   DLGIPVYEKIFTLYNLYNADECFFTGTAAEVIAVTEVDGRKIGNGEVGPITKKLMEEFK
FT                   KLTQIDGVDIYE"
FT   gene            728082..729740
FT                   /locus_tag="COB47_0621"
FT   CDS_pept        728082..729740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COB47_0621"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   ate:Athe_0665 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:COB47_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADL41939"
FT                   /db_xref="GOA:D9TIV7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D9TIV7"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADL41939.1"
FT                   /translation="MRSDIVKKGFEKAPQRSLF