(data stored in SCRATCH zone)

EMBL: CP002167

ID   CP002167; SV 1; circular; genomic DNA; STD; PRO; 4993013 BP.
XX
AC   CP002167;
XX
PR   Project:PRJNA50883;
XX
DT   27-SEP-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Escherichia coli UM146, complete genome.
XX
KW   .
XX
OS   Escherichia coli UM146
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-4993013
RX   DOI; 10.1128/JB.01290-10.
RX   PUBMED; 21075930.
RA   Krause D.O., Little A.C., Dowd S.E., Bernstein C.N.;
RT   "Complete genome sequence of adherent invasive Escherichia coli UM146
RT   isolated from ileal Crohn's disease biopsy tissue";
RL   J. Bacteriol. 193(2):583-583(2010).
XX
RN   [2]
RP   1-4993013
RA   Krause D.O., Little A.C., Dowd S.E., Bernstein C.N.;
RT   ;
RL   Submitted (29-JUL-2010) to the INSDC.
RL   Research and Testing Laboratory, 4321 Marsha Sharp Fwy, Lubbock, TX 79407,
RL   USA
XX
DR   MD5; acb83b3a3a89b1ea9b683433063a953a.
DR   BioSample; SAMN00017915.
DR   EnsemblGenomes-Gn; EBG00001033974.
DR   EnsemblGenomes-Gn; EBG00001033975.
DR   EnsemblGenomes-Gn; EBG00001033976.
DR   EnsemblGenomes-Gn; EBG00001033977.
DR   EnsemblGenomes-Gn; EBG00001033978.
DR   EnsemblGenomes-Gn; EBG00001033979.
DR   EnsemblGenomes-Gn; EBG00001033980.
DR   EnsemblGenomes-Gn; EBG00001033981.
DR   EnsemblGenomes-Gn; EBG00001033982.
DR   EnsemblGenomes-Gn; EBG00001033983.
DR   EnsemblGenomes-Gn; EBG00001033984.
DR   EnsemblGenomes-Gn; EBG00001033985.
DR   EnsemblGenomes-Gn; EBG00001033986.
DR   EnsemblGenomes-Gn; EBG00001033987.
DR   EnsemblGenomes-Gn; EBG00001033988.
DR   EnsemblGenomes-Gn; EBG00001033989.
DR   EnsemblGenomes-Gn; EBG00001033990.
DR   EnsemblGenomes-Gn; EBG00001033991.
DR   EnsemblGenomes-Gn; EBG00001033992.
DR   EnsemblGenomes-Gn; EBG00001033993.
DR   EnsemblGenomes-Gn; EBG00001033994.
DR   EnsemblGenomes-Gn; EBG00001033995.
DR   EnsemblGenomes-Gn; EBG00001033996.
DR   EnsemblGenomes-Gn; EBG00001033997.
DR   EnsemblGenomes-Gn; EBG00001033998.
DR   EnsemblGenomes-Gn; EBG00001033999.
DR   EnsemblGenomes-Gn; EBG00001034000.
DR   EnsemblGenomes-Gn; EBG00001034001.
DR   EnsemblGenomes-Gn; EBG00001034002.
DR   EnsemblGenomes-Gn; EBG00001034003.
DR   EnsemblGenomes-Gn; EBG00001034004.
DR   EnsemblGenomes-Gn; EBG00001034005.
DR   EnsemblGenomes-Gn; EBG00001034006.
DR   EnsemblGenomes-Gn; EBG00001034007.
DR   EnsemblGenomes-Gn; EBG00001034008.
DR   EnsemblGenomes-Gn; EBG00001034009.
DR   EnsemblGenomes-Gn; EBG00001034010.
DR   EnsemblGenomes-Gn; EBG00001034011.
DR   EnsemblGenomes-Gn; EBG00001034012.
DR   EnsemblGenomes-Gn; EBG00001034013.
DR   EnsemblGenomes-Gn; EBG00001034014.
DR   EnsemblGenomes-Gn; EBG00001034015.
DR   EnsemblGenomes-Gn; EBG00001034016.
DR   EnsemblGenomes-Gn; EBG00001034017.
DR   EnsemblGenomes-Gn; EBG00001034018.
DR   EnsemblGenomes-Gn; EBG00001034019.
DR   EnsemblGenomes-Gn; EBG00001034020.
DR   EnsemblGenomes-Gn; EBG00001034021.
DR   EnsemblGenomes-Gn; EBG00001034022.
DR   EnsemblGenomes-Gn; EBG00001034023.
DR   EnsemblGenomes-Gn; EBG00001034024.
DR   EnsemblGenomes-Gn; EBG00001034025.
DR   EnsemblGenomes-Gn; EBG00001034026.
DR   EnsemblGenomes-Gn; EBG00001034027.
DR   EnsemblGenomes-Gn; EBG00001034028.
DR   EnsemblGenomes-Gn; EBG00001034029.
DR   EnsemblGenomes-Gn; EBG00001034030.
DR   EnsemblGenomes-Gn; EBG00001034031.
DR   EnsemblGenomes-Gn; EBG00001034032.
DR   EnsemblGenomes-Gn; EBG00001034033.
DR   EnsemblGenomes-Gn; EBG00001034034.
DR   EnsemblGenomes-Gn; EBG00001034035.
DR   EnsemblGenomes-Gn; EBG00001034036.
DR   EnsemblGenomes-Gn; EBG00001034037.
DR   EnsemblGenomes-Gn; EBG00001034038.
DR   EnsemblGenomes-Gn; EBG00001034039.
DR   EnsemblGenomes-Gn; EBG00001034040.
DR   EnsemblGenomes-Gn; EBG00001034041.
DR   EnsemblGenomes-Gn; EBG00001034042.
DR   EnsemblGenomes-Gn; EBG00001034043.
DR   EnsemblGenomes-Gn; EBG00001034044.
DR   EnsemblGenomes-Gn; EBG00001034045.
DR   EnsemblGenomes-Gn; EBG00001034046.
DR   EnsemblGenomes-Gn; EBG00001034047.
DR   EnsemblGenomes-Gn; EBG00001034048.
DR   EnsemblGenomes-Gn; EBG00001034049.
DR   EnsemblGenomes-Gn; EBG00001034050.
DR   EnsemblGenomes-Gn; EBG00001034051.
DR   EnsemblGenomes-Gn; EBG00001034052.
DR   EnsemblGenomes-Gn; EBG00001034053.
DR   EnsemblGenomes-Gn; EBG00001034054.
DR   EnsemblGenomes-Gn; EBG00001034055.
DR   EnsemblGenomes-Gn; EBG00001034056.
DR   EnsemblGenomes-Gn; EBG00001034057.
DR   EnsemblGenomes-Gn; EBG00001034058.
DR   EnsemblGenomes-Gn; EBG00001034059.
DR   EnsemblGenomes-Gn; EBG00001034060.
DR   EnsemblGenomes-Gn; EBG00001034061.
DR   EnsemblGenomes-Gn; EBG00001034062.
DR   EnsemblGenomes-Gn; EBG00001034063.
DR   EnsemblGenomes-Gn; EBG00001034064.
DR   EnsemblGenomes-Gn; EBG00001034065.
DR   EnsemblGenomes-Gn; EBG00001034066.
DR   EnsemblGenomes-Gn; EBG00001034067.
DR   EnsemblGenomes-Gn; EBG00001034068.
DR   EnsemblGenomes-Gn; EBG00001034069.
DR   EnsemblGenomes-Gn; EBG00001034070.
DR   EnsemblGenomes-Gn; EBG00001034071.
DR   EnsemblGenomes-Gn; EBG00001034072.
DR   EnsemblGenomes-Gn; EBG00001034073.
DR   EnsemblGenomes-Gn; EBG00001034074.
DR   EnsemblGenomes-Gn; EBG00001034075.
DR   EnsemblGenomes-Gn; EBG00001034076.
DR   EnsemblGenomes-Gn; EBG00001034077.
DR   EnsemblGenomes-Gn; EBG00001034078.
DR   EnsemblGenomes-Gn; EBG00001034079.
DR   EnsemblGenomes-Gn; EBG00001034080.
DR   EnsemblGenomes-Gn; EBG00001034081.
DR   EnsemblGenomes-Gn; EBG00001034082.
DR   EnsemblGenomes-Gn; EBG00001034083.
DR   EnsemblGenomes-Gn; EBG00001034084.
DR   EnsemblGenomes-Gn; EBG00001034085.
DR   EnsemblGenomes-Gn; EBG00001034086.
DR   EnsemblGenomes-Gn; EBG00001034087.
DR   EnsemblGenomes-Gn; EBG00001034088.
DR   EnsemblGenomes-Gn; EBG00001034089.
DR   EnsemblGenomes-Gn; EBG00001034090.
DR   EnsemblGenomes-Gn; EBG00001034091.
DR   EnsemblGenomes-Gn; EBG00001034092.
DR   EnsemblGenomes-Gn; EBG00001034093.
DR   EnsemblGenomes-Gn; EBG00001034094.
DR   EnsemblGenomes-Gn; EBG00001034095.
DR   EnsemblGenomes-Gn; EBG00001034096.
DR   EnsemblGenomes-Gn; EBG00001034097.
DR   EnsemblGenomes-Gn; EBG00001034098.
DR   EnsemblGenomes-Gn; EBG00001034099.
DR   EnsemblGenomes-Gn; EBG00001034100.
DR   EnsemblGenomes-Gn; EBG00001034101.
DR   EnsemblGenomes-Gn; EBG00001034102.
DR   EnsemblGenomes-Gn; EBG00001034103.
DR   EnsemblGenomes-Gn; EBG00001034104.
DR   EnsemblGenomes-Gn; EBG00001034105.
DR   EnsemblGenomes-Gn; EBG00001034106.
DR   EnsemblGenomes-Gn; EBG00001034107.
DR   EnsemblGenomes-Gn; EBG00001034108.
DR   EnsemblGenomes-Gn; EBG00001034109.
DR   EnsemblGenomes-Gn; EBG00001034110.
DR   EnsemblGenomes-Gn; EBG00001034111.
DR   EnsemblGenomes-Gn; EBG00001034112.
DR   EnsemblGenomes-Gn; EBG00001034113.
DR   EnsemblGenomes-Gn; EBG00001034114.
DR   EnsemblGenomes-Gn; EBG00001034115.
DR   EnsemblGenomes-Gn; EBG00001034116.
DR   EnsemblGenomes-Gn; EBG00001034117.
DR   EnsemblGenomes-Gn; EBG00001034118.
DR   EnsemblGenomes-Gn; EBG00001034119.
DR   EnsemblGenomes-Gn; EBG00001034120.
DR   EnsemblGenomes-Gn; EBG00001034121.
DR   EnsemblGenomes-Gn; EBG00001034122.
DR   EnsemblGenomes-Gn; EBG00001034123.
DR   EnsemblGenomes-Gn; EBG00001034124.
DR   EnsemblGenomes-Gn; EBG00001034125.
DR   EnsemblGenomes-Gn; EBG00001034126.
DR   EnsemblGenomes-Gn; EBG00001034127.
DR   EnsemblGenomes-Gn; EBG00001034128.
DR   EnsemblGenomes-Gn; EBG00001034129.
DR   EnsemblGenomes-Gn; EBG00001034130.
DR   EnsemblGenomes-Gn; EBG00001034131.
DR   EnsemblGenomes-Gn; EBG00001034132.
DR   EnsemblGenomes-Gn; EBG00001034133.
DR   EnsemblGenomes-Gn; EBG00001034134.
DR   EnsemblGenomes-Gn; EBG00001034135.
DR   EnsemblGenomes-Gn; EBG00001034136.
DR   EnsemblGenomes-Gn; EBG00001034137.
DR   EnsemblGenomes-Gn; EBG00001034138.
DR   EnsemblGenomes-Gn; EBG00001034139.
DR   EnsemblGenomes-Gn; EBG00001034140.
DR   EnsemblGenomes-Gn; EBG00001034141.
DR   EnsemblGenomes-Gn; EBG00001034142.
DR   EnsemblGenomes-Gn; EBG00001034143.
DR   EnsemblGenomes-Gn; EBG00001034144.
DR   EnsemblGenomes-Gn; EBG00001034145.
DR   EnsemblGenomes-Gn; EBG00001034146.
DR   EnsemblGenomes-Gn; EBG00001034147.
DR   EnsemblGenomes-Gn; EBG00001034148.
DR   EnsemblGenomes-Gn; EBG00001034149.
DR   EnsemblGenomes-Gn; EBG00001034150.
DR   EnsemblGenomes-Gn; EBG00001034151.
DR   EnsemblGenomes-Gn; EBG00001034152.
DR   EnsemblGenomes-Gn; EBG00001034153.
DR   EnsemblGenomes-Gn; EBG00001034154.
DR   EnsemblGenomes-Gn; EBG00001034155.
DR   EnsemblGenomes-Gn; EBG00001034156.
DR   EnsemblGenomes-Gn; EBG00001034157.
DR   EnsemblGenomes-Gn; EBG00001034158.
DR   EnsemblGenomes-Gn; EBG00001034159.
DR   EnsemblGenomes-Gn; EBG00001034160.
DR   EnsemblGenomes-Gn; EBG00001034161.
DR   EnsemblGenomes-Gn; EBG00001034162.
DR   EnsemblGenomes-Gn; EBG00001034163.
DR   EnsemblGenomes-Gn; EBG00001034164.
DR   EnsemblGenomes-Gn; EBG00001034165.
DR   EnsemblGenomes-Gn; EBG00001034166.
DR   EnsemblGenomes-Gn; EBG00001034167.
DR   EnsemblGenomes-Gn; EBG00001034168.
DR   EnsemblGenomes-Gn; EBG00001034169.
DR   EnsemblGenomes-Gn; EBG00001034170.
DR   EnsemblGenomes-Gn; EBG00001034171.
DR   EnsemblGenomes-Gn; EBG00001034172.
DR   EnsemblGenomes-Gn; EBG00001034173.
DR   EnsemblGenomes-Gn; EBG00001034174.
DR   EnsemblGenomes-Gn; EBG00001034175.
DR   EnsemblGenomes-Gn; EBG00001034176.
DR   EnsemblGenomes-Gn; EBG00001034177.
DR   EnsemblGenomes-Gn; EBG00001034178.
DR   EnsemblGenomes-Gn; EBG00001034179.
DR   EnsemblGenomes-Gn; EBG00001034180.
DR   EnsemblGenomes-Gn; EBG00001034181.
DR   EnsemblGenomes-Gn; EBG00001034182.
DR   EnsemblGenomes-Gn; EBG00001034183.
DR   EnsemblGenomes-Gn; EBG00001034184.
DR   EnsemblGenomes-Gn; EBG00001034185.
DR   EnsemblGenomes-Gn; EBG00001034186.
DR   EnsemblGenomes-Gn; EBG00001034187.
DR   EnsemblGenomes-Gn; EBG00001034188.
DR   EnsemblGenomes-Gn; EBG00001034189.
DR   EnsemblGenomes-Gn; EBG00001034190.
DR   EnsemblGenomes-Gn; EBG00001034191.
DR   EnsemblGenomes-Gn; EBG00001034192.
DR   EnsemblGenomes-Gn; EBG00001034193.
DR   EnsemblGenomes-Gn; EBG00001034194.
DR   EnsemblGenomes-Gn; EBG00001034195.
DR   EnsemblGenomes-Gn; EBG00001034196.
DR   EnsemblGenomes-Gn; EBG00001034197.
DR   EnsemblGenomes-Gn; EBG00001034198.
DR   EnsemblGenomes-Gn; EBG00001034199.
DR   EnsemblGenomes-Gn; EBG00001034200.
DR   EnsemblGenomes-Gn; EBG00001034201.
DR   EnsemblGenomes-Gn; EBG00001034202.
DR   EnsemblGenomes-Gn; EBG00001034203.
DR   EnsemblGenomes-Gn; UM146_r23989.
DR   EnsemblGenomes-Gn; UM146_r23991.
DR   EnsemblGenomes-Gn; UM146_r23993.
DR   EnsemblGenomes-Gn; UM146_r23995.
DR   EnsemblGenomes-Gn; UM146_r23997.
DR   EnsemblGenomes-Gn; UM146_r23999.
DR   EnsemblGenomes-Gn; UM146_r24001.
DR   EnsemblGenomes-Gn; UM146_r24003.
DR   EnsemblGenomes-Gn; UM146_r24005.
DR   EnsemblGenomes-Gn; UM146_r24007.
DR   EnsemblGenomes-Gn; UM146_r24009.
DR   EnsemblGenomes-Gn; UM146_r24011.
DR   EnsemblGenomes-Gn; UM146_r24013.
DR   EnsemblGenomes-Gn; UM146_r24015.
DR   EnsemblGenomes-Gn; UM146_r24017.
DR   EnsemblGenomes-Gn; UM146_r24019.
DR   EnsemblGenomes-Gn; UM146_r24021.
DR   EnsemblGenomes-Gn; UM146_r24023.
DR   EnsemblGenomes-Gn; UM146_r24025.
DR   EnsemblGenomes-Gn; UM146_r24027.
DR   EnsemblGenomes-Gn; UM146_r24029.
DR   EnsemblGenomes-Gn; UM146_r24031.
DR   EnsemblGenomes-Gn; UM146_t23817.
DR   EnsemblGenomes-Gn; UM146_t23819.
DR   EnsemblGenomes-Gn; UM146_t23821.
DR   EnsemblGenomes-Gn; UM146_t23823.
DR   EnsemblGenomes-Gn; UM146_t23825.
DR   EnsemblGenomes-Gn; UM146_t23827.
DR   EnsemblGenomes-Gn; UM146_t23829.
DR   EnsemblGenomes-Gn; UM146_t23831.
DR   EnsemblGenomes-Gn; UM146_t23833.
DR   EnsemblGenomes-Gn; UM146_t23835.
DR   EnsemblGenomes-Gn; UM146_t23837.
DR   EnsemblGenomes-Gn; UM146_t23839.
DR   EnsemblGenomes-Gn; UM146_t23841.
DR   EnsemblGenomes-Gn; UM146_t23843.
DR   EnsemblGenomes-Gn; UM146_t23845.
DR   EnsemblGenomes-Gn; UM146_t23847.
DR   EnsemblGenomes-Gn; UM146_t23849.
DR   EnsemblGenomes-Gn; UM146_t23851.
DR   EnsemblGenomes-Gn; UM146_t23853.
DR   EnsemblGenomes-Gn; UM146_t23855.
DR   EnsemblGenomes-Gn; UM146_t23857.
DR   EnsemblGenomes-Gn; UM146_t23859.
DR   EnsemblGenomes-Gn; UM146_t23861.
DR   EnsemblGenomes-Gn; UM146_t23863.
DR   EnsemblGenomes-Gn; UM146_t23865.
DR   EnsemblGenomes-Gn; UM146_t23867.
DR   EnsemblGenomes-Gn; UM146_t23869.
DR   EnsemblGenomes-Gn; UM146_t23871.
DR   EnsemblGenomes-Gn; UM146_t23873.
DR   EnsemblGenomes-Gn; UM146_t23875.
DR   EnsemblGenomes-Gn; UM146_t23877.
DR   EnsemblGenomes-Gn; UM146_t23879.
DR   EnsemblGenomes-Gn; UM146_t23881.
DR   EnsemblGenomes-Gn; UM146_t23883.
DR   EnsemblGenomes-Gn; UM146_t23885.
DR   EnsemblGenomes-Gn; UM146_t23887.
DR   EnsemblGenomes-Gn; UM146_t23889.
DR   EnsemblGenomes-Gn; UM146_t23891.
DR   EnsemblGenomes-Gn; UM146_t23893.
DR   EnsemblGenomes-Gn; UM146_t23895.
DR   EnsemblGenomes-Gn; UM146_t23897.
DR   EnsemblGenomes-Gn; UM146_t23899.
DR   EnsemblGenomes-Gn; UM146_t23901.
DR   EnsemblGenomes-Gn; UM146_t23903.
DR   EnsemblGenomes-Gn; UM146_t23905.
DR   EnsemblGenomes-Gn; UM146_t23907.
DR   EnsemblGenomes-Gn; UM146_t23909.
DR   EnsemblGenomes-Gn; UM146_t23911.
DR   EnsemblGenomes-Gn; UM146_t23913.
DR   EnsemblGenomes-Gn; UM146_t23915.
DR   EnsemblGenomes-Gn; UM146_t23917.
DR   EnsemblGenomes-Gn; UM146_t23919.
DR   EnsemblGenomes-Gn; UM146_t23921.
DR   EnsemblGenomes-Gn; UM146_t23923.
DR   EnsemblGenomes-Gn; UM146_t23925.
DR   EnsemblGenomes-Gn; UM146_t23927.
DR   EnsemblGenomes-Gn; UM146_t23929.
DR   EnsemblGenomes-Gn; UM146_t23931.
DR   EnsemblGenomes-Gn; UM146_t23933.
DR   EnsemblGenomes-Gn; UM146_t23935.
DR   EnsemblGenomes-Gn; UM146_t23937.
DR   EnsemblGenomes-Gn; UM146_t23939.
DR   EnsemblGenomes-Gn; UM146_t23941.
DR   EnsemblGenomes-Gn; UM146_t23943.
DR   EnsemblGenomes-Gn; UM146_t23945.
DR   EnsemblGenomes-Gn; UM146_t23947.
DR   EnsemblGenomes-Gn; UM146_t23949.
DR   EnsemblGenomes-Gn; UM146_t23951.
DR   EnsemblGenomes-Gn; UM146_t23953.
DR   EnsemblGenomes-Gn; UM146_t23955.
DR   EnsemblGenomes-Gn; UM146_t23957.
DR   EnsemblGenomes-Gn; UM146_t23959.
DR   EnsemblGenomes-Gn; UM146_t23961.
DR   EnsemblGenomes-Gn; UM146_t23963.
DR   EnsemblGenomes-Gn; UM146_t23965.
DR   EnsemblGenomes-Gn; UM146_t23967.
DR   EnsemblGenomes-Gn; UM146_t23969.
DR   EnsemblGenomes-Gn; UM146_t23971.
DR   EnsemblGenomes-Gn; UM146_t23973.
DR   EnsemblGenomes-Gn; UM146_t23975.
DR   EnsemblGenomes-Gn; UM146_t23977.
DR   EnsemblGenomes-Gn; UM146_t23979.
DR   EnsemblGenomes-Gn; UM146_t23981.
DR   EnsemblGenomes-Gn; UM146_t23983.
DR   EnsemblGenomes-Gn; UM146_t23985.
DR   EnsemblGenomes-Gn; UM146_t23987.
DR   EnsemblGenomes-Tr; EBT00001637169.
DR   EnsemblGenomes-Tr; EBT00001637170.
DR   EnsemblGenomes-Tr; EBT00001637171.
DR   EnsemblGenomes-Tr; EBT00001637172.
DR   EnsemblGenomes-Tr; EBT00001637173.
DR   EnsemblGenomes-Tr; EBT00001637174.
DR   EnsemblGenomes-Tr; EBT00001637175.
DR   EnsemblGenomes-Tr; EBT00001637176.
DR   EnsemblGenomes-Tr; EBT00001637177.
DR   EnsemblGenomes-Tr; EBT00001637178.
DR   EnsemblGenomes-Tr; EBT00001637179.
DR   EnsemblGenomes-Tr; EBT00001637180.
DR   EnsemblGenomes-Tr; EBT00001637181.
DR   EnsemblGenomes-Tr; EBT00001637182.
DR   EnsemblGenomes-Tr; EBT00001637183.
DR   EnsemblGenomes-Tr; EBT00001637184.
DR   EnsemblGenomes-Tr; EBT00001637185.
DR   EnsemblGenomes-Tr; EBT00001637186.
DR   EnsemblGenomes-Tr; EBT00001637187.
DR   EnsemblGenomes-Tr; EBT00001637188.
DR   EnsemblGenomes-Tr; EBT00001637189.
DR   EnsemblGenomes-Tr; EBT00001637190.
DR   EnsemblGenomes-Tr; EBT00001637191.
DR   EnsemblGenomes-Tr; EBT00001637192.
DR   EnsemblGenomes-Tr; EBT00001637193.
DR   EnsemblGenomes-Tr; EBT00001637194.
DR   EnsemblGenomes-Tr; EBT00001637195.
DR   EnsemblGenomes-Tr; EBT00001637196.
DR   EnsemblGenomes-Tr; EBT00001637197.
DR   EnsemblGenomes-Tr; EBT00001637198.
DR   EnsemblGenomes-Tr; EBT00001637199.
DR   EnsemblGenomes-Tr; EBT00001637200.
DR   EnsemblGenomes-Tr; EBT00001637201.
DR   EnsemblGenomes-Tr; EBT00001637202.
DR   EnsemblGenomes-Tr; EBT00001637203.
DR   EnsemblGenomes-Tr; EBT00001637204.
DR   EnsemblGenomes-Tr; EBT00001637205.
DR   EnsemblGenomes-Tr; EBT00001637206.
DR   EnsemblGenomes-Tr; EBT00001637207.
DR   EnsemblGenomes-Tr; EBT00001637208.
DR   EnsemblGenomes-Tr; EBT00001637209.
DR   EnsemblGenomes-Tr; EBT00001637210.
DR   EnsemblGenomes-Tr; EBT00001637211.
DR   EnsemblGenomes-Tr; EBT00001637212.
DR   EnsemblGenomes-Tr; EBT00001637213.
DR   EnsemblGenomes-Tr; EBT00001637214.
DR   EnsemblGenomes-Tr; EBT00001637215.
DR   EnsemblGenomes-Tr; EBT00001637216.
DR   EnsemblGenomes-Tr; EBT00001637217.
DR   EnsemblGenomes-Tr; EBT00001637218.
DR   EnsemblGenomes-Tr; EBT00001637219.
DR   EnsemblGenomes-Tr; EBT00001637220.
DR   EnsemblGenomes-Tr; EBT00001637221.
DR   EnsemblGenomes-Tr; EBT00001637222.
DR   EnsemblGenomes-Tr; EBT00001637223.
DR   EnsemblGenomes-Tr; EBT00001637224.
DR   EnsemblGenomes-Tr; EBT00001637225.
DR   EnsemblGenomes-Tr; EBT00001637226.
DR   EnsemblGenomes-Tr; EBT00001637227.
DR   EnsemblGenomes-Tr; EBT00001637228.
DR   EnsemblGenomes-Tr; EBT00001637229.
DR   EnsemblGenomes-Tr; EBT00001637230.
DR   EnsemblGenomes-Tr; EBT00001637231.
DR   EnsemblGenomes-Tr; EBT00001637232.
DR   EnsemblGenomes-Tr; EBT00001637233.
DR   EnsemblGenomes-Tr; EBT00001637234.
DR   EnsemblGenomes-Tr; EBT00001637235.
DR   EnsemblGenomes-Tr; EBT00001637236.
DR   EnsemblGenomes-Tr; EBT00001637237.
DR   EnsemblGenomes-Tr; EBT00001637238.
DR   EnsemblGenomes-Tr; EBT00001637239.
DR   EnsemblGenomes-Tr; EBT00001637240.
DR   EnsemblGenomes-Tr; EBT00001637241.
DR   EnsemblGenomes-Tr; EBT00001637242.
DR   EnsemblGenomes-Tr; EBT00001637243.
DR   EnsemblGenomes-Tr; EBT00001637244.
DR   EnsemblGenomes-Tr; EBT00001637245.
DR   EnsemblGenomes-Tr; EBT00001637246.
DR   EnsemblGenomes-Tr; EBT00001637247.
DR   EnsemblGenomes-Tr; EBT00001637248.
DR   EnsemblGenomes-Tr; EBT00001637249.
DR   EnsemblGenomes-Tr; EBT00001637250.
DR   EnsemblGenomes-Tr; EBT00001637251.
DR   EnsemblGenomes-Tr; EBT00001637252.
DR   EnsemblGenomes-Tr; EBT00001637253.
DR   EnsemblGenomes-Tr; EBT00001637254.
DR   EnsemblGenomes-Tr; EBT00001637255.
DR   EnsemblGenomes-Tr; EBT00001637256.
DR   EnsemblGenomes-Tr; EBT00001637257.
DR   EnsemblGenomes-Tr; EBT00001637258.
DR   EnsemblGenomes-Tr; EBT00001637259.
DR   EnsemblGenomes-Tr; EBT00001637260.
DR   EnsemblGenomes-Tr; EBT00001637261.
DR   EnsemblGenomes-Tr; EBT00001637262.
DR   EnsemblGenomes-Tr; EBT00001637263.
DR   EnsemblGenomes-Tr; EBT00001637264.
DR   EnsemblGenomes-Tr; EBT00001637265.
DR   EnsemblGenomes-Tr; EBT00001637266.
DR   EnsemblGenomes-Tr; EBT00001637267.
DR   EnsemblGenomes-Tr; EBT00001637268.
DR   EnsemblGenomes-Tr; EBT00001637269.
DR   EnsemblGenomes-Tr; EBT00001637270.
DR   EnsemblGenomes-Tr; EBT00001637271.
DR   EnsemblGenomes-Tr; EBT00001637272.
DR   EnsemblGenomes-Tr; EBT00001637273.
DR   EnsemblGenomes-Tr; EBT00001637274.
DR   EnsemblGenomes-Tr; EBT00001637275.
DR   EnsemblGenomes-Tr; EBT00001637276.
DR   EnsemblGenomes-Tr; EBT00001637277.
DR   EnsemblGenomes-Tr; EBT00001637278.
DR   EnsemblGenomes-Tr; EBT00001637279.
DR   EnsemblGenomes-Tr; EBT00001637280.
DR   EnsemblGenomes-Tr; EBT00001637281.
DR   EnsemblGenomes-Tr; EBT00001637282.
DR   EnsemblGenomes-Tr; EBT00001637283.
DR   EnsemblGenomes-Tr; EBT00001637284.
DR   EnsemblGenomes-Tr; EBT00001637285.
DR   EnsemblGenomes-Tr; EBT00001637286.
DR   EnsemblGenomes-Tr; EBT00001637287.
DR   EnsemblGenomes-Tr; EBT00001637288.
DR   EnsemblGenomes-Tr; EBT00001637289.
DR   EnsemblGenomes-Tr; EBT00001637290.
DR   EnsemblGenomes-Tr; EBT00001637291.
DR   EnsemblGenomes-Tr; EBT00001637292.
DR   EnsemblGenomes-Tr; EBT00001637293.
DR   EnsemblGenomes-Tr; EBT00001637294.
DR   EnsemblGenomes-Tr; EBT00001637295.
DR   EnsemblGenomes-Tr; EBT00001637296.
DR   EnsemblGenomes-Tr; EBT00001637297.
DR   EnsemblGenomes-Tr; EBT00001637298.
DR   EnsemblGenomes-Tr; EBT00001637299.
DR   EnsemblGenomes-Tr; EBT00001637300.
DR   EnsemblGenomes-Tr; EBT00001637301.
DR   EnsemblGenomes-Tr; EBT00001637302.
DR   EnsemblGenomes-Tr; EBT00001637303.
DR   EnsemblGenomes-Tr; EBT00001637304.
DR   EnsemblGenomes-Tr; EBT00001637305.
DR   EnsemblGenomes-Tr; EBT00001637306.
DR   EnsemblGenomes-Tr; EBT00001637307.
DR   EnsemblGenomes-Tr; EBT00001637308.
DR   EnsemblGenomes-Tr; EBT00001637309.
DR   EnsemblGenomes-Tr; EBT00001637310.
DR   EnsemblGenomes-Tr; EBT00001637312.
DR   EnsemblGenomes-Tr; EBT00001637313.
DR   EnsemblGenomes-Tr; EBT00001637315.
DR   EnsemblGenomes-Tr; EBT00001637317.
DR   EnsemblGenomes-Tr; EBT00001637318.
DR   EnsemblGenomes-Tr; EBT00001637320.
DR   EnsemblGenomes-Tr; EBT00001637322.
DR   EnsemblGenomes-Tr; EBT00001637323.
DR   EnsemblGenomes-Tr; EBT00001637324.
DR   EnsemblGenomes-Tr; EBT00001637325.
DR   EnsemblGenomes-Tr; EBT00001637327.
DR   EnsemblGenomes-Tr; EBT00001637328.
DR   EnsemblGenomes-Tr; EBT00001637329.
DR   EnsemblGenomes-Tr; EBT00001637331.
DR   EnsemblGenomes-Tr; EBT00001637332.
DR   EnsemblGenomes-Tr; EBT00001637333.
DR   EnsemblGenomes-Tr; EBT00001637335.
DR   EnsemblGenomes-Tr; EBT00001637336.
DR   EnsemblGenomes-Tr; EBT00001637337.
DR   EnsemblGenomes-Tr; EBT00001637338.
DR   EnsemblGenomes-Tr; EBT00001637339.
DR   EnsemblGenomes-Tr; EBT00001637340.
DR   EnsemblGenomes-Tr; EBT00001637341.
DR   EnsemblGenomes-Tr; EBT00001637343.
DR   EnsemblGenomes-Tr; EBT00001637344.
DR   EnsemblGenomes-Tr; EBT00001637345.
DR   EnsemblGenomes-Tr; EBT00001637347.
DR   EnsemblGenomes-Tr; EBT00001637348.
DR   EnsemblGenomes-Tr; EBT00001637350.
DR   EnsemblGenomes-Tr; EBT00001637351.
DR   EnsemblGenomes-Tr; EBT00001637353.
DR   EnsemblGenomes-Tr; EBT00001637354.
DR   EnsemblGenomes-Tr; EBT00001637355.
DR   EnsemblGenomes-Tr; EBT00001637357.
DR   EnsemblGenomes-Tr; EBT00001637358.
DR   EnsemblGenomes-Tr; EBT00001637359.
DR   EnsemblGenomes-Tr; EBT00001637361.
DR   EnsemblGenomes-Tr; EBT00001637362.
DR   EnsemblGenomes-Tr; EBT00001637364.
DR   EnsemblGenomes-Tr; EBT00001637365.
DR   EnsemblGenomes-Tr; EBT00001637367.
DR   EnsemblGenomes-Tr; EBT00001637368.
DR   EnsemblGenomes-Tr; EBT00001637370.
DR   EnsemblGenomes-Tr; EBT00001637371.
DR   EnsemblGenomes-Tr; EBT00001637373.
DR   EnsemblGenomes-Tr; EBT00001637374.
DR   EnsemblGenomes-Tr; EBT00001637376.
DR   EnsemblGenomes-Tr; EBT00001637378.
DR   EnsemblGenomes-Tr; EBT00001637380.
DR   EnsemblGenomes-Tr; EBT00001637382.
DR   EnsemblGenomes-Tr; EBT00001637383.
DR   EnsemblGenomes-Tr; EBT00001637385.
DR   EnsemblGenomes-Tr; EBT00001637387.
DR   EnsemblGenomes-Tr; EBT00001637388.
DR   EnsemblGenomes-Tr; EBT00001637390.
DR   EnsemblGenomes-Tr; EBT00001637391.
DR   EnsemblGenomes-Tr; EBT00001637392.
DR   EnsemblGenomes-Tr; EBT00001637394.
DR   EnsemblGenomes-Tr; EBT00001637395.
DR   EnsemblGenomes-Tr; EBT00001637396.
DR   EnsemblGenomes-Tr; EBT00001637397.
DR   EnsemblGenomes-Tr; EBT00001637399.
DR   EnsemblGenomes-Tr; EBT00001637400.
DR   EnsemblGenomes-Tr; EBT00001637402.
DR   EnsemblGenomes-Tr; EBT00001637403.
DR   EnsemblGenomes-Tr; EBT00001637404.
DR   EnsemblGenomes-Tr; EBT00001637406.
DR   EnsemblGenomes-Tr; EBT00001637407.
DR   EnsemblGenomes-Tr; EBT00001637409.
DR   EnsemblGenomes-Tr; EBT00001637410.
DR   EnsemblGenomes-Tr; EBT00001637412.
DR   EnsemblGenomes-Tr; EBT00001637413.
DR   EnsemblGenomes-Tr; EBT00001637415.
DR   EnsemblGenomes-Tr; EBT00001637416.
DR   EnsemblGenomes-Tr; EBT00001637417.
DR   EnsemblGenomes-Tr; EBT00001637419.
DR   EnsemblGenomes-Tr; EBT00001637420.
DR   EnsemblGenomes-Tr; EBT00001637422.
DR   EnsemblGenomes-Tr; EBT00001637424.
DR   EnsemblGenomes-Tr; EBT00001637425.
DR   EnsemblGenomes-Tr; EBT00001637426.
DR   EnsemblGenomes-Tr; EBT00001637428.
DR   EnsemblGenomes-Tr; EBT00001637429.
DR   EnsemblGenomes-Tr; EBT00001637431.
DR   EnsemblGenomes-Tr; EBT00001637432.
DR   EnsemblGenomes-Tr; EBT00001637434.
DR   EnsemblGenomes-Tr; EBT00001637435.
DR   EnsemblGenomes-Tr; EBT00001637436.
DR   EnsemblGenomes-Tr; UM146_r23989-1.
DR   EnsemblGenomes-Tr; UM146_r23991-1.
DR   EnsemblGenomes-Tr; UM146_r23993-1.
DR   EnsemblGenomes-Tr; UM146_r23995-1.
DR   EnsemblGenomes-Tr; UM146_r23997-1.
DR   EnsemblGenomes-Tr; UM146_r23999-1.
DR   EnsemblGenomes-Tr; UM146_r24001-1.
DR   EnsemblGenomes-Tr; UM146_r24003-1.
DR   EnsemblGenomes-Tr; UM146_r24005-1.
DR   EnsemblGenomes-Tr; UM146_r24007-1.
DR   EnsemblGenomes-Tr; UM146_r24009-1.
DR   EnsemblGenomes-Tr; UM146_r24011-1.
DR   EnsemblGenomes-Tr; UM146_r24013-1.
DR   EnsemblGenomes-Tr; UM146_r24015-1.
DR   EnsemblGenomes-Tr; UM146_r24017-1.
DR   EnsemblGenomes-Tr; UM146_r24019-1.
DR   EnsemblGenomes-Tr; UM146_r24021-1.
DR   EnsemblGenomes-Tr; UM146_r24023-1.
DR   EnsemblGenomes-Tr; UM146_r24025-1.
DR   EnsemblGenomes-Tr; UM146_r24027-1.
DR   EnsemblGenomes-Tr; UM146_r24029-1.
DR   EnsemblGenomes-Tr; UM146_r24031-1.
DR   EnsemblGenomes-Tr; UM146_t23817-1.
DR   EnsemblGenomes-Tr; UM146_t23819-1.
DR   EnsemblGenomes-Tr; UM146_t23821-1.
DR   EnsemblGenomes-Tr; UM146_t23823-1.
DR   EnsemblGenomes-Tr; UM146_t23825-1.
DR   EnsemblGenomes-Tr; UM146_t23827-1.
DR   EnsemblGenomes-Tr; UM146_t23829-1.
DR   EnsemblGenomes-Tr; UM146_t23831-1.
DR   EnsemblGenomes-Tr; UM146_t23833-1.
DR   EnsemblGenomes-Tr; UM146_t23835-1.
DR   EnsemblGenomes-Tr; UM146_t23837-1.
DR   EnsemblGenomes-Tr; UM146_t23839-1.
DR   EnsemblGenomes-Tr; UM146_t23841-1.
DR   EnsemblGenomes-Tr; UM146_t23843-1.
DR   EnsemblGenomes-Tr; UM146_t23845-1.
DR   EnsemblGenomes-Tr; UM146_t23847-1.
DR   EnsemblGenomes-Tr; UM146_t23849-1.
DR   EnsemblGenomes-Tr; UM146_t23851-1.
DR   EnsemblGenomes-Tr; UM146_t23853-1.
DR   EnsemblGenomes-Tr; UM146_t23855-1.
DR   EnsemblGenomes-Tr; UM146_t23857-1.
DR   EnsemblGenomes-Tr; UM146_t23859-1.
DR   EnsemblGenomes-Tr; UM146_t23861-1.
DR   EnsemblGenomes-Tr; UM146_t23863-1.
DR   EnsemblGenomes-Tr; UM146_t23865-1.
DR   EnsemblGenomes-Tr; UM146_t23867-1.
DR   EnsemblGenomes-Tr; UM146_t23869-1.
DR   EnsemblGenomes-Tr; UM146_t23871-1.
DR   EnsemblGenomes-Tr; UM146_t23873-1.
DR   EnsemblGenomes-Tr; UM146_t23875-1.
DR   EnsemblGenomes-Tr; UM146_t23877-1.
DR   EnsemblGenomes-Tr; UM146_t23879-1.
DR   EnsemblGenomes-Tr; UM146_t23881-1.
DR   EnsemblGenomes-Tr; UM146_t23883-1.
DR   EnsemblGenomes-Tr; UM146_t23885-1.
DR   EnsemblGenomes-Tr; UM146_t23887-1.
DR   EnsemblGenomes-Tr; UM146_t23889-1.
DR   EnsemblGenomes-Tr; UM146_t23891-1.
DR   EnsemblGenomes-Tr; UM146_t23893-1.
DR   EnsemblGenomes-Tr; UM146_t23895-1.
DR   EnsemblGenomes-Tr; UM146_t23897-1.
DR   EnsemblGenomes-Tr; UM146_t23899-1.
DR   EnsemblGenomes-Tr; UM146_t23901-1.
DR   EnsemblGenomes-Tr; UM146_t23903-1.
DR   EnsemblGenomes-Tr; UM146_t23905-1.
DR   EnsemblGenomes-Tr; UM146_t23907-1.
DR   EnsemblGenomes-Tr; UM146_t23909-1.
DR   EnsemblGenomes-Tr; UM146_t23911-1.
DR   EnsemblGenomes-Tr; UM146_t23913-1.
DR   EnsemblGenomes-Tr; UM146_t23915-1.
DR   EnsemblGenomes-Tr; UM146_t23917-1.
DR   EnsemblGenomes-Tr; UM146_t23919-1.
DR   EnsemblGenomes-Tr; UM146_t23921-1.
DR   EnsemblGenomes-Tr; UM146_t23923-1.
DR   EnsemblGenomes-Tr; UM146_t23925-1.
DR   EnsemblGenomes-Tr; UM146_t23927-1.
DR   EnsemblGenomes-Tr; UM146_t23929-1.
DR   EnsemblGenomes-Tr; UM146_t23931-1.
DR   EnsemblGenomes-Tr; UM146_t23933-1.
DR   EnsemblGenomes-Tr; UM146_t23935-1.
DR   EnsemblGenomes-Tr; UM146_t23937-1.
DR   EnsemblGenomes-Tr; UM146_t23939-1.
DR   EnsemblGenomes-Tr; UM146_t23941-1.
DR   EnsemblGenomes-Tr; UM146_t23943-1.
DR   EnsemblGenomes-Tr; UM146_t23945-1.
DR   EnsemblGenomes-Tr; UM146_t23947-1.
DR   EnsemblGenomes-Tr; UM146_t23949-1.
DR   EnsemblGenomes-Tr; UM146_t23951-1.
DR   EnsemblGenomes-Tr; UM146_t23953-1.
DR   EnsemblGenomes-Tr; UM146_t23955-1.
DR   EnsemblGenomes-Tr; UM146_t23957-1.
DR   EnsemblGenomes-Tr; UM146_t23959-1.
DR   EnsemblGenomes-Tr; UM146_t23961-1.
DR   EnsemblGenomes-Tr; UM146_t23963-1.
DR   EnsemblGenomes-Tr; UM146_t23965-1.
DR   EnsemblGenomes-Tr; UM146_t23967-1.
DR   EnsemblGenomes-Tr; UM146_t23969-1.
DR   EnsemblGenomes-Tr; UM146_t23971-1.
DR   EnsemblGenomes-Tr; UM146_t23973-1.
DR   EnsemblGenomes-Tr; UM146_t23975-1.
DR   EnsemblGenomes-Tr; UM146_t23977-1.
DR   EnsemblGenomes-Tr; UM146_t23979-1.
DR   EnsemblGenomes-Tr; UM146_t23981-1.
DR   EnsemblGenomes-Tr; UM146_t23983-1.
DR   EnsemblGenomes-Tr; UM146_t23985-1.
DR   EnsemblGenomes-Tr; UM146_t23987-1.
DR   EuropePMC; PMC3019814; 21075930.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3811367; 23872574.
DR   EuropePMC; PMC4192283; 25269819.
DR   EuropePMC; PMC4325821; 25583718.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4568875; 26413073.
DR   EuropePMC; PMC5930371; 29523546.
DR   EuropePMC; PMC6180223; 30305321.
DR   EuropePMC; PMC6385356; 30796316.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00117; C0719.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00262; sar.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP002167.
DR   SILVA-SSU; CP002167.
XX
CC   To obtain a sample of UM146 E coli isolate please contact Denis
CC   Krause, denis_krause@umanitoba.ca
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group. Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4993013
FT                   /organism="Escherichia coli UM146"
FT                   /strain="UM146"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:869729"
FT   misc_feature    91..629
FT                   /note="potential RNA of insufficient length (23S ribosomal
FT                   RNA)"
FT   gene            869..984
FT                   /locus_tag="UM146_r23989"
FT   rRNA            869..984
FT                   /locus_tag="UM146_r23989"
FT                   /product="5S ribosomal RNA"
FT   gene            999..1074
FT                   /locus_tag="UM146_t23817"
FT   tRNA            999..1074
FT                   /locus_tag="UM146_t23817"
FT                   /product="tRNA-Thr"
FT   gene            1114..1229
FT                   /locus_tag="UM146_r23991"
FT   rRNA            1114..1229
FT                   /locus_tag="UM146_r23991"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(1292..2050)
FT                   /locus_tag="UM146_00005"
FT   CDS_pept        complement(1292..2050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00005"
FT                   /product="amino-acid transporter subunit ; ATP-binding
FT                   component of ABC superfamily protein"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69432"
FT                   /protein_id="ADN69432.1"
FT                   /translation="MSQILLQPANAMITLENVNKWYGQFHVLKNINLIVQPGERIVLCG
FT                   PSGSGKSTTIRCINHLEEHQQGRIVVDGIELNEDIRNIERVRQEVGMVFQHFNLFPHLT
FT                   VLQNCTLAPIWVRKMPKKEAEALAMHYLERVRIAEHAQKFPGQISGGQQQRVAIARSLC
FT                   MKPKIMLFDEPTSALDPEMVKEVLDTMIGLAQSGMTMLCVTHEMGFARTVADRVIFMDR
FT                   GEIVEQAAPNEFFAHPKSERTRTFLSQVIH"
FT   gene            complement(2058..3161)
FT                   /locus_tag="UM146_00010"
FT   CDS_pept        complement(2058..3161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00010"
FT                   /product="putative transport system permease protein"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69433"
FT                   /protein_id="ADN69433.1"
FT                   /translation="MTKVLLSHPPRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLM
FT                   WELIPPLLNWVFLQANWVGSTRADCTKSGACWVFIHERFGQFMYGLYPHDQRWRINLAL
FT                   LIGLVSIAPMFWKILPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTL
FT                   IIASVGIAGALPWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFM
FT                   AEGTSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIL
FT                   PQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLGMSTEGYVFAAL
FT                   IYWIFCFSMSRYSQHLEKRFNTGRTPH"
FT   gene            complement(3171..4352)
FT                   /locus_tag="UM146_00015"
FT   CDS_pept        complement(3171..4352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00015"
FT                   /product="amino-acid transporter subunit ; membrane
FT                   component of ABC superfamily protein"
FT                   /note="COG4597 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69434"
FT                   /protein_id="ADN69434.1"
FT                   /translation="MSHRRSTVKGSLSFANPTVRAWLFQILAVVAVVGIIGWLFHNTVT
FT                   NLSNRGITSGFAFLDRGAGFGIVQHLIDYQQGDTYGRVFIVGLLNTLLVSALCIVFASV
FT                   LGFFIGLARLSDNWLLRKLSTIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQAVSALDL
FT                   VFLSNRGLYIPSPQLGDGFLAFILAVVIAIVLSVGLFRFNKTHQIKTGQLRRTWPIAAV
FT                   LIIGLPLLAQWLFGAALHWDVPALRGFNFRGGMVLIPELAALTLALSIYTSAFIAEIIR
FT                   AGIQAVPYGQHEAARSLGLPNPVTLRRVIIPQALRVIIPPLTSQYLNIVKNSSLAAAIG
FT                   YPDMVSLFAGTVLNQTGQAIETIAMTMSVYLIISLTISLLMNIYNRRIAIVER"
FT   gene            complement(4420..5445)
FT                   /locus_tag="UM146_00020"
FT   CDS_pept        complement(4420..5445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00020"
FT                   /product="predicted periplasmic binding transport protein;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69435"
FT                   /protein_id="ADN69435.1"
FT                   /translation="MKKMMIATLAAASVLLAVANQAHAGATLDAVQKKGFVQCGISDGL
FT                   PGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSGEVDLLSRN
FT                   TTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTDTELNVAD
FT                   YFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVI
FT                   SKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAHLLGKE
FT                   GDYGKDLKLDNKWAFNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPV
FT                   R"
FT   gene            complement(5876..6097)
FT                   /locus_tag="UM146_00025"
FT   CDS_pept        complement(5876..6097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69436"
FT                   /protein_id="ADN69436.1"
FT                   /translation="MKRLIPVTLLTALLAGCAHDSPCVPVYDDQGRLVHTNTCMKGTTQ
FT                   DNWETAGAIAGGAAAVAGLTMGIIALSK"
FT   gene            6203..6328
FT                   /locus_tag="UM146_00030"
FT   CDS_pept        6203..6328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69437"
FT                   /protein_id="ADN69437.1"
FT                   /translation="MTIYVNCKNSEGSGNYRKFLKSEKKNILLIFMGFTENKKGA"
FT   gene            complement(6350..9454)
FT                   /locus_tag="UM146_00035"
FT   CDS_pept        complement(6350..9454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00035"
FT                   /product="multidrug efflux system protein"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69438"
FT                   /protein_id="ADN69438.1"
FT                   /translation="MANFFIRRPIFAWVLAIILMMAGALAILQLPVAQYPTIAPPAVSV
FT                   SANYPGADAQTVQDTVTQVIEQNMNGIDNLMYMSSTSDSAGSVTITLTFQSGTDPDIAQ
FT                   VQVQNKLQLATPLLPQEVQQQGISVEKSSSSYLMVAGFVSDNPGTTQDDISDYVASNVK
FT                   DTLSRLNGVGDVQLFGAQYAMRIWLDADLLNKYKLTPVDVINQLKVQNDQIAAGQLGGT
FT                   PALPGQQLNASIIAQTRLKNPEEFGKVTLRVNSDGSVVRLKDVARVELGGENYNVIARI
FT                   NGKPAAGLGIKLATGANALDTAKAIKAKLAELQPFFPQGMKVLYPYDTTPFVQLSIQEV
FT                   VKTLFEAIMLVFLVMYLFLQNMRATLIPTIAVPVVLLGTFAILAAFGYSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMMEDKLPPREATEKSMSQIQGALVGIAMVLSAVFIPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATLLKPVSAEHHENKGGFFGWFNT
FT                   TFDHSVNHYTNSVGKILGSTGRYLLIYALIVAGMVVLFLRLPSSFLPEEDQGVFLTMIQ
FT                   LPAGATQERTQKVLDQVTDYYLKNEKANVESVFTVNGFSFSGQAQNAGMAFVSLKPWEE
FT                   RSGDENSAEAVIHRAKMELGKIRDGFVIPFNMPAIVELGTATGFDFELIDQAGLGHDAL
FT                   TQARNQLLGMAAQHPASLVSVRPNGLEDTAQFKLEVDQEKAQALGVSLSDINQTISTAL
FT                   GGTYVNDFIDRGRVKKVYVQADAKFRMLPEDVDKLYVRSANGEMVPFSAFTTSHWVYGS
FT                   PRLERYNGLPSMEIQGEAAPGTSSGDAMALMENLASKLPAGIGYDWTGMSYQERLSGNQ
FT                   APALVAISFVVVFLCLAALYESWSIPVSVMLVVPLGIVGVLLAATLFNQKNDVYFMVGL
FT                   LTTIGLSAKNAILIVEFAKDLMEKEGKGVVEATLMAVRMRLRPILMTSLAFILGVLPLA
FT                   ISNGAGSGAQNAVGIGVMGGMVSATLLAIFFVPVFFVVIRRCFKG"
FT   gene            complement(9466..10623)
FT                   /locus_tag="UM146_00040"
FT   CDS_pept        complement(9466..10623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00040"
FT                   /product="cytoplasmic membrane lipoprotein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69439"
FT                   /protein_id="ADN69439.1"
FT                   /translation="MTKHARFFLLPSFILISAALIAGCNDKGEEKAHVGEPQVTVHIVK
FT                   TAPLEVKTELPGRTNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQASY
FT                   DSAKGELAKSEAAAAIAHLTVKRYVPLVGTKYISQQEYDQAIADARQADAAVIAAKATV
FT                   ESARINLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDF
FT                   MRLKQSVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPN
FT                   PQHTLLPGMFVRARIDEGVQPDAILIPQQGVSRTPRGDATVLIVNNKSQVEARPVVASQ
FT                   AIGDKWLISEGLKSGDQVIVSGLQKARPGEQVKATTDTPADTASK"
FT   gene            11025..11687
FT                   /locus_tag="UM146_00045"
FT   CDS_pept        11025..11687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00045"
FT                   /product="DNA-binding transcriptional regulator EnvR"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69440"
FT                   /protein_id="ADN69440.1"
FT                   /translation="MAKRTKAEALKTRQELIETAIAQFAQHGVSKTTLNDIADAANVTR
FT                   GAIYWHFENKTQLFNEMWLQQPSLRELIQDHLTAGLEHDPFQQLREKLIVGLQYIAKIP
FT                   RQQALLKILYHKCEFNDEMLAEGVIREKMGFNPQTLREVLQACQQQGCVANNLDLDVVM
FT                   IIIDGAFSGIVQNWLMNMAGYDLYKQAPALVDNVLRMFMPDENITKLIHKTNELSVI"
FT   gene            complement(11690..11869)
FT                   /locus_tag="UM146_00050"
FT   CDS_pept        complement(11690..11869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69441"
FT                   /protein_id="ADN69441.1"
FT                   /translation="MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPL
FT                   KLVNCDELNFQDRM"
FT   gene            complement(11953..12837)
FT                   /locus_tag="UM146_00055"
FT   CDS_pept        complement(11953..12837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00055"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="COG0863 DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69442"
FT                   /protein_id="ADN69442.1"
FT                   /translation="MRTGCEPTRFGNEAKTIIQGDALTELKKLPAESVDLIFADPPYNI
FT                   GKNFDGLIEAWKEDLFIDWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKLFTI
FT                   KSRIVWSYDSSGVQAKKHYGSMYEPILMMVKDAKNYTFNGDAILVEAKTGSQRALINYR
FT                   KNPPQPYNHQKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPF
FT                   AGSFTTGAVAVASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNLSKR
FT                   SRLSEVDPDLIAK"
FT   gene            complement(12925..13221)
FT                   /gene="fis"
FT                   /locus_tag="UM146_00060"
FT   CDS_pept        complement(12925..13221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="UM146_00060"
FT                   /product="DNA-binding protein Fis"
FT                   /note="COG2901 Factor for inversion stimulation Fis,
FT                   transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69443"
FT                   /protein_id="ADN69443.1"
FT                   /translation="MFEQRVNSDVLTVSTVNSQDQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   gene            complement(13247..14092)
FT                   /locus_tag="UM146_00065"
FT   CDS_pept        complement(13247..14092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00065"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /note="COG0042 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69444"
FT                   /protein_id="ADN69444.1"
FT                   /translation="MMSSNPQVWESDKSRLRMVHIDEPGIRTVQIAGSDPKEMADAARI
FT                   NVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKIRTGW
FT                   APEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDI
FT                   TDPLKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAH
FT                   VRELHDFYGPAKGYRIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENFA
FT                   "
FT   gene            complement(14541..15422)
FT                   /gene="prmA"
FT                   /locus_tag="UM146_00070"
FT   CDS_pept        complement(14541..15422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="UM146_00070"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2264 Ribosomal protein L11 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69445"
FT                   /protein_id="ADN69445.1"
FT                   /translation="MPWIQLKLNTTGANAEDLSDALMEAGAVSITFQDTHDTPVFEPLP
FT                   GETRLWGDTDVIGLFDAETDMNDVVAILENHPLLGAGFAHKIEQLEDKDWEREWMDNFH
FT                   PMRFGERLWICPSWRDVPDENAVNVMLDPGLAFGTGTHPTTSLCLQWLDSLDLTGKTVI
FT                   DFGCGSGILAIAALKLGAAKAIGIDIDPQAIQASRDNAERNGVSDRLELYLPKDQPEEM
FT                   KADVVVANILAGPLRELAPLISVLPVSGGLLGLSGILASQAESVCEAYADSFALDPVVE
FT                   KEEWCRITGRKN"
FT   gene            complement(15434..16885)
FT                   /gene="panF"
FT                   /locus_tag="UM146_00075"
FT   CDS_pept        complement(15434..16885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panF"
FT                   /locus_tag="UM146_00075"
FT                   /product="sodium/panthothenate symporter"
FT                   /note="COG4145 Na+/panthothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69446"
FT                   /protein_id="ADN69446.1"
FT                   /translation="MQLEVILPLVAYLVVVFGISVYAMRKRSTGTFLNEYFLGSRSMGG
FT                   IVLAMTLTATYISASSFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGILGKKFAILARR
FT                   YNAVTLNDMLFARYQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYETGLL
FT                   IFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVDTLQTIDP
FT                   QLVTPQGADDILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVA
FT                   ILMFGMHLAGALGRAVIPDLTVPDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQL
FT                   LQSSATIIKDLYLNIRPDQMQNETRLKRMSAVITLVLGALLLLAAWKPPEMIIWLNLLA
FT                   FGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLAKLNIQYLGFHPIVPSLLL
FT                   SLLAFLVGNRFGTSVPQATVLTTDK"
FT   gene            complement(16875..17117)
FT                   /locus_tag="UM146_00080"
FT   CDS_pept        complement(16875..17117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00080"
FT                   /product="hypothetical protein"
FT                   /note="COG3924 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69447"
FT                   /protein_id="ADN69447.1"
FT                   /translation="MDTRFVQAHKEARWALGLTLLYLAVWLVAAYLPGVAPGFTGFPRW
FT                   FEMACILTPLLFIGLCWAMVKFIYRDIPLEDDDAA"
FT   gene            complement(17210..18166)
FT                   /locus_tag="UM146_00085"
FT   CDS_pept        complement(17210..18166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00085"
FT                   /product="ribokinase family sugar kinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69448"
FT                   /protein_id="ADN69448.1"
FT                   /translation="MTITICAMGELLAEFLSRNPHQKFTQPGEFIGPFPSGAPAIFAAQ
FT                   VAKLSHRAIFFGCVGNDDFARLIIERLRHEGVITDGIHVMNNAVTGTAFVSYQNPQQRD
FT                   FVFNIPNSACGLFTAEHIDKDLLKQCNHLHIVGSSLFSFRMIDVMRKAITTIKSAGGTV
FT                   SFDPNIRKEMLSIPEMAQALDYLIEYTDIFIPSESELPFFARHKNLSEEQIVSDLLHGG
FT                   VKHVAIKRAQRGASYYKLKNGTLHAQHVAGHDIEIIDPTGAGDCFGATFITLFLSGFPA
FT                   HKALQYANASGALAVMRQGPMEGISSLADIEDFLQQH"
FT   gene            complement(18177..19007)
FT                   /locus_tag="UM146_00090"
FT   CDS_pept        complement(18177..19007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00090"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69449"
FT                   /protein_id="ADN69449.1"
FT                   /translation="MKSVNVPRKSSNLLKRRLKIAEIVAAQGEIKVDDLSAQLGVSGVT
FT                   IRGDLSYLEQQGYLKRSFGGAIATPLSSEPEAIQPIAPLSLAQQMEIARHCARLIRDRD
FT                   TLFLGHGTICRKIIPLLSEVKKLRLITNDPEHALLANQFIDGEIILAGSEMLRPDTALA
FT                   GKPLEQALQHFTITHSILEISHLDADGTLNINVPRLAAAWQLCFDHAQNKTVIVAADPA
FT                   PSTAAIGHLHQAENVIVSRSINEQYQQQLQSADFVILYTSNECFTWSNRERLQE"
FT   gene            19348..20202
FT                   /gene="gatY"
FT                   /locus_tag="UM146_00095"
FT   CDS_pept        19348..20202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatY"
FT                   /locus_tag="UM146_00095"
FT                   /product="tagatose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.2"
FT                   /note="COG0191 Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69450"
FT                   /protein_id="ADN69450.1"
FT                   /translation="MYIISSKNMLKKAQSEGYAVPAFNIHNLETLQVVVESAAQLRSPV
FT                   MLAGTPGTYRYGGVGSLISLVQSLAREYNLPLVLHLDHHEESDDIFNKVRAGIRSVMID
FT                   GSHLPFEDNIARVQEVTTFCHRFDVSVEAELGRLGGQEDDLRVDEKDSAYTSPAAAAEF
FT                   VQRTQIDSLAVAIGTAHGLYAHEPRLDFVRLEQIRQRVEIPLVLHGASGLSEQDVQHCI
FT                   RRGICKVNVATELKIAFADALKGYFYNNPAANDPRHYMQPAKAAMKEVVIRIIGVCGSE
FT                   GKI"
FT   gene            20238..21128
FT                   /locus_tag="UM146_00100"
FT   CDS_pept        20238..21128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00100"
FT                   /product="putative ABC-type sugar transport system,
FT                   periplasmic component"
FT                   /note="COG1879 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69451"
FT                   /protein_id="ADN69451.1"
FT                   /translation="MKNIKLLGSAMLVSLALFSQSSLAKEYKIGASLLTQQHPFYIDLA
FT                   NAMKEEAKKDNVNLSVSIANQDLNKQLSDVEDFITKKVDAIIVSPVDSKGVQAAIIKAD
FT                   KAGIPVITVDVAAEGVPVVSHVATDNYAGGVEAGKLMGKLLHGKGTVAIISYPALQSVV
FT                   ARVDGFKKGLSDTPDIKIVAEQPGITRAEALTTAQNIMQANANLNGLFGFGDDAALAAV
FT                   IAAKSAHNDNIKIIGFDGMKEACDAVDSEKTFAAVIRQYPDQMGAKAIDAAVDHLNGKP
FT                   VEKMIPVQPGVYTGK"
FT   gene            21189..22688
FT                   /locus_tag="UM146_00105"
FT   CDS_pept        21189..22688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00105"
FT                   /product="putative ribose transport ATP-binding protein
FT                   RbsA"
FT                   /note="COG1129 ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69452"
FT                   /protein_id="ADN69452.1"
FT                   /translation="MTDVILDVSHIAKTFGHVQALKDITLSLRKGRVHTLLGENGAGKS
FT                   TLMKILAGVYPPTQGTITLRGETITINNPQHSRQLGIAIIFQELSLSNNMTVAENIYAN
FT                   NEPRRFGIINDKKMLADCQNLLADLGIPLDPLEMVGNMSMAHRQLVEIAKALSYAADVV
FT                   IMDEPTSSLSDNEAEILFNIIEKLKQRGCAVIYISHRMDEIMRISDDISVIRDGEYIAT
FT                   HEKKNSDIQHLIAQMVGREMKNIWPARLGEKPDENVPAKLEVKNLSHPSLFKEVSFAVR
FT                   PGEVLGFFGLVGAGRSDVMKALFGLVSYHGTVLIDGKEVRIANPKQAIDHGIAFVTENR
FT                   KEEGLVLMHDVNMNTHHVAFQYNASRMGLINHRQEEAKTLQSIARMNTKVSSVHQAVGA
FT                   LSGGNQQKIVLSKWLEKTPRILLLDEPTRGVDVGAKFEIYNVIRQLAAAGTAIILVSSE
FT                   LPEVMALSDRLVVMRNKTIADIYSCENLTQIQVMTAATGVR"
FT   gene            22689..23678
FT                   /locus_tag="UM146_00110"
FT   CDS_pept        22689..23678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00110"
FT                   /product="putative sugar transporter subunit: membrane
FT                   component of ABC superfamily protein"
FT                   /note="COG1172 Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69453"
FT                   /protein_id="ADN69453.1"
FT                   /translation="MTEKTLASPKPSEIPIANNFKKVFRQYGGILSGMVVLIILFSFIN
FT                   DSFFTANNITNIILQVSIIAITAYGMTYVLLLGDIDLSVGSTIALIGTFAALGASWGIP
FT                   FVLLVPLSIIAALTLGMINGGLTAIAGIPSFIVTVATMGIFRGIAYIVTDGMPIMIKDD
FT                   AFLALGNGEFLYIPIPIWILIILLLINHFILTKTTFGRKIYITGGNKEAAIYSGINVTR
FT                   LKIKVFMITAVLAGISGMILASRLYSGQPNSALSYELDAIAAAVLGGTSLNGGYGTVVG
FT                   TVIGALTIGVINNGMNLMNVPYFYQMVVKGLVILVAVYFDVRNKRKRS"
FT   misc_feature    23700..24661
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|260870001|ref|YP_003236403.1| possible sugar kinase"
FT   gene            24658..25704
FT                   /locus_tag="UM146_00125"
FT   CDS_pept        24658..25704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69454"
FT                   /protein_id="ADN69454.1"
FT                   /translation="MKNEIWSWIGDLSQVAGIKHYELRSGRAKGTEAFDVRTGAGLAFT
FT                   VVKDRALDIAWASYKDTALSFITPNGVVAPAFFESQGNGFLRSFYAGLLTTCGLSYIGT
FT                   PCEDEGETLGLHGRLAATPAEEVGYRTERTDDSIEFVINGKVRETRLFGENLTLERTIR
FT                   CRYGENVMRIEDKVTNHGFTRQPLQILYHFNYGWPLLSPQAEILLSAKSITPRTPHAAE
FT                   GLASHLEICTPQPGFDEQVYYLTLNSDSQGMSKVALVNAELGWGIYEKFDTMQLPNFIQ
FT                   WKNLGAGEYVMGLEVSNSFPDGRDKERAQGRLPFIEPGETKTYCFELGIVDGDAEISAL
FT                   KAEIASYR"
FT   gene            complement(25796..27145)
FT                   /locus_tag="UM146_00130"
FT   CDS_pept        complement(25796..27145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00130"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69455"
FT                   /protein_id="ADN69455.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLA
FT                   DETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIG
FT                   PKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGG
FT                   GGGRGMRVVRSDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNA
FT                   IYLAERDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFEN
FT                   GEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRIN
FT                   AEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAI
FT                   ARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLEKKLGLQEK"
FT   gene            complement(27156..27626)
FT                   /locus_tag="UM146_00135"
FT   CDS_pept        complement(27156..27626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00135"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0511 Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69456"
FT                   /protein_id="ADN69456.1"
FT                   /translation="MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQ
FT                   QAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIE
FT                   VGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE"
FT   gene            complement(28031..28195)
FT                   /locus_tag="UM146_00140"
FT   CDS_pept        complement(28031..28195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00140"
FT                   /product="hypothetical protein"
FT                   /note="COG2717 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69457"
FT                   /protein_id="ADN69457.1"
FT                   /translation="MGNPQQPLRNVVYLVAILASLHYLWSVKIISLQPPIFAGLALQLF
FT                   TLRYKKFRR"
FT   gene            complement(28604..29578)
FT                   /locus_tag="UM146_00145"
FT   CDS_pept        complement(28604..29578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00145"
FT                   /product="putative oxidoreductase, Zn-dependent and
FT                   NAD(P)-binding protein"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69458"
FT                   /protein_id="ADN69458.1"
FT                   /translation="MQALLLEQQDGKTLASVQTLDESRQPEGDVTVDVHWSSLNYKDAL
FT                   AITGKGKIIRNFPMIPGIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARV
FT                   KGDWLVAMPQGLDARKAMIIGTAGFTAMLCVMALEDAGVRPQDGEIVVTGASGGVGSTA
FT                   VALLHKLGYQVVAVSGRESTHEYLKSLGASRILPRDEFAESRPLEKQVWAGAIDTVGDK
FT                   VLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPARRAQAWQR
FT                   LVADLPESFYTQAAKEISLAEAPKFAEAIINNQIQGRTLVKVN"
FT   gene            29730..31670
FT                   /locus_tag="UM146_00150"
FT   CDS_pept        29730..31670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00150"
FT                   /product="regulatory protein CsrD"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69459"
FT                   /protein_id="ADN69459.1"
FT                   /translation="MRLTTKFSAFVTLLTGLTIFVTLLGCSLSFYNAIQYKFSHRVQAV
FT                   ATAIDTHLVSNDFSTLRPQITELMMSADIVRVDLLHGDKQVYTLARNGSYRPVGTNDLF
FT                   RELSVPLIKHPGMSLRLVYQDPMGNYFHSLMTTAPLTGAIGFIILMLFLAVRWLQRQLA
FT                   GQELLETRATRILNGERGSNVLGTIYEWPPRTSSALDTLLCEIQNAREQHSRLDTLIRS
FT                   YAAQDMKTGLNNRLFFDNQLATLLEDQEKVGTHGIVMMIRLPDFNMLSDTWGHSQVEEQ
FT                   FFSLTNLLSTFMMRYPGALLARYHRSDFAALLPHRTLKEAESIASQLIKAVDTLPNNKM
FT                   LDRDDMIHIGICAWRSGQDTEQVMEHAESATRNAGLQGGNSWAIYDDSLPEKGRGNVRW
FT                   RTLIEQMLSRGGPRLYQKPAVTREGRVHHRELMCRIFDGNEEVSSAEYMPMVLQFGLSE
FT                   EYDRLLISRLIPLLRYWPEENLAIQVTVESLIRPRFQRWLRDTLMQCEKSQRRRIIIEL
FT                   AEADVGQHISRLQPVIRLVNALGVRVAVNQAGLTLVSTSWIKELNVELLKLHPGLVRNI
FT                   EKRTENQLLVQSLVEACSGTSTQVYATGVRSRSEWQTLIQRGVTGGQGDFFASSQPLDT
FT                   NVKKYSQRYSV"
FT   gene            31975..33018
FT                   /locus_tag="UM146_00155"
FT   CDS_pept        31975..33018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00155"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69460"
FT                   /protein_id="ADN69460.1"
FT                   /translation="MLKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR
FT                   AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEI
FT                   GSAYPGDEVREIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   gene            33084..34187
FT                   /locus_tag="UM146_00160"
FT   CDS_pept        33084..34187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00160"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="COG1792 Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69461"
FT                   /protein_id="ADN69461.1"
FT                   /translation="MKPIFSRGPSLQIRLILAVLVALGIIIADSRLGTFSQIRTYMDTA
FT                   VSPFYFVSNAPRELLDGVSQTLASRDQLELENRALRQELLLKNSELLMLGQYKQENARL
FT                   RELLGSPLRQDEQKMVTQVISTVNDPYSDQVVIDKGSVNGVYEGQPVISDKGVVGQVVA
FT                   VAKLTSRVLLICDATHALPIQVLRNDIRVIAAGNGCTDDLQLEHLPANTDIRVGDVLVT
FT                   SGLGGRFPEGYPVAVVSSVKLDTQRAYTVIQARPTAGLQRLRYLLLLWGADRNGANPMT
FT                   PEEVHRVANERLMQMMPQVLPSPDAMGPKLPEPATGITQPTPQQPATGNAVTAPAAPTQ
FT                   PAANRSPQRATPPQSGAQPPARAPGGQ"
FT   gene            34072..34203
FT                   /locus_tag="UM146_00165"
FT   CDS_pept        34072..34203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69462"
FT                   /protein_id="ADN69462.1"
FT                   /translation="MQLLRLLRPHSPLLIALHKGLRRRKVVLNRLRVRREDNSGELS"
FT   gene            34187..34675
FT                   /locus_tag="UM146_00170"
FT   CDS_pept        34187..34675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00170"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="COG2891 Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69463"
FT                   /protein_id="ADN69463.1"
FT                   /translation="MASYRSQGRWVIWLSFLIALLLQIMPWPDNLIVFRPNWVLLILLY
FT                   WILALPHRVNVGTGFVMGAILDLISGSTLGVRVLAMSIIAYLVALKYQLFRNLALWQQA
FT                   LVVMLLSLVVDIIVFWAEFLVINVSFRPEVFWSSVVNGVLWPWIFLLMRKVRQQFAVQ"
FT   gene            34684..35277
FT                   /locus_tag="UM146_00175"
FT   CDS_pept        34684..35277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00175"
FT                   /product="Maf-like protein"
FT                   /note="COG0424 Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69464"
FT                   /protein_id="ADN69464.1"
FT                   /translation="MTSLYLASGSPRRQELLAQLGVTFERIVTGIEEQRQPQESAQQYV
FT                   VRLAREKAQAGVAQTAQDLPVLGADTIVILNGEVLEKPRDAEHAAQMLRKLSGQTHQVM
FT                   TAVALADSQHILDCLVVTDVTFRTLTDEDIAGYVASGEPLDKAGAYGIQGLGGCFVRKI
FT                   NGSFHAVVGLPLVETYELLSNFNALREKRDKHDG"
FT   gene            35267..36736
FT                   /locus_tag="UM146_00180"
FT   CDS_pept        35267..36736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00180"
FT                   /product="ribonuclease G"
FT                   /note="COG1530 Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69465"
FT                   /protein_id="ADN69465.1"
FT                   /translation="MTAELLVNVTPSETRVAYIDGGILQEIHIEREARRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGEEQKQFTVRDISELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESESERERLKKVVAEYCD
FT                   EQGGFIIRTAAEGVGEAELASDAAYLKRVWTKVMERKKRPQTRYQLYGELALAQRVLRD
FT                   FADAELDRIRVDSRLTYEALLEFTSEYIPEMTSKLEHYTGRQPIFDLFDVENEIQRALE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLDDTIFNTNIEATQAIARQLRLRNL
FT                   GGIIIIDFIDMNNEDHRRRVLHSLEQALSKDRVKTSVNGFSALGLVEMTRKRTRESIEH
FT                   VLCNECPTCHGRGTVKTVETVCYEIMREIVRVHHAYDSDRFLVYASPAVAEALKGEESH
FT                   SLAEVEIFVGKQVKVQIEPLYNQEQFDVVMM"
FT   gene            36813..40604
FT                   /locus_tag="UM146_00185"
FT   CDS_pept        36813..40604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00185"
FT                   /product="hypothetical protein"
FT                   /note="COG3164 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69466"
FT                   /protein_id="ADN69466.1"
FT                   /translation="MPGILLLTGAALVVIAALLVSGLRIALPHLDAWRPEILNKIESAT
FT                   GMPVEASQLSASWQNFGPTLEAHDIRAELKDGGEFSVKRVTLALDVWQSLLHMRWQFRD
FT                   LTFWQLRFRTNTPITSGGGNDSLEASHISDLFLRQFDHFDLRDSEVSFLTPSGQRAELA
FT                   IPQLTWLNDPRRHRAEGLVSLSSLTGQHGVMQVRMDLRDDEGLLSNGRVWLQADDIDLK
FT                   PWLGKWMQDNIALETAQFSLEGWMTIDKGDVTGGDVWLKQGGASWLGEKETHTLSVDNL
FT                   TAHITRENPGWQFSIPDTRITMDGKPWPSGALTLAWIPEQDVGGKDNKRSDELRIRASN
FT                   LELAGLEGVRPLVAKLSPALGDVWRSTQPSGKINTLALDIPLQAADKTRFQASWSDLAW
FT                   KQWKLLPGAEHFSGTLSGSVENGLLTASMKQAKMPYETVFRAPLEIADGQATISWLNND
FT                   KGFQLDGRNIDVKAKAVHARGGFRYLQPANDEPWLGILAGISTDDGSQAWRYFPENLMG
FT                   KDLVDYLSGAIQGGEADNATLVYGGNPQLFPYKHNEGQFEVLVPLRNAKFAFQPDWPAL
FT                   TNLDIELDFINDGLWMKTDGVNLGGVRASNLTAVIPDYSKEKLLIDADIKGPGKAVGPY
FT                   FDETPLKDSLGATLQELQLDGDVNARLHLDIPLNGELVTAKGEVTLRNNSLFIKPLDST
FT                   LKNLSGKFSFINGDLQSEPLTASWFNQPLNVDFSTKEGAKAYQVAVNLNGNWQPAKTGV
FT                   LPVAVNEALSGSVAWDGKVGIDLPYHAGATYNVELNGDLKNVSSHLPSPLAKPAGEPLA
FT                   VNVKVDGNLNSFELTGQAGADNHFNSRWLLGQKLTLDRAIWAADSKTLPPLPEQSGVEL
FT                   NMPPMNGAEWLALFQKGAAESVGGAASFPQHITLRTPMLSLGNQQWNNLSIVSQPTANG
FT                   TLVEAQGREINATLAMRNNAPWLANIKYLYYNPSVAKTRGDSTQSSPFPTTERINFRGW
FT                   PDAQIRCAECWFWGQKFGRIDSDITISGDTLTLTNGLIDTGFSRLTADGEWVNNPGNER
FT                   TSLKGKLRGQKIDAAAEFFGVTTPIRQSSFNVDYDLHWRKAPWQPDEATLNGIIHTQLG
FT                   KGEITEINTGHAGQLLRLLSVDALMRKLRFDFRDTFGEGFYFDSIRSTAWIKDGVMHTD
FT                   DTLVDGLEADIAMKGSVNLVRRDLNMEAVVAPEISATVGVAAAFAVNPIVGAAVFAASK
FT                   VLGPLWSKVSILRYHISGPLDDPQINEVLRQPRKEKAQ"
FT   gene            40760..42205
FT                   /gene="tldD"
FT                   /locus_tag="UM146_00190"
FT   CDS_pept        40760..42205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="UM146_00190"
FT                   /product="protease TldD"
FT                   /note="COG0312 Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69467"
FT                   /protein_id="ADN69467.1"
FT                   /translation="MSLNLVSEQLLAANGLKHQDLFAILGQLAERRLDYGDLYFQSSYH
FT                   ESWVLEDRIIKDGSYNIDQGVGVRAISGEKTGFAYADQISLLALEQSAQAARTIVRDSG
FT                   DGKVQTLGAVEHSPLYTSVDPLQSMSREEKLDILRRVDKVAREADKRVQEVTASLSGVY
FT                   ELILVAATDGTLAADVRPLVRLSVSVLVEEDGKRERGASGGGGRFGYEFFLADLDGEVR
FT                   ADAWAKEAVRMALVNLSAVAAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVF
FT                   SGQVGELVASELCTVVDDGTMVDRRGSVAIDDEGTPGQYNVLIENGILKGYMQDKLNAR
FT                   LMGMTPTGNGRRESYAHLPMPRMTNTYMLPGKSTPQEIIESVEYGIYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIENGKVTKPVKGATLIGSGIETMQQISMVGNDLKLDNGVGVCGKEG
FT                   QSLPVGVGQPTLKVDNLTVGGTA"
FT   gene            complement(42333..43244)
FT                   /locus_tag="UM146_00195"
FT   CDS_pept        complement(42333..43244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00195"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69468"
FT                   /protein_id="ADN69468.1"
FT                   /translation="MSVFAKVVEFGSFTAAARQLQMSVSSISQTVSKLEDELQVKLLNR
FT                   STRSIGLTEAGRIYYQGCRRMLHEVQDVHEQLYAFNNTPIGTLRIGCSSTMAQNVLAGL
FT                   TAKMLKEYPGLSVNLVTGIPAPDLIADGLDVVIRVGALQDSSLFSRRLGAMPMVVCAAK
FT                   SYLTQYGIPEKPADLSSHSWLEYSVRPDNEFELIAPEGISTRLIPQGRFVTNDPMTLVR
FT                   WLTAGAGIAYVPLMWVINEINRGELEILLPRYQSDPRPVYALYTEKDKLPLKVQVVINS
FT                   LTDYFVEVGKLFQEMHGRGKEK"
FT   gene            43445..43648
FT                   /locus_tag="UM146_00200"
FT   CDS_pept        43445..43648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69469"
FT                   /protein_id="ADN69469.1"
FT                   /translation="MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVW
FT                   HPALFNTALYCCLFYLISRLFV"
FT   gene            43656..44588
FT                   /locus_tag="UM146_00205"
FT   CDS_pept        43656..44588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00205"
FT                   /product="p-hydroxybenzoic acid efflux subunit AaeA"
FT                   /note="COG1566 Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69470"
FT                   /protein_id="ADN69470.1"
FT                   /translation="MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSA
FT                   DVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEK
FT                   RQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADG
FT                   WVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVL
FT                   KGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTA
FT                   TVVVTGKQDRDESQDSFFRKMAHRLREFG"
FT   gene            44594..46561
FT                   /locus_tag="UM146_00210"
FT   CDS_pept        44594..46561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00210"
FT                   /product="p-hydroxybenzoic acid efflux subunit AaeB"
FT                   /note="COG1289 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69471"
FT                   /protein_id="ADN69471.1"
FT                   /translation="MGIFSIANQHIRFAVKLATAIVLALFVGFHFQLETPRWAVLTAAI
FT                   VAAGPAFAAGGEPYSGAIRYRGFLRIIGTFIGCIAGLVIIIAMIRAPLLMILVCCIWAG
FT                   FCTWISSLVRIENSYAWGLAGYTALIIVITIQPEPLLTPQFAVERCSEIVIGIVCAIMA
FT                   DLLFSPRSIKQEVDRELESLLVAQYQLMQLCIKHGDGEVVDKAWGDLVRRTTALQGMRS
FT                   NLNMESSRWARANRRLKAINTLSLTLITQSCETYLIQNTRPELITDTFREFFDTPVETA
FT                   QDVHKQLKRLRRVIAWTGERETPVTIYSWVAAATRYQLLKRGVISNTKINATEEEILQG
FT                   EPEVKVESAERHHAMVNFWRTTLSCILGTLFWLWTGWTSGSGAMVMIAVVTSLAMRLPN
FT                   PRMVAIDFIYGTLAALPLGLLYFLVIIPNTQQSMLLLCISLAVLGFFLGIEVQKRRLGS
FT                   MGALASTINIIVLDNPMTFHFSQFLDSALGQIVGCVLAFTVILLVRDKSRDRTGRVLLN
FT                   QFVSAAVSAMTTNVARRKENHLPALYQQLFLLMNKFPGDLPKFRLALTMIIAHQRLRDA
FT                   PIPVNEDLSAFHRQMRRTADHVISARSDDKRRRYFGQLLEELEIYQEKLRIWQAPPQVT
FT                   EPVHRLTGMLHKYQHALTDS"
FT   gene            46653..46925
FT                   /locus_tag="UM146_00215"
FT   CDS_pept        46653..46925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00215"
FT                   /product="putative barnase inhibitor"
FT                   /note="COG2732 Barstar, RNAse (barnase) inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69472"
FT                   /protein_id="ADN69472.1"
FT                   /translation="MNIYTFDFDEIESQEDFYRDFSQTFGLAKDKVRDLDSLWDVLMND
FT                   VLPLPLEIEFVHLGEKTRRRFGALILLFDEAEEELEGHLRFNVRH"
FT   gene            complement(46980..47243)
FT                   /locus_tag="UM146_00220"
FT   CDS_pept        complement(46980..47243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69473"
FT                   /protein_id="ADN69473.1"
FT                   /translation="MKIKTTVAALSVLSVLSFGAFAADSIDAAQAQNREAIGTVSVSGV
FT                   ASSPMDMREMLNKKAEEKGATAYQITEARSGDTWHATAELYK"
FT   gene            complement(47607..48077)
FT                   /locus_tag="UM146_00225"
FT   CDS_pept        complement(47607..48077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00225"
FT                   /product="arginine repressor"
FT                   /note="COG1438 Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69474"
FT                   /protein_id="ADN69474.1"
FT                   /translation="MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGA
FT                   AQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKELYEAILELFDQEL"
FT   gene            48512..49450
FT                   /locus_tag="UM146_00230"
FT   CDS_pept        48512..49450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00230"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="COG0039 Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69475"
FT                   /protein_id="ADN69475.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVKIKGFSGEDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQ
FT                   VAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKG
FT                   KQPGEVEVPVIGGHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFGLSLVRALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSI
FT                   GTLSAFEQNALEGMLDTLKKDIALGEEFVNK"
FT   gene            complement(49512..50579)
FT                   /locus_tag="UM146_00235"
FT   CDS_pept        complement(49512..50579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00235"
FT                   /product="serine endoprotease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69476"
FT                   /protein_id="ADN69476.1"
FT                   /translation="MFVKLLRSVAIGLIVGAILLVAMPSLRSLNPLSTPQFDSTDETPA
FT                   SYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQI
FT                   IVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYN
FT                   LGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDK
FT                   SNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
FT                   IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDK
FT                   QLTLQVTIQEYPATN"
FT   gene            complement(50669..52036)
FT                   /locus_tag="UM146_00240"
FT   CDS_pept        complement(50669..52036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00240"
FT                   /product="serine endoprotease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69477"
FT                   /protein_id="ADN69477.1"
FT                   /translation="MKKQTQLLSALALSVGLTLSASFQAVASIPGQVADQAPLPSLAPM
FT                   LEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINANKGYV
FT                   LTNNHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLR
FT                   VGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALLNLN
FT                   GELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRGLLGIKGTEMSADIA
FT                   KAFNLDVQRGAFVSEVLPGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIATTEPGTK
FT                   VKLGLLRNGKPLEVEVTLDTSTSSSASAEMITPALEGATLSDGQLKDGGKGIKIDEVVK
FT                   GSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKPAIIALQIVRGNESLYLLMR"
FT   gene            complement(52190..52588)
FT                   /locus_tag="UM146_00245"
FT   CDS_pept        complement(52190..52588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00245"
FT                   /product="cytochrome d ubiquinol oxidase subunit III"
FT                   /note="COG3105 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69478"
FT                   /protein_id="ADN69478.1"
FT                   /translation="MTWEYALIGLVVGIIIGAVAMRFGNRKLRQQQALQYELEKNKAEL
FT                   DEYREELVSHFARSAELLDTMAHDYRQLYQHMAKSSSSLLPELSAEANPFRNRLAESEA
FT                   SNDQAPVQMPRDYSEGASGLLRTGAKRD"
FT   gene            52782..53909
FT                   /locus_tag="UM146_00250"
FT   CDS_pept        52782..53909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00250"
FT                   /product="hypothetical protein"
FT                   /note="COG1485 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69479"
FT                   /protein_id="ADN69479.1"
FT                   /translation="MQSVTPTSQYLKALNEGSHQPDDVQKEAVSRLEIIYQELINSTPP
FT                   APRTSGLMARVGKLWGKREDTKHMPVRGLYMWGGVGRGKTWLMDLFYQSLPGERKQRLH
FT                   FHRFMLRVHEELTALQGQTDPLEIIADRFKAETDVLCFDEFFVSDITDAMLLGGLMKAL
FT                   FARGITLVATSNIPPDELYRNGLQRARFLPAIDAIKRHCDVMNVDAGVDYRLRTLTQAH
FT                   LWLSPLNDETRAQMDKLWLALAGAKRENSPTLEINHRPLATMGVENQTLAVSFTTLCVD
FT                   ARSQHDYIALSRLFHTVMLFDVPVMTRLMESEARRFIALVDEFYERHVKLVVSAEVPLY
FT                   EIYQGERLKFEFQRCLSRLQEMQSEEYLKREHLAG"
FT   gene            54129..54557
FT                   /gene="rplM"
FT                   /locus_tag="UM146_00255"
FT   CDS_pept        54129..54557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="UM146_00255"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69480"
FT                   /protein_id="ADN69480.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
FT   gene            54573..54965
FT                   /gene="rpsI"
FT                   /locus_tag="UM146_00260"
FT   CDS_pept        54573..54965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="UM146_00260"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69481"
FT                   /protein_id="ADN69481.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   gene            55360..55998
FT                   /gene="sspA"
FT                   /locus_tag="UM146_00265"
FT   CDS_pept        55360..55998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="UM146_00265"
FT                   /product="stringent starvation protein A"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69482"
FT                   /protein_id="ADN69482.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDN
FT                   PPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMH
FT                   RIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAP
FT                   LLWRLPQLGIEFSGPGAKELKGYMTRVFERDSFLASLTEAEREMRLGRS"
FT   gene            56004..56501
FT                   /locus_tag="UM146_00270"
FT   CDS_pept        56004..56501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00270"
FT                   /product="ClpXP protease specificity-enhancing factor"
FT                   /note="COG2969 Stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69483"
FT                   /protein_id="ADN69483.1"
FT                   /translation="MDLSQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEY
FT                   ARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMF
FT                   EPEAAYDEDASIMNDEEASADNETVMSVIDGDKPDHDDETHPDDEPPQPPRGGRPALRV
FT                   VK"
FT   gene            56618..57400
FT                   /locus_tag="UM146_00275"
FT   CDS_pept        56618..57400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00275"
FT                   /product="transcriptional regulator NanR"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69484"
FT                   /protein_id="ADN69484.1"
FT                   /translation="MNAFDPQAEDSTTTIGRNLRSRPLARKKLSEMVEEELEQMIRRRE
FT                   FGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGERARVSRPSADTIIGEL
FT                   SGMAKDFLSHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIDLLAKALEINSQSLDNNA
FT                   AFIRSDVDFHRVLAEIPGNPIFMAIHVALLDWLIAARPTVADQALHEHNNVSYQQHIAI
FT                   VDAIRRHDPDEADRALQSHLNSVSATWHAFGQTTNKKK"
FT   gene            57522..58415
FT                   /locus_tag="UM146_00280"
FT   CDS_pept        57522..58415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00280"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /note="COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69485"
FT                   /protein_id="ADN69485.1"
FT                   /translation="MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVG
FT                   GSTGEAFVQSLSEREQVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVS
FT                   AVTPFYYPFSFEEHCDHYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGA
FT                   LKQTSGDLYQMEQIRREHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVK
FT                   ALKEGDIQTAQKLQTECNKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKY
FT                   LPELKALAQQLMQERG"
FT   gene            58524..60014
FT                   /locus_tag="UM146_00285"
FT   CDS_pept        58524..60014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00285"
FT                   /product="putative sialic acid transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69486"
FT                   /protein_id="ADN69486.1"
FT                   /translation="MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTE
FT                   VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGF
FT                   APGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQV
FT                   YSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKEKHGGKAPVRTMVDILYRGEH
FT                   RIANIVMTLAAATALWFCFAGNLQNAAIVAVLGLLCAAIFISFMVQSTGKRWPTGVMLM
FT                   VVVLFAFLYSWPIQALLPTYLKTDLAYDPHTVANVLFFSGFGAAVGCCVGGFLGDWLGT
FT                   RKAYVCSLLASQLLIIPVFAIGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQ
FT                   RAAGLGFTYNVGALGGALAPILGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRV
FT                   QRWLRPEALRTHDAIDGKPFSGAVPFGSAKNDLVKTKS"
FT   gene            60062..60751
FT                   /locus_tag="UM146_00290"
FT   CDS_pept        60062..60751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00290"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="COG3010 Putative N-acetylmannosamine-6-phosphate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69487"
FT                   /protein_id="ADN69487.1"
FT                   /translation="MSLLAQLDQKIAANGGLIVSCQPVPDSPLDKPEIVAAMALAAEQA
FT                   GAVAIRIEGVANLQATRAVVSVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAI
FT                   DGTDRPRPVPVETLLARIHHHGLLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETP
FT                   EEPDLALVKTLSDAGCRVIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHICQWYNT
FT                   AMKKAVL"
FT   gene            60748..61623
FT                   /locus_tag="UM146_00295"
FT   CDS_pept        60748..61623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00295"
FT                   /product="N-acetylmannosamine kinase"
FT                   /EC_number="2.7.1.60"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69488"
FT                   /protein_id="ADN69488.1"
FT                   /translation="MTTLAIDIGGTKLAAALIGADGQIRDRRELPTPASQTPQALRDAL
FT                   SALVSPLQAHAQRVAIASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAIN
FT                   DAQAAAWAEYQALDGDITDMVFITVSTGVGGGVVSGGKLRTGPGGLAGHIGHTLADPHG
FT                   PACGCGRTGCVEAIASGRGIATAAQGELAGANAKTIFTRAGQGDEQAQQLIHRSARTLA
FT                   RLIADIKATTDCQCVVVGGSVGLAEGYLALVETYLAQEPAAFHVDLLAAHYRHDAGLLG
FT                   AALLAQGEIL"
FT   gene            61620..62084
FT                   /locus_tag="UM146_00300"
FT   CDS_pept        61620..62084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00300"
FT                   /product="hypothetical protein"
FT                   /note="COG2731 Beta-galactosidase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69489"
FT                   /protein_id="ADN69489.1"
FT                   /translation="MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNI
FT                   FMNVMTFNTQSPVEKKAELHEQYIDIQLLLNGEERILFGMAGTARQCEEFHHEDDYQLC
FT                   SAIENEQAIILKPGMFAVFMPGEPHKPGCVVGEPGEIKKVVVKIKADLMA"
FT   gene            complement(62152..63570)
FT                   /gene="gltD"
FT                   /locus_tag="UM146_00305"
FT   CDS_pept        complement(62152..63570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="UM146_00305"
FT                   /product="glutamate synthase subunit beta"
FT                   /EC_number="1.4.1.13"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69490"
FT                   /protein_id="ADN69490.1"
FT                   /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSEGQAKAQAD
FT                   RCLSCGNPYCEWKCPVHNYIPNWLKLANEGRIFEAAELSHQTNTLPEVCGRVCPQDRLC
FT                   EGSCTLNDEFGAVTIGNIERYINDKAFEMGWRPDMSGVKQTGKKVAIIGAGPAGLACAD
FT                   VLTRNGVKAVVFDRHPEIGGLLTFGIPAFKLEKEVMTRRREIFTGMGIEFKLNTEVGRD
FT                   VQLDDLLSDYDAVFLGVGTYQSMRGGLENEDADGVYAALPFLIANTKQLMGFGETNDEP
FT                   FVSMEGKRVVVLGGGDTAMDCVRTSVRQGAKHVTCAYRRDEENMPGSRREVKNAREEGV
FT                   EFKFNIQPLGIEVNGNGKVSGVKMVRTEMGEPDAKGRRRAEIVAGSEHIVPADAVIMAF
FT                   GFRPHNMEWLAKHSVELDSQGRIIAPEGSDNAFQTSNPKIFAGGDIVRGSDLVVTAIAE
FT                   GRKAADGIMNWLEV"
FT   gene            complement(63583..67791)
FT                   /gene="gltB"
FT                   /locus_tag="UM146_00310"
FT   CDS_pept        complement(63583..67791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="UM146_00310"
FT                   /product="glutamate synthase subunit alpha"
FT                   /EC_number="1.4.1.13"
FT                   /note="COG0067 Glutamate synthase domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69491"
FT                   /protein_id="ADN69491.1"
FT                   /translation="MLFLNKDPELAAAARRIVEEELQRETLSIVGWRDVPTNEGVLGEI
FT                   ALSSLPRIEQIFVNAPAGWRPRDMERRLFIARRRIEKRLEADKDFYVCSLSNLVNIYKG
FT                   LCMPADLPRFYLDLADLRLESAICLFHQRFSTNTVPRWPLAQPFRYLAHNGEINTITGN
FT                   RQWARARTYKFQTPLIPDLHDAAPFVNETGSDSSSMDNMLELLLAGGMDIIRAMRLLVP
FT                   PAWQNNPDMDPELRAFFDFNSMHMEPWDGPAGIVMSDGRFAACNLDRNGLRPARYVITK
FT                   DKLITCASEVGIWDYQPDEVVEKGRVGPGELMVIDTRSGRILHSAETDDDLKSRHPYKE
FT                   WMEKNVRRLVPFEDLPDEEVGSRELDDDTLASYQKQFNYSAEELDSVIRVLGENGQEAV
FT                   GSMGDDTPFAVLSSQPRIIYDYFRQQFAQVTNPPIDPLREAHVMSLATSIGREMNVFCE
FT                   AEGQAHRLSFKSPILLYSDFKQLTTMKEDHYRADTLDITFDVTKTTLEATVKELCDKAE
FT                   KMVRSGTVLLVLSDRNIAKDRLPVPAPMAVGAIQTRLVEQSLRCDANIIVETASARDPH
FT                   HFAVLLGFGATAIYPYLAYETLGRLVDTHAIAKDYRTVMLNYRNGINKGLYKIMSKMGI
FT                   STIASYRCSKLFEAVGLHDDVVGLCFQGAVSRIGGASFEDFQQDLLNLSKRAWLARKPI
FT                   SQGGLLKYVHGGEYHAYNPDVVRTLQQAVQSGEYSDYQEYAKLVNERPATTLRDLLAIT
FT                   PGENAVNIADVEPASELFKRFDTAAMSIGALSPEAHEALAEAMNSIGGNSNSGEGGEDP
FT                   ARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIAK
FT                   LRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVA
FT                   KAYADLITIAGYDGGTGASPLSSVKYAGCPWELGLVETQQALVANGLRHKIRLQVDGGL
FT                   KTGVDIIKAAILGAESFGFGTGPMVALGCKYLRICHLNNCATGVATQDDKLRKNHYHGL
FT                   PFKVTNYFEFIARETRELMAQLGVTRLVDLIGRTDLLKELDGFTAKQQKLALSKLLETA
FT                   EPHPGKALYCTENNPPFDNGLLNAQLLQQAKPFVDERQSKTFWFDIRNTDRSVGASLSG
FT                   YIAQTHGDQGLAADPIKAYFNGTAGQSFGVWNAGGVELYLTGDANDYVGKGMAGGLIAI
FT                   RPPVGSAFRSHEASIIGNTCLYGATGGRLYAAGRAGERFGVRNSGAITVVEGIGDNGCE
FT                   YMTGGIVCILGKTGVNFGAGMTGGFAYVLDESGDFRKRVNPELVEVLSVDDLAIHEEHL
FT                   RGLITEHVQHTGSQRGEEILANWSTFATKFALVKPKSSDVKALLGHRSRSAAELRVQAQ
FT                   "
FT   gene            complement(67812..68150)
FT                   /gene="gltB"
FT                   /locus_tag="UM146_00315"
FT   CDS_pept        complement(67812..68150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="UM146_00315"
FT                   /product="glutamate synthase subunit alpha"
FT                   /EC_number="1.4.1.13"
FT                   /note="COG0067 Glutamate synthase domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69492"
FT                   /protein_id="ADN69492.1"
FT                   /translation="MRGARMTRKPRRHALTVPVRSGSEVGFPQSLGEVHDMLYDKSLER
FT                   DNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAILADGKTGDGCGLLLQKPDRFFAS
FT                   LRRSAAGV"
FT   gene            68567..68671
FT                   /locus_tag="UM146_00320"
FT   CDS_pept        68567..68671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69493"
FT                   /protein_id="ADN69493.1"
FT                   /translation="MIYVIVHEISVILIDYAVDKSRPGRLIQVIAELG"
FT   gene            68717..69646
FT                   /locus_tag="UM146_00325"
FT   CDS_pept        68717..69646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00325"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /note="COG1242 Predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69494"
FT                   /protein_id="ADN69494.1"
FT                   /translation="MQLQKLVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDGTIGRGGC
FT                   TFCNVASFADEAQQHRSIAEQLAHQANLVNRAKRYLAYFQAYTSTFAEVQVLRSMYQQA
FT                   VSQANIVGLCVGTRPDCVPDAVLDLLCEYKDQGYEVWLELGLQTAHDKTLHRINRGHDF
FT                   ACYQRTTQLARERGLKVCSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGS
FT                   IMAKAWEAGRLNGIELEDYTLTAGEMIRHTPPEVIYHRISASARRPTLLAPLWCENRWT
FT                   GMVELDRYLNEHGVQGSALGRPWLPPTA"
FT   gene            69742..72078
FT                   /locus_tag="UM146_00330"
FT   CDS_pept        69742..72078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00330"
FT                   /product="aerobic respiration control sensor protein ArcB"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69495"
FT                   /protein_id="ADN69495.1"
FT                   /translation="MKQIRLLAQYYVDLMMKLGLVRFSMLLALALVVLAIVVQMAVTMV
FT                   LHGQVESIDVIRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSRLVQKLEEMRERDLSL
FT                   NVQLKDNIAQLNQEIAVREKAEAELQETFGQLKIEIKEREETQIQLEQQSSFLRSFLDA
FT                   SPDLVFYRNEDKEFSGCNRAMELLTGKSEKQLVHLKPADVYSPEAAAKVIETDEKVFRH
FT                   NVSLTYEQWLDYPDGRKACFEIRKVPYYDRVGKRHGLMGFGRDITERKRYQDALERASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELTAEQEKYLKTIHVSAVTLGNIFNDIID
FT                   MDKMERRKVQLDNQPVDFTSFLADLENLSALQAQQKGLRFNLEPTLPLPHQVITDGTRL
FT                   RQILWNLISNAVKFTQQGQVTVRVRYDEGDMLHFEVEDSGIGIPQDELDKIFAMYYQVK
FT                   DSHGGKPATGTGIGLAVSRRLAKNMGGDITVTSEQGKGSTFTLTIHAPSVAEEVDDAFD
FT                   EDDMPLPALNVLLVEDIELNVIVARSVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLD
FT                   IQLPDMTGLDISRELTKRYPREDLPPLVALTANVLKDKQEYLNAGMDDVLSKPLSVPAL
FT                   TAMIKKFWDTQDDEESTVTTEENSKSEALLDIPMLEQYLELVGPKLITDGLAVFERMMP
FT                   GYVSVLESNLTAQDKKGIVEEGHKIKGAAGSVGLRHLQQLGQQIQSPDLPAWEDNVGEW
FT                   IEEMKEEWRHDVEVLKAWVAKATKK"
FT   gene            72308..72961
FT                   /locus_tag="UM146_00335"
FT   CDS_pept        72308..72961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00335"
FT                   /product="isoprenoid biosynthesis protein with
FT                   amidotransferase-like domain"
FT                   /note="COG3155 Uncharacterized protein involved in an early
FT                   stage of isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69496"
FT                   /protein_id="ADN69496.1"
FT                   /translation="MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQ
FT                   VDVINHLTGEAMTETRNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAVKNLSNF
FT                   ASLGSECTVDRELKALAQAMHQAGKPLGFMCIAPAILPKIFDFPLRLTIGTDIDTAEVL
FT                   EEMGAEHVPCPVDDIVVDEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE"
FT   gene            72958..73686
FT                   /gene="mtgA"
FT                   /locus_tag="UM146_00340"
FT   CDS_pept        72958..73686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="UM146_00340"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69497"
FT                   /protein_id="ADN69497.1"
FT                   /translation="MSKSRLTVFSFVRRFLLRLMVVLAIFWGGGIALFSVAPVPFSAVM
FT                   VERQVSAWLHGNFRYVAHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALA
FT                   HNERNENRIRGASTISQQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLN
FT                   IAEFGDGVFGVEAAAQRYFHKPASKLTRSEAALLAAVLPNPLRFKVSAPSGYVRSRQAW
FT                   ILRQMYQLGGEPFMQQHQLD"
FT   gene            complement(73683..74315)
FT                   /locus_tag="UM146_00345"
FT   CDS_pept        complement(73683..74315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69498"
FT                   /protein_id="ADN69498.1"
FT                   /translation="MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRR
FT                   ELKYYAHLGRRLKDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYE
FT                   EDIAQLRQLLKQLKRYLQDNRIVTMSLKPQNILCHRISESEVTPVVCDNIGESTLIPLA
FT                   TWSKWCCLRKQERLWKRFIAQPALAIALQKDLQPRESKTLALTSREA"
FT   gene            complement(74529..74801)
FT                   /locus_tag="UM146_00350"
FT   CDS_pept        complement(74529..74801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00350"
FT                   /product="phosphohistidinoprotein-hexose phosphotransferase
FT                   component of N-regulated PTS system (Npr)"
FT                   /note="COG1925 Phosphotransferase system, HPr-related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69499"
FT                   /protein_id="ADN69499.1"
FT                   /translation="MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAE
FT                   ANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVIALFNSGFDED"
FT   gene            complement(74798..75652)
FT                   /locus_tag="UM146_00355"
FT   CDS_pept        complement(74798..75652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00355"
FT                   /product="hypothetical protein"
FT                   /note="COG1660 Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69500"
FT                   /protein_id="ADN69500.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARTLA
FT                   DREISAAVSIDVRNMPESPEIFEQAMSNLPDAFSPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLESAIDKESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRHRTLEK
FT                   RKP"
FT   gene            complement(75698..76189)
FT                   /locus_tag="UM146_00360"
FT   CDS_pept        complement(75698..76189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00360"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69501"
FT                   /protein_id="ADN69501.1"
FT                   /translation="MTNNDTTLQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSL
FT                   APQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPV
FT                   DLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDTEGTPDEA
FT                   "
FT   gene            complement(76307..76594)
FT                   /locus_tag="UM146_00365"
FT   CDS_pept        complement(76307..76594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00365"
FT                   /product="putative sigma(54) modulation protein"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69502"
FT                   /protein_id="ADN69502.1"
FT                   /translation="MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEK
FT                   VTHTSDATLHVNGGEIHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH"
FT   gene            complement(76617..78050)
FT                   /locus_tag="UM146_00370"
FT   CDS_pept        complement(76617..78050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00370"
FT                   /product="RNA polymerase factor sigma-54"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG1508 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma54 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69503"
FT                   /protein_id="ADN69503.1"
FT                   /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNP
FT                   LLEQIDTHEEIDTRETQDSETLDTADALEQKEMPEELPLDASWDTIYTAGTPSGTSGDY
FT                   IDDELPVYQGETTQTLQDYLMWQVELTPFSDTDRAIATSIVDAVDDTGYLTVPLEDILE
FT                   SMGDEEIDIDEVEAVLKRIQRFDPVGVAAKDLRDCLLIQLSQFDKTTPWLEEARLIISD
FT                   HLDLLANHDFRTLMRVTRLKEDVLKEAVNLIQSLDPRPGQSIQTGEPEYVIPDVLVRKH
FT                   NGHWTVELNSDSIPRLQINQHYASMCNNARNDGDSQFIRSNLQDAKWLIKSLESRNDTL
FT                   LRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFEL
FT                   KYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTV
FT                   AKYRESLSIPPSNQRKQLV"
FT   gene            complement(78098..78823)
FT                   /locus_tag="UM146_00375"
FT   CDS_pept        complement(78098..78823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00375"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YhbG"
FT                   /note="COG1137 ABC-type (unclassified) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69504"
FT                   /protein_id="ADN69504.1"
FT                   /translation="MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQ
FT                   IRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPT
FT                   EILQDEHVKRVYLGEDFRL"
FT   gene            complement(78830..79387)
FT                   /locus_tag="UM146_00380"
FT   CDS_pept        complement(78830..79387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00380"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="COG1934 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69505"
FT                   /protein_id="ADN69505.1"
FT                   /translation="MKFKTNKLSLNLVLASSLLAASIPAFAVTGDTDQPIHIESDQQSL
FT                   DMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKP
FT                   VEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTV
FT                   LVPSQLQDKNNKGQTPAQKKGN"
FT   gene            complement(79356..79931)
FT                   /locus_tag="UM146_00385"
FT   CDS_pept        complement(79356..79931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00385"
FT                   /product="hypothetical protein"
FT                   /note="COG3117 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69506"
FT                   /protein_id="ADN69506.1"
FT                   /translation="MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSE
FT                   HTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLT
FT                   NDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKM
FT                   RGNLRSKNAELIEKVRTSYEIQNKQTQP"
FT   gene            complement(79928..80494)
FT                   /locus_tag="UM146_00390"
FT   CDS_pept        complement(79928..80494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00390"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.45"
FT                   /note="COG1778 Low specificity phosphatase (HAD
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69507"
FT                   /protein_id="ADN69507.1"
FT                   /translation="MSKAGASLATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMG
FT                   NNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLI
FT                   AFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGR
FT                   GAVREVCDLLLLAQGKLDEAKGQSI"
FT   gene            complement(80515..81501)
FT                   /locus_tag="UM146_00395"
FT   CDS_pept        complement(80515..81501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00395"
FT                   /product="D-arabinose 5-phosphate isomerase"
FT                   /note="COG0794 Predicted sugar phosphate isomerase involved
FT                   in capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69508"
FT                   /protein_id="ADN69508.1"
FT                   /translation="MSHVELQPGFDFQQAGKEVLAIERECLAELDQYINQNFTLACEKM
FT                   FWCKGKVVVMGMGKSGHIGRKMAATFASTGTPSFFVHPGEAAHGDLGMVTPQDVVIAIS
FT                   NSGESSEITALIPVLKRLHVPLICITGRPESSMARAADVHLCVKVAKEACPLGLAPTSS
FT                   TTATLVMGDALAVALLKARGFTAEDFALSHPGGALGRKLLLRVNDIMHTGDEIPHVKKT
FT                   ASLRDALLEVTRKNLGMTVICDDNMMIEGIFTDGDLRRVFDMGVDVRQLSIADVMTPGG
FT                   IRVRPGILAVEALNLMQSRHITSVMVADGDHLLGVLHMHDLLRAGVV"
FT   gene            complement(81515..82492)
FT                   /locus_tag="UM146_00400"
FT   CDS_pept        complement(81515..82492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00400"
FT                   /product="putative calcium/sodium:proton antiporter"
FT                   /note="COG0530 Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69509"
FT                   /protein_id="ADN69509.1"
FT                   /translation="MLLATALLIVGLLLVVYSADRLVFAASILCRTFGIPPLIIGMTVV
FT                   SIGTSLPEIIVSLAASLHEQRDLAVGTALGSNIINILLILGLAALVRPFTVHSDVLRRE
FT                   LPLMLLVSVVAGSVLYDGQLSRSDGIFLLFLAVLWLLFIVKLARQAERQGTDSLTREQL
FT                   AELPREGGLPVAFLWLGIALIIMPVATRMVVDNATVLANYFAISELTMGLTAIAIGTSL
FT                   PELATAIAGVRKGENDIAVGNIIGANIFNIVIVLGLPALITPGEIDPLAYSRDYSVMLL
FT                   VSIIFALLCWRRSPQPGRGVGVLLTGGFIVWLAMLYWLSPILVE"
FT   gene            82702..83511
FT                   /locus_tag="UM146_00405"
FT   CDS_pept        82702..83511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00405"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YrbF"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69510"
FT                   /protein_id="ADN69510.1"
FT                   /translation="MEQSVANLVDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGI
FT                   GKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDMNVFD
FT                   NVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEP
FT                   DLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWILADKK
FT                   IVAHGSAQALQANPDPRVRQFLDGIADGPVPFRYPAGDYHADLLPGS"
FT   gene            83519..84301
FT                   /locus_tag="UM146_00410"
FT   CDS_pept        83519..84301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00410"
FT                   /product="toluene ABC transporter, permease protein"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69511"
FT                   /protein_id="ADN69511.1"
FT                   /translation="MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLV
FT                   RQLYNVGVLSMLIIVVSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVA
FT                   ALLFAGRAGSALTAEIGLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFV
FT                   AVGIWGGSLVGVSWKGIDSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGY
FT                   DAIPTSAGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   gene            84306..84857
FT                   /locus_tag="UM146_00415"
FT   CDS_pept        84306..84857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00415"
FT                   /product="hypothetical protein"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69512"
FT                   /protein_id="ADN69512.1"
FT                   /translation="MQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYAT
FT                   FDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTS
FT                   GLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAMVLEDLIGQFLYGSKGDDNKNSG
FT                   DAPAAAPGNNETTEPVGTTK"
FT   gene            84876..85511
FT                   /locus_tag="UM146_00420"
FT   CDS_pept        84876..85511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00420"
FT                   /product="toluene tolerance protein Ttg2D"
FT                   /note="COG2854 ABC-type transport system involved in
FT                   resistance to organic solvents, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69513"
FT                   /protein_id="ADN69513.1"
FT                   /translation="MFKRLMMVALLVIAPLSAATAADQTNPYKLMDEAAQKTFDRLKNE
FT                   QPQIRANPDYLRTIVDQELLPYVQVKYAGALVLGQYYKSATPAQRDAYFAAFREYLKQA
FT                   YGQALAMYHGQTYQIAPEQPLGDKIIVPIRVTIIDPNGRPPVRLDFQWRKNSQTGNWQA
FT                   YDMIAEGVSMITTKQNEWGTLLRTKGIDGLTAQLKSISQQKITLEEKK"
FT   gene            85511..85804
FT                   /locus_tag="UM146_00425"
FT   CDS_pept        85511..85804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00425"
FT                   /product="hypothetical protein"
FT                   /note="COG3113 Predicted NTP binding protein (contains STAS
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69514"
FT                   /protein_id="ADN69514.1"
FT                   /translation="MSESLSWMQTGDTLALSGELDQDVLLPLWEIREEAVKGITSIDLS
FT                   RVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR"
FT   gene            85949..86218
FT                   /locus_tag="UM146_00430"
FT   CDS_pept        85949..86218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00430"
FT                   /product="putative transcriptional regulator, BolA
FT                   superfamily protein"
FT                   /note="COG5007 Predicted transcriptional regulator, BolA
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69515"
FT                   /protein_id="ADN69515.1"
FT                   /translation="MIEDPMENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGM
FT                   SRVKKQQTVYGPLMEYIADNRIHAVSIKAYTPAEWARDRKLNGF"
FT   gene            86273..87532
FT                   /locus_tag="UM146_00435"
FT   CDS_pept        86273..87532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00435"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69516"
FT                   /protein_id="ADN69516.1"
FT                   /translation="MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLKDVDTSMKLLSQLGAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARF
FT                   GQGQVSLPGGCTIGARPVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSV
FT                   GATVTIMCAATLAEGTTIIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLG
FT                   GGVYRVLPDRIETGTFLVAAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWIS
FT                   LDMHGKRPKAVNVRTAPHPAFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSR
FT                   MGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGY
FT                   ERIEDKLRALGANIERVKGE"
FT   gene            complement(87580..87858)
FT                   /locus_tag="UM146_00440"
FT   CDS_pept        complement(87580..87858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00440"
FT                   /product="DNA-binding transcriptional regulator Nlp"
FT                   /note="COG3423 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69517"
FT                   /protein_id="ADN69517.1"
FT                   /translation="MESNFIDWHPADIIAGLRKKETSMAAESRRNGLSSSTLANALSRP
FT                   WPKGEMIIAKALGTDPWVIWPSRYHDPQTHEFIDRTQLMRSYTKPKK"
FT   gene            complement(88091..89062)
FT                   /locus_tag="UM146_00445"
FT   CDS_pept        complement(88091..89062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00445"
FT                   /product="octaprenyl diphosphate synthase"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69518"
FT                   /protein_id="ADN69518.1"
FT                   /translation="MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGK
FT                   RIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENY
FT                   MRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQ
FT                   LGKNVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGNGRHLLEPVLEAMNACGSL
FT                   EWTRQRAEEEADKAIAALQVLPDTPWREALVGLAHIAVQRDR"
FT   gene            89320..89631
FT                   /gene="rplU"
FT                   /locus_tag="UM146_00450"
FT   CDS_pept        89320..89631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="UM146_00450"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG0261 Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69519"
FT                   /protein_id="ADN69519.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMIANGE
FT                   EVKIGVPFVDGGVIKAEVVAHGRGEKVKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
FT   gene            89652..89909
FT                   /gene="rpmA"
FT                   /locus_tag="UM146_00455"
FT   CDS_pept        89652..89909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="UM146_00455"
FT                   /product="50S ribosomal protein L27"
FT                   /note="COG0211 Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69520"
FT                   /protein_id="ADN69520.1"
FT                   /translation="MAHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE"
FT   gene            90036..91001
FT                   /locus_tag="UM146_00460"
FT   CDS_pept        90036..91001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00460"
FT                   /product="hypothetical protein"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69521"
FT                   /protein_id="ADN69521.1"
FT                   /translation="MKQQAGIGILLALTTAICWGALPIAMKQVLEVMEPPTIVFYRFLM
FT                   ASIGLGAILAVKKRLPPLRVFRKPRWLILLAVATAGLFGNFILFSSSLQYLSPTASQVI
FT                   GQLSPVGMMVASVFILKEKMRSTQVVGALMLLSGLVMFFNTSLVEIFTKLTDYTWGVIF
FT                   GVGAATVWVSYGVAQKVLLRRLASPQILFLLYTLCTIALFPLANPGVIAQLSHWQLACL
FT                   IFCGLNTLVGYGALAEAMARWQAAQVSAIITLTPLFTLFFSDLLSLAWPDFFARPMLNL
FT                   LGYLGAFVVVAGAMYSAIGHRIWGGLRKHTTVVSQPRAGE"
FT   gene            91017..92177
FT                   /gene="obgE"
FT                   /locus_tag="UM146_00465"
FT   CDS_pept        91017..92177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="UM146_00465"
FT                   /product="GTPase ObgE"
FT                   /note="COG0536 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69522"
FT                   /protein_id="ADN69522.1"
FT                   /translation="MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   WMEADENLNTLIDYRFEKSFRAERGQNGASRDCTGKRGKDVTIKVPVGTRVIDQGTGET
FT                   MGDMTKHGQRLLVAKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRELLLELMLLADVG
FT                   MLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEKSFVVADIPGLIEGAA
FT                   EGAGLGIRFLKHLERCRVLLHLIDIDPIDGTDPVENARIIISELEKYSQDLAAKPRWLV
FT                   FNKIDLLDKVEAEEKAKAIAEALGWEDKYYLISAASGLGVKDLCWDVMTFIIENPVVQA
FT                   EEAKQPEKVEFMWDDYHRQQLEEIAEEDDEDWDEDDEEGVEFIYKR"
FT   gene            complement(92218..93651)
FT                   /locus_tag="UM146_00470"
FT   CDS_pept        complement(92218..93651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00470"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="COG2027 D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69523"
FT                   /protein_id="ADN69523.1"
FT                   /translation="MRFSRFIIGLTSCIAFSVQAANVDEYITQLPAGANLALMVQKVGA
FT                   SAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVAR
FT                   FGADPTLRRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAP
FT                   PAAAIVDRNCFSISLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVV
FT                   PGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKDELKQAGITWSGTLLRQTQVN
FT                   EPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQIL
FT                   RQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSL
FT                   QYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTVSGQRMAFVQYLSGYAVEPADQRNR
FT                   RIPLVRFESRLYKDIYQNN"
FT   gene            93899..94375
FT                   /gene="greA"
FT                   /locus_tag="UM146_00475"
FT   CDS_pept        93899..94375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="UM146_00475"
FT                   /product="transcription elongation factor GreA"
FT                   /note="COG0782 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69524"
FT                   /protein_id="ADN69524.1"
FT                   /translation="MQAIPMTLRGAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIKDIEAKLSNAQVIDVTKMPNNGRVIFGATVTVLNLDSDEEQT
FT                   YRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVVVIKTPGGEVEFEVIKVEYL"
FT   gene            complement(94531..94824)
FT                   /locus_tag="UM146_00480"
FT   CDS_pept        complement(94531..94824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00480"
FT                   /product="RNA-binding protein YhbY"
FT                   /note="COG1534 Predicted RNA-binding protein containing KH
FT                   domain, possibly ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69525"
FT                   /protein_id="ADN69525.1"
FT                   /translation="MNLSTKQKQHLKGLAHPLKPVVLLGSNGLTEGVLAEIEQALEHHE
FT                   LIKVKIATEDRETKTLIVEAIVRETGACNVQVIGKTLVLYRPTKERKISLPR"
FT   gene            94950..95579
FT                   /gene="rrmJ"
FT                   /locus_tag="UM146_00485"
FT   CDS_pept        94950..95579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="UM146_00485"
FT                   /product="23S rRNA methyltransferase J"
FT                   /note="COG0293 23S rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69526"
FT                   /protein_id="ADN69526.1"
FT                   /translation="MTGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQS
FT                   DKLFKPGMTVVDLGAAPGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDEL
FT                   VMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVV
FT                   KVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP"
FT   gene            95679..97613
FT                   /gene="hflB"
FT                   /locus_tag="UM146_00490"
FT   CDS_pept        95679..97613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="UM146_00490"
FT                   /product="ATP-dependent metalloprotease"
FT                   /note="COG0465 ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69527"
FT                   /protein_id="ADN69527.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRKVDYSTFLQEVNNDQ
FT                   VREARINGREINVTKKDSNRYTTYIPVQDPKLLDNLLTKNVKVVGEPPEEPSLLASIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEE
FT                   VAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   APDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISAS
FT                   RQKLESQISTLYGGRLAEEIIYGPEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLL
FT                   YAEEEGEVFLGRSVAKAKHMSDETARIIDQEVKALIERNYNRARQLLTDNMDILHAMKD
FT                   ALMKYETIDAPQIDDLMARRDVRPPAGWEEPGASNNSGDNGSPKAPRPVDEPRTPNPGN
FT                   TMSEQLGDK"
FT   gene            97703..98551
FT                   /gene="folP"
FT                   /locus_tag="UM146_00495"
FT   CDS_pept        97703..98551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="UM146_00495"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="COG0294 Dihydropteroate synthase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69528"
FT                   /protein_id="ADN69528.1"
FT                   /translation="MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLLDAVKHAN
FT                   LMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIR
FT                   ESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNR
FT                   YFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKS
FT                   MIGQLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRY
FT                   E"
FT   gene            98544..99881
FT                   /gene="glmM"
FT                   /locus_tag="UM146_00500"
FT   CDS_pept        98544..99881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="UM146_00500"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COG1109 Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69529"
FT                   /protein_id="ADN69529.1"
FT                   /translation="MSNRKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PFYDNGIKFFSIDGTKLPDAVEEAIEAEMEKEISCVDSAELGKASRIVDAAGRYIEFCK
FT                   ATFPNELSLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDV
FT                   RALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRGGAV
FT                   GTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGD
FT                   GIVAGLQVLAAMARNHMSLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVE
FT                   AALGSRGRVLLRKSGTEPLIRVMVEGEDEAQVTEFAHRIADAVKAV"
FT   gene            100109..100441
FT                   /gene="secG"
FT                   /locus_tag="UM146_00505"
FT   CDS_pept        100109..100441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="UM146_00505"
FT                   /product="preprotein translocase subunit SecG"
FT                   /note="COG1314 Preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69530"
FT                   /protein_id="ADN69530.1"
FT                   /translation="MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGS
FT                   SGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKP
FT                   TSDIPN"
FT   gene            100456..100542
FT                   /locus_tag="UM146_t23819"
FT   tRNA            100456..100542
FT                   /locus_tag="UM146_t23819"
FT                   /product="tRNA-Leu"
FT   gene            100995..102620
FT                   /locus_tag="UM146_00510"
FT   CDS_pept        100995..102620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00510"
FT                   /product="putative hydrolase, inner membrane"
FT                   /note="COG2194 Predicted membrane-associated,
FT                   metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69531"
FT                   /protein_id="ADN69531.1"
FT                   /translation="MTVFNKFVRSFKSHWLLYLCVIVFGITNLVASSGAHMVQRLLFFV
FT                   LTILVVKRISSLPLRLLIAVPFVLLTAADMSISLYSWCIFGTTFNDGFAISVLQSDPDE
FT                   VVKMLGMYIPYLCAFAFLSLLFFAVIIKYDVSLPTKKVTGILLLIVISGSLFSACQFAY
FT                   KDAKNKEAFSPYILASRFATYTPFFNLNYFALAAKEHQRLLSIANTVPYFQLSVRDTGI
FT                   DTYVLIVGESVRVDNMSLYGYTRSTTPQVEAQRKQIKLFNQAISGAPYTALSVPLSLTA
FT                   DSVLSHDIHNYPDNIINMANQAGFQTFWLSSQSAFRQNGTAVTSIAMRAMETVYVRGFD
FT                   ELLLPHLSQALQQKTQQKKLIVLHLNGSHEPACSAYPQSSAVFQPQDDQDACYDNSIHY
FT                   TDSLLGQVFELLKDRRASVMYFADHGLERDPTKKNVYFHGGREASQQAYHVPMFIWYSP
FT                   VLGDGVDRTTENDIFSTAYNNYLINAWMGVTKPEQPQTLEEVIAHYKGDSRVVDANHDV
FT                   FDFVMLRKEFTEDKQGNPTPEGQG"
FT   gene            complement(102628..103971)
FT                   /locus_tag="UM146_00515"
FT   CDS_pept        complement(102628..103971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00515"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COG0137 Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69532"
FT                   /protein_id="ADN69532.1"
FT                   /translation="MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANL
FT                   GQPDEEDYDAIPRRAMEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFI
FT                   DELGGRHEMSEFMIACGFDYKMSVEKAYSTDSNMLGATHEAKDLEYLNSSVKIVNPIMG
FT                   VKFWDESVKIPAEEVTVRFEQGHPVALNGKTFSDDVEMLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLLTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDSQ
FT                   ALMLRDSLQRWVASQITGEVTLELRRGNDYSILNTVSENLTYKPERLTMEKGDSVFSPD
FT                   DRIGQLTMRNLDITDTREKLFGYAKTGLLSSSATSGVPQVENLENKGQ"
FT   gene            104319..104395
FT                   /locus_tag="UM146_t23821"
FT   tRNA            104319..104395
FT                   /locus_tag="UM146_t23821"
FT                   /product="tRNA-Met"
FT   gene            104632..105054
FT                   /locus_tag="UM146_00520"
FT   CDS_pept        104632..105054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00520"
FT                   /product="hypothetical protein"
FT                   /note="COG0779 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69533"
FT                   /protein_id="ADN69533.1"
FT                   /translation="MITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVS
FT                   HQVSAVLDVEDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVTLVLRMAVQNRRKWQ
FT                   GVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHF"
FT   gene            105082..106569
FT                   /gene="nusA"
FT                   /locus_tag="UM146_00525"
FT   CDS_pept        105082..106569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="UM146_00525"
FT                   /product="transcription elongation factor NusA"
FT                   /note="COG0195 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69534"
FT                   /protein_id="ADN69534.1"
FT                   /translation="MNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDV
FT                   RVQIDRKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNISLDLGNNAEAVIL
FT                   REDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMT
FT                   VDDLQAKHQAEAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLD
FT                   EPTVEALRERAKNALATIAQAQEESLGDNKPADDLLNLEGVDRDLAFKLAARGVCTLED
FT                   LAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA"
FT   gene            106594..109266
FT                   /gene="infB"
FT                   /locus_tag="UM146_00530"
FT   CDS_pept        106594..109266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="UM146_00530"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69535"
FT                   /protein_id="ADN69535.1"
FT                   /translation="MTDVTIKTLAAERQTSVERLVQQFADAGIRKSADDSVSAQEKQTL
FT                   IDHLNQKNSGPDKLTLQRKTRSTLNIPGTGGKSKSVQIEVRKKRTFVKRDPQEAERLAA
FT                   EEQAQREAEEQARREAEESAKREAQQKAEREAAEQAKREAAEQAKREAAEKDKVSNQQD
FT                   DMTKNAQAEKARREQEAAELKRKAEEEARRKLEEEARRVAEEARRMAEENKWTDNAEPT
FT                   EDSSDYHVTTSQHARQAEDESDREVEGGRGRGRNAKAARPKKGNKHAESKADREEARAA
FT                   VRGGKGGKRKGSSLQQGFQKPAQAVNRDVVIGETITVGELANKMAVKGSQVIKAMMKLG
FT                   AMATINQVIDQETAQLVAEEMGHKVILRRENELEEAVMSDRDTGAAAEPRAPVVTIMGH
FT                   VDHGKTSLLDYIRSTKVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTSMRARG
FT                   AQATDIVVLVVAADDGVMPQTIEAIQHAKAAGVPVVVAVNKIDKPEADPDRVKNELSQY
FT                   GILPEEWGGESQFVHVSAKAGTGIDELLDAILLQAEVLELKAVRKGMASGAVIESFLDK
FT                   GRGPVATVLVREGTLHKGDIVLCGFEYGRVRAMRNELGQEVLEAGPSIPVEILGLSGVP
FT                   AAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANMTEGEVHEVNIVLK
FT                   ADVQGSVEAISDSLLKLSTDEVKVKIIGSGVGGITETDATLAAASNAILVGFNVRADAS
FT                   ARKVIEAESLDLRYYSVIYNLIDEVKAAMSGMLSPELKQQIIGLAEVRDVFKSPKFGAI
FT                   AGCMVTEGVVKRHNPIRVLRDNVVIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDV
FT                   RTGDVIEVFEIIEIQRTIA"
FT   gene            109430..109831
FT                   /gene="rbfA"
FT                   /locus_tag="UM146_00535"
FT   CDS_pept        109430..109831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="UM146_00535"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69536"
FT                   /protein_id="ADN69536.1"
FT                   /translation="MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSR
FT                   DLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLV
FT                   EGMRMSNLVTSVVKHDEERRVNPDDSKED"
FT   gene            109831..110775
FT                   /gene="truB"
FT                   /locus_tag="UM146_00540"
FT   CDS_pept        109831..110775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="UM146_00540"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COG0130 Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69537"
FT                   /protein_id="ADN69537.1"
FT                   /translation="MSRPRRRGRDINGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTG
FT                   ALDPLATGMLPICLGEATKFSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEERPVTFS
FT                   AEQLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYELLFIRH
FT                   EGNELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHLREL
FT                   VEQAEQQDIPAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRTSGAPLEGLV
FT                   RVTEGENGKFIGMGEIDDEGRVAPRRLVVEYPA"
FT   gene            110924..111193
FT                   /gene="rpsO"
FT                   /locus_tag="UM146_00545"
FT   CDS_pept        110924..111193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="UM146_00545"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG0184 Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69538"
FT                   /protein_id="ADN69538.1"
FT                   /translation="MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR"
FT   gene            111440..113575
FT                   /locus_tag="UM146_00550"
FT   CDS_pept        111440..113575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00550"
FT                   /product="polynucleotide phosphorylase/polyadenylase"
FT                   /note="COG1185 Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69539"
FT                   /protein_id="ADN69539.1"
FT                   /translation="MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVV
FT                   GQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPIRPLFP
FT                   EGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVL
FT                   NPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINEL
FT                   VKEAGKPRWDWQPEPVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSETIATL
FT                   LAEDETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPKRR
FT                   EIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKE
FT                   IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVI
FT                   RALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRVYNGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATE
FT                   QSQPAAAPEAPAAEQGE"
FT   gene            113684..114568
FT                   /locus_tag="UM146_00555"
FT   CDS_pept        113684..114568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00555"
FT                   /product="lipoprotein NlpI"
FT                   /note="COG4785 Lipoprotein NlpI, contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69540"
FT                   /protein_id="ADN69540.1"
FT                   /translation="MKPFLRWCFVATALTLAGCSNTSWRKSEVLAVPLQPTLQQEVILA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPND
FT                   PFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKAD
FT                   ATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLL
FT                   GQDQDDLAESDQQ"
FT   gene            114748..116637
FT                   /locus_tag="UM146_00560"
FT   CDS_pept        114748..116637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00560"
FT                   /product="ATP-dependent RNA helicase DeaD"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69541"
FT                   /protein_id="ADN69541.1"
FT                   /translation="MAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRD
FT                   VLGMAQTGSGKTAAFSLPLLQNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGV
FT                   NVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQ
FT                   SYWTVWGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQ
FT                   ALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAG
FT                   RAGRALLFVENRERRLLRNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLESSD
FT                   LDQYRALLSKIQPTAEGEELDLETLAAALLKMAQGERTLIVPPDAPMRPKREFRDRDDR
FT                   GPRDRNDRGPRGDREDRPRRERRDVGDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSR
FT                   YIGNIKLFASHSTIELPKGMPGEVLQHFTRTRILNKPMNMQLLGDAQPHTGGERRGGGR
FT                   GFGGERREGGRNFSGERREGGRGDGRRFSGERREGRAPRRDDSTGRRRFGGDA"
FT   gene            116875..118035
FT                   /locus_tag="UM146_00565"
FT   CDS_pept        116875..118035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00565"
FT                   /product="tryptophan permease"
FT                   /note="COG0814 Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69542"
FT                   /protein_id="ADN69542.1"
FT                   /translation="MFSLPVVMSGAWFFWSMAALIFTWFCMLHSGLMILEANLNYRIGS
FT                   SFDTITKDLLGKGWNVVNGISIAFVLYILTYAYISASGSILHHTFAEMSLNVPARAAGF
FT                   GFALLVAFVVWLSTKAVSRMTAIVLGAKVITFFLTFGSLLGHVQPATLFNVAESNASYA
FT                   PYLLMTLPFCLASFGYHGNVPSLMKYYGKDPKTIVKCLVYGTLMALALYTIWLLATMGN
FT                   IPRPEFIGIAEKGGNIDVLVQALSGVLNSRSLDLLLVVFSNFAVASSFLGVTLGLFDYL
FT                   ADLFGFDDSAMGRLKTALLTFAPPVVGGLLFPNGFLYAIGYAGLAATIWAAIVPALLAR
FT                   ASRKRFGSPKFRVWGGKPMIMLILVFGVGNALVHILSSFNVLPVYQ"
FT   gene            complement(118153..119160)
FT                   /locus_tag="UM146_00570"
FT   CDS_pept        complement(118153..119160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00570"
FT                   /product="hypothetical protein"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69543"
FT                   /protein_id="ADN69543.1"
FT                   /translation="MTDKTIAFSLLDLAPIPEGSSARDAFSHSLDLARLAEKRGYHRYW
FT                   LAEHHNMTGIASAATSVLIGYLAANTTTLHLGSGGVMLPNHSPLVIAEQFGTLNTLYPG
FT                   RIDLGLGRAPGSDQRTMMALRRHMSGDIDNFPRDVAELVDWFDARDPNPHVRPVPGYGE
FT                   KIPVWLLGSSLYSAQLAAQLGLPFAFASHFAPDMLFQALHLYRSNFKPSARLEKPYAMV
FT                   CINIIAADSNRDAEFLFTSMQQAFVKLRRGETGQLPPPIQNMDQFWSPSEQYGVQQALS
FT                   MSLVGDKAKVRHGLQSILRETDADEIMVNGQIFDHQARLHSFELAMDVKEELLG"
FT   gene            complement(119241..120119)
FT                   /locus_tag="UM146_00575"
FT   CDS_pept        complement(119241..120119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00575"
FT                   /product="putative protease"
FT                   /note="COG0826 Collagenase and related proteases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69544"
FT                   /protein_id="ADN69544.1"
FT                   /translation="MKYSLGPVLWYWPKETLEEFYQQAAASSADVIYLGEAVCSKRRAT
FT                   KVGDWLEMAKSLAGSGKQIVLSTLALVQASSELGELKRYVENGEFLIEASDLGVVNMCA
FT                   ERKLPFVAGHALNCYNAVTLKILLKQGMMRWCMPVELSRDWLVNLLNQCDELGIRNQFE
FT                   VEVLSYGHLPLAYSARCFTARSEDRPKDECETCCIKYPNGRNVLSQENQQVFVLNGIQT
FT                   MSGYVYNLGNELASMQGLVDVVRLSPQGTDTFAMLDAFRANENGAAPLPLTANSDCNGY
FT                   WRRLAGLELQA"
FT   gene            complement(120128..121123)
FT                   /locus_tag="UM146_00580"
FT   CDS_pept        complement(120128..121123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00580"
FT                   /product="peptidase (collagenase-like) protein"
FT                   /note="COG0826 Collagenase and related proteases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69545"
FT                   /protein_id="ADN69545.1"
FT                   /translation="MELLCPAGNLPALKAAIENGADAVYIGLKDDTNARHFAGLNFTEK
FT                   KLQEAVSFVHQHRRKLHIAINTFAHPDGYARWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPHIERHVSVQASATNEEAINFYHRHFDVARVVLPRVLSIHQVKQLARVTPVPLEVF
FT                   AFGSLCIMSEGRCYLSSYLTGESPNTVGACSPARFVRWQQTPQGLESRLNEVLIDRYQD
FT                   GENAGYPTLCKGRYLVNGERYHALEEPTSLNTLELLPELMAANIASVKIEGRQRSPAYV
FT                   SQVAKVWRQAIDRCKADPQNFIPQSAWMETLGSMSEGTQTTLGAYHRKWQ"
FT   gene            121332..121856
FT                   /locus_tag="UM146_00585"
FT   CDS_pept        121332..121856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00585"
FT                   /product="hypothetical protein"
FT                   /note="COG3154 Putative lipid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69546"
FT                   /protein_id="ADN69546.1"
FT                   /translation="MLDKLRSRIVHLGPSLLSVPVKLTPFALKRQVLEQVLSWQFRQAL
FT                   DDGELEFLEGRWLSIHVRDIDLQWFTSVVNGKLVVSQNAQADVSFSADASDLLMIAARK
FT                   QDPDTLFFQRRLVIEGDTELGLYVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAP
FT                   ETKQTSVGEPC"
FT   gene            121850..122353
FT                   /locus_tag="UM146_00590"
FT   CDS_pept        121850..122353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00590"
FT                   /product="hypothetical protein"
FT                   /note="COG3153 Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69547"
FT                   /protein_id="ADN69547.1"
FT                   /translation="MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLV
FT                   ATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFG
FT                   YAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEH
FT                   FNRF"
FT   gene            complement(122340..122642)
FT                   /locus_tag="UM146_00595"
FT   CDS_pept        complement(122340..122642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00595"
FT                   /product="GIY-YIG nuclease superfamily protein"
FT                   /note="COG2827 Predicted endonuclease containing a URI
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69548"
FT                   /protein_id="ADN69548.1"
FT                   /translation="MTPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGE
FT                   LTLAFSAPVGDRSLALRAEYRVKQLTKRQKERLVAEGAVFAELLSSLQTPEIKSD"
FT   gene            122693..123136
FT                   /locus_tag="UM146_00600"
FT   CDS_pept        122693..123136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00600"
FT                   /product="hypothetical protein"
FT                   /note="COG3787 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69549"
FT                   /protein_id="ADN69549.1"
FT                   /translation="METLTAISRWLAKQHVVTWCVQQEGELWCANAFYLFDAQKVAFYI
FT                   LTEEKTRHAQMSGPQAAIAGTVNGQPKTVALIRGVQFKGEIRRLEGEESDLARKAYNRR
FT                   FPVARMLSAPVWEIRLDEIKFTDNTLGFGKKMIWLRNSGTEQA"
FT   gene            complement(123116..123634)
FT                   /locus_tag="UM146_00605"
FT   CDS_pept        complement(123116..123634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00605"
FT                   /product="putative intracellular protease"
FT                   /note="COG0693 Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69550"
FT                   /protein_id="ADN69550.1"
FT                   /translation="MSKKIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKG
FT                   KKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAIC
FT                   HGPQLLISADVILGRKLTAVKPIVIDVKNAGAEFYDQEVVVDKDQLVTSRTPDDLPAFN
FT                   REALRLLGA"
FT   gene            123762..124397
FT                   /locus_tag="UM146_00610"
FT   CDS_pept        123762..124397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00610"
FT                   /product="putative nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69551"
FT                   /protein_id="ADN69551.1"
FT                   /translation="MSQVLITGATGLVGGHLLRMLINEPKVNAIAAPTRRPLGDMPGVF
FT                   NPHDPQLTDALAQVTDPIDIVFCCLGTTRREAGSKEAFIHADYTLVVDTALTGRRLGAQ
FT                   HMLVVSAMGANAHSPFFYNRVKGEMEEALIAQNWPKLTIARPSMLLGDRSKQRMNETLF
FT                   APLFRLLPGNWKSIDARDVARVMLAEAMRPEHEGVTILSSSELRKRAE"
FT   gene            124470..125510
FT                   /locus_tag="UM146_00615"
FT   CDS_pept        124470..125510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00615"
FT                   /product="putative permease"
FT                   /note="COG0701 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69552"
FT                   /protein_id="ADN69552.1"
FT                   /translation="MTGQSSSQAATPIQWWKPALFFLVVIAGLWYVKWQPYYGKAFTAA
FT                   ETHSIGKSILAQADANPWQAALNYAMIYFLAVWKAAVLGVILGSLIQVLIPRDWLLRTL
FT                   GQSRFRGTLLGTLFSLPGMMCTCCAAPVAAGMRRQQASMGGALAFWMGNPLLNPATLVF
FT                   MGFVLGWDFAAIRLVAGLVMVLLIATLVQKWVRETPQTQAPVEIDIPEAQGGFFSRWGR
FT                   ALWTLFWSTIPVYILAVLVLGAARVWLFPHADGAVDNSLMWVVAMAVAGCLFVIPTAAE
FT                   IPIVQTMMLAGMGTAPALALLMTLPAVSLPSLIMLRKAFPTKALWLTGAMVAVSGVIVG
FT                   GLALLV"
FT   gene            complement(125623..126198)
FT                   /locus_tag="UM146_00620"
FT   CDS_pept        complement(125623..126198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00620"
FT                   /product="hypothetical protein"
FT                   /note="COG2823 Predicted periplasmic or secreted
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69553"
FT                   /protein_id="ADN69553.1"
FT                   /translation="MKALSPIAVLISALLLQGCVAAAVVGTAAVGTKAATDPRSVGTQV
FT                   DDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLVGQSPNAELSARAKQIAMGVDGA
FT                   NEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSSNVKVTTENGEVFLMGLVT
FT                   EREAKAAADIASRVSGVKRVTTAFTFIK"
FT   gene            complement(126208..126798)
FT                   /locus_tag="UM146_00625"
FT   CDS_pept        complement(126208..126798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00625"
FT                   /product="DnaA initiator-associating protein DiaA"
FT                   /note="COG0279 Phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69554"
FT                   /protein_id="ADN69554.1"
FT                   /translation="MQERIKACFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKIL
FT                   CCGNGTSAANAQHFAASMINRFETERPSLPAIALNTDNVVLTAIANDRLHDEVYAKQVR
FT                   ALGHAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRI
FT                   PSHRSARIQEMHMLTVNCLCDLIDNTLFPHQDV"
FT   gene            complement(126818..127213)
FT                   /locus_tag="UM146_00630"
FT   CDS_pept        complement(126818..127213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00630"
FT                   /product="hypothetical protein"
FT                   /note="COG0792 Predicted endonuclease distantly related to
FT                   archaeal Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69555"
FT                   /protein_id="ADN69555.1"
FT                   /translation="MATVPTRSGSPRQLTTKQTGDAWEAQARRWLEGKGLRFIAANVNE
FT                   RGGEIDLIMREGRTTVFIEVRYRRSALYGGAAASVTRSKQHKLLQTARLWLARHNGSFD
FT                   TVDCRFDVVAFTGNEVEWIKDAFNDHS"
FT   gene            complement(127171..129207)
FT                   /locus_tag="UM146_00635"
FT   CDS_pept        complement(127171..129207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00635"
FT                   /product="hypothetical protein"
FT                   /note="COG3107 Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69556"
FT                   /protein_id="ADN69556.1"
FT                   /translation="MVPSTFSRLKAARCLPVVLAALIFAGCGTHTPDQSTAYMQGTAQA
FT                   DSAFYLQQMQQSSDDTRINWQLLAIRALVKEGKTGQAVELFNQLPQELNDTQRREKTLL
FT                   AAEIKLAQKDFAGAQNLLAKITPADLEQNQQARYWQAKIDASQGRPSIDLLRALIAQEP
FT                   LLGAKEKQQNIDATWQALSSMTQEQANTLVINADENILQGWLDLQRVWFDNRNDPDMMK
FT                   AGIADWQKRYPNNPGAKMLPTQLVNVKAFKPASTNKIALLLPLNGQAAVFGRTIQQGFE
FT                   AAKNIGTQPVVAQVAAAPAADVAEQPQPQTVDGVASPAQASVSDLTGEQPAAQSVPVSA
FT                   PATSTAAVSAPANPSAELKIYDTSSQPLSQILSQVQQDGASIVVGPLLKNNVEELLKSN
FT                   TPLNVLALNQPENIENRVNICYFALSPEDEARDAARHIRDQGKQAPLVLIPRSSLGDRV
FT                   ANAFAQEWQKLGGGTVLQQKFGSTSELRAGVNGGSGIALTGSPITPRETTDSGMTTNNP
FT                   TLQTTPTDDQFTNNGGRVDAVYIVATPGEIAFIKPMIAMRNGSQSGATLYASSRSAQGT
FT                   AGPDFRLEMEGLQYSEIPMLAGGNLPLMQQALSAVNNDYSLARMYAMGVDAWSLANHFS
FT                   QMRQVQGFEINGNTGSLTANPDCVINRKLSWLQYQQGQVVPAS"
FT   gene            129272..130135
FT                   /locus_tag="UM146_00640"
FT   CDS_pept        129272..130135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00640"
FT                   /product="putative methyltransferase"
FT                   /note="COG0313 Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69557"
FT                   /protein_id="ADN69557.1"
FT                   /translation="MKQHQSADNSQGQLYIVPTPIGNLADITQRALEVLQAVDLIAAED
FT                   TRHTGLLLQHFGINARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYH
FT                   LVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEP
FT                   RTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDEN
FT                   RRKGEMVLIVEGHKAQEEDLPADALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYA
FT                   LEQQGE"
FT   gene            complement(130185..130952)
FT                   /locus_tag="UM146_00645"
FT   CDS_pept        complement(130185..130952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00645"
FT                   /product="galactosamine-6-phosphate isomerase"
FT                   /note="COG0363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69558"
FT                   /protein_id="ADN69558.1"
FT                   /translation="MERGTASGGASLLKEFHPVQTLQQVENYTALSERASEYLLAVIRR
FT                   KPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTCETFLQ
FT                   QHIVQPLGLREDQLISFHSEEINETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPG
FT                   ESLQPACHISQLDARTQQHEMLKTADRPVTRGITLGLKDILNAREVLLLVTGEGKQDAT
FT                   ERFLTAKVSTAIPASFLWLHNYFTCMIDEMCRR"
FT   gene            complement(130953..131744)
FT                   /locus_tag="UM146_00650"
FT   CDS_pept        complement(130953..131744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00650"
FT                   /product="N-acetylgalactosamine-specific PTS system
FT                   transporter subunit IID"
FT                   /note="COG3716 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69559"
FT                   /protein_id="ADN69559.1"
FT                   /translation="MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKI
FT                   YKDDKPGLSAAMKDNLEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAG
FT                   IGDAIFWFTLLPIMAGICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAI
FT                   DKVRENSQMIARSATILGITVIGGLIASYVHINVVTSFAIDSTHSVALQQDFFDKVFPN
FT                   ILPMAYTLLMYYFLRVKKAHPVLLIGVTFVLSIVCSAFGIL"
FT   gene            complement(131734..132537)
FT                   /locus_tag="UM146_00655"
FT   CDS_pept        complement(131734..132537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00655"
FT                   /product="N-acetylgalactosamine-specific PTS system
FT                   transporter subunit IIC"
FT                   /note="COG3715 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69560"
FT                   /protein_id="ADN69560.1"
FT                   /translation="MHEITLLQGLSLAALVFFLGIDFWLEALFLFRPIIVCTLTGAILG
FT                   DIQTGLITGGLTELAFAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFS
FT                   LLMQYVILFFYSAFSLFMTKADKCAKEADTAAFSRLNWATMLIVASAYAVIAFLCTYLA
FT                   QGAMQALVKAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQV
FT                   SNLLPVAVLGAGFAVYEFFNAKSRQQAQPQPVASKNEEEDYSNGI"
FT   gene            complement(132576..133052)
FT                   /locus_tag="UM146_00660"
FT   CDS_pept        complement(132576..133052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00660"
FT                   /product="N-acetylgalactosamine-specific PTS system
FT                   transporter subunit IIB"
FT                   /note="COG3444 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69561"
FT                   /protein_id="ADN69561.1"
FT                   /translation="MSSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDI
FT                   QQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKD
FT                   VNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD"
FT   gene            complement(133219..134079)
FT                   /gene="kbaY"
FT                   /locus_tag="UM146_00665"
FT   CDS_pept        complement(133219..134079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaY"
FT                   /locus_tag="UM146_00665"
FT                   /product="tagatose-bisphosphate aldolase"
FT                   /note="COG0191 Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69562"
FT                   /protein_id="ADN69562.1"
FT                   /translation="MSIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPV
FT                   ILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMID
FT                   GSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEAKRF
FT                   VELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTI
FT                   ELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSA
FT                   NRISA"
FT   gene            complement(134092..135246)
FT                   /locus_tag="UM146_00670"
FT   CDS_pept        complement(134092..135246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00670"
FT                   /product="tagatose-6-phosphate ketose/aldose isomerase"
FT                   /note="COG2222 Predicted phosphosugar isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69563"
FT                   /protein_id="ADN69563.1"
FT                   /translation="MPENYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFL
FT                   EPLLRKENLRIILTGAGTSAFIGDIIAPWLASHTGKNFSAVPTTDLVTNPMDYLNPAHP
FT                   LLLISFGRSGNSPESVAAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLMPA
FT                   ETHDRGFAMTSSITTMMASCLAVFAPETINSQTFRDVADRCQAILTSLGDFSEGVFGYA
FT                   PWKRIVYLGSGGLQGAARESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDNETLVVVF
FT                   VSSHPYTRQYDLDLLAELRRDNQAMRVIAIAAESNDVIAAGPHIILPPSRHFIDVEQAF
FT                   CFLMYAQTFALMQSLHMGNTPDTPSASGTVNRVVQGVIIHPWQA"
FT   gene            complement(135595..136728)
FT                   /locus_tag="UM146_00675"
FT   CDS_pept        complement(135595..136728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00675"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="COG1820 N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69564"
FT                   /protein_id="ADN69564.1"
FT                   /translation="MTHVLRARRLLTEEGWLDDHQLRIADGVIAAIEPIPVGVTERDAE
FT                   LLCPAYIDTHVHGGAGVDVMDDAPDVLDKLAMHKAREGVGSWLPTTVTAPLNTIHAALE
FT                   RIAQRCQRGGPGAQVLGSYLEGPYFTPQNKGAHPPELFRELEIAELDQLIAVSQHTLRV
FT                   VALAPEKEGALQAIRHLKQQNVRVMLGHSAATWQQTRAAFDAGADGLVHCYNGMTGLHH
FT                   REPGMVGAGLTDKRAWLELIADGHHVHPAAMSLCCCCAKERIVLITDAMQAAGMPDGHY
FT                   TLCGEEVQMRGGVVRTASGGLAGSTLSVDAAVRNMVELTGVTPAEAIHMASLHPARMLG
FT                   VDGVLGSLKPGKRASVVALDSGLHVQQIWIQGQLASF"
FT   gene            complement(136725..137159)
FT                   /locus_tag="UM146_00680"
FT   CDS_pept        complement(136725..137159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00680"
FT                   /product="PTS system, mannose/sorbose-specific, IIA
FT                   component"
FT                   /note="COG2893 Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69565"
FT                   /protein_id="ADN69565.1"
FT                   /translation="MLSIILTGHGGFASGMEKAMKQILGEQSQFIAIDFPETSSTALLT
FT                   SQLEEAIAQLDCEDGIVFLTDLLGGTPFRVASTLAMQKPGCEVITGTNLQLLLEMVLER
FT                   EGLSGEEFRVQALECGHRGLTSLVDELGRCHEECPVEEGI"
FT   gene            complement(137177..138055)
FT                   /locus_tag="UM146_00685"
FT   CDS_pept        complement(137177..138055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00685"
FT                   /product="putative hexose/hexosamine family PTS permease
FT                   IID component"
FT                   /note="COG3716 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69566"
FT                   /protein_id="ADN69566.1"
FT                   /translation="MASNQTTLPNVSENEETLLTGVNENVYEDQSIGAELTKKDINRVA
FT                   WRSMLLQASFNYERMQASGWLYGLLPALKKIHTNKRDLARAMKGHMGFFNTHPFLVTFV
FT                   IGIILAMERSKQDVNSIQSTKIAVGAPLGGIGDAMFWLTLLPICGGIGASLALQGSILG
FT                   AVVFIVLFNVVHLGLRFGLAHYAYRMGVAAIPLIKANTKKVGHAASIVGMTVIGALVAT
FT                   YVRLSTTLEITAGDAVVKLQADVIDKLMPAFLPLVYTLTMFWLVRRGWSPLRLIAITVV
FT                   LGIVGKFCHFL"
FT   gene            complement(138045..138824)
FT                   /locus_tag="UM146_00690"
FT   CDS_pept        complement(138045..138824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00690"
FT                   /product="N-acetylgalactosamine-specific enzyme IIC
FT                   component of PTS"
FT                   /note="COG3715 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69567"
FT                   /protein_id="ADN69567.1"
FT                   /translation="MEISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGD
FT                   LHTGILTGGTLELVWMGLAPLAGAQPPNVIIGTIVGTAFAITTGVKPDVAVGVAVPFAV
FT                   AVQMGITFLFSVMSGVMSRCDRMAENADTRGIERVNYLALLALGTFYFLCAFLPIYFGA
FT                   EHAKTIIDVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP
FT                   VLAIAAAALAMALIDLLRKSPEPTQPAAQKEEFEDGI"
FT   gene            complement(138835..139308)
FT                   /locus_tag="UM146_00695"
FT   CDS_pept        complement(138835..139308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00695"
FT                   /product="N-acetylgalactosamine-specific PTS system
FT                   transporter subunit IIB"
FT                   /note="COG3444 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69568"
FT                   /protein_id="ADN69568.1"
FT                   /translation="MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDLVQQ
FT                   NLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINV
FT                   GNMHYANGKQQIAKTVSVDAGDIAAFNDLKAAGVECFVQGVPTEPAVDLFKLL"
FT   gene            complement(139331..140611)
FT                   /locus_tag="UM146_00700"
FT   CDS_pept        complement(139331..140611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00700"
FT                   /product="tagatose 6-phosphate aldolase 1, kbaZ subunit"
FT                   /note="COG4573 Predicted tagatose 6-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69569"
FT                   /protein_id="ADN69569.1"
FT                   /translation="MKHLTEMVRQHKAGKTNGIYAVCSAHPLVLEAAIRYASANQTPLL
FT                   IEATSNQVDQFGGYTGMTPADFRGFVCQLADSLNFPQDALILGGDHLGPNRWQNLPAAQ
FT                   AMANADDLIKSYVAAGFKKIHLDCSMSCQDDPIPLTDDIVAERAARLAKVAEETCREHF
FT                   GEADLEYVIGTEVPVPGGAHETLSELAVTTPDAARATLEAHRHAFEKQGLNAIWPRIIA
FT                   LVVQPGVEFDHTNVIDYQPAKAAALSQMVENYETLIFEAHSTDYQTPQSLRQLVIDHFA
FT                   ILKVGPALTFALREALFSLAAIEEELVPAKACSGLRQVLENVMLDRPEYWQSHYHGDGN
FT                   ARRLARGYSYSDRVRYYWPDSQIDDAFAHLVRNLADSPIPLPLISQYLPLQYVKVRSGE
FT                   LQPTPRELIINHIQDILAQYHTACEGQ"
FT   gene            140860..141684
FT                   /locus_tag="UM146_00705"
FT   CDS_pept        140860..141684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00705"
FT                   /product="DNA-binding transcriptional regulator AgaR"
FT                   /note="COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69570"
FT                   /protein_id="ADN69570.1"
FT                   /translation="MSNTDASGEKRVTGTSERREQIIQRLRQQGSVQVNDLSALYGVST
FT                   VTIRNDLAFLEKQGIAVRAYGGALICDSTTPSVEPSVEDKSALNTAMKRSVAKAAVELI
FT                   QPGHRVILDSGTTTFEIARLMRKHTDVIAMTNGMNVANALLEAEGVELLMTGGHLRRQS
FT                   QSFYGDQAEQSLQNYHFDMLFLGVDAIDLERGVSTHNEDEARLNRRMCEVAERIIVVTD
FT                   SSKFNRSSLHKIIDTQRIDMIIVDEGIPSDSLEGLRKAGVEVILVGDHASSL"
FT   gene            complement(141736..143307)
FT                   /locus_tag="UM146_00710"
FT   CDS_pept        complement(141736..143307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00710"
FT                   /product="(D)-galactarate dehydrogenase"
FT                   /note="COG2721 Altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69571"
FT                   /protein_id="ADN69571.1"
FT                   /translation="MANIEIRQETPTAFYIKVHDTDNVAIIVNDNGLKAGTRFPDGLEL
FT                   IEHIPQGHKVALLDIPANGEIIRYGEVIGYAVRAIPRGSWIDESMVVLPEAPPLHTLPL
FT                   ATKVPEPLPPLEGYTFEGYRNADGSVGTKNLLGITTSVHCVAGVVDYVVKIIERDLLPK
FT                   YPNVDGVVGLNHLYGCGVAINAPAAVVPIRTIHNISLNPNFGGEVMVIGLGCEKLQPER
FT                   LLTGTDDVQAIPVESASIVSLQDEKHVGFQSMVEDILQVAECHLQKLNQRQRETCPASE
FT                   LVVGMQCGGSDAFSGVTANPAVGYASDLLVRCGATVMFSEVTEVRDAIHLLTPRAVNEE
FT                   VGKRLLEEMEWYDNYLNMGKTDRSANPSPGNKKGGLANVVEKALGSIAKSGKSAIVEVL
FT                   SPGQRPTKRGLIYAATPASDFVCGTQQVASGITVQVFTTGRGTPYGLMAVPVIKMATRT
FT                   ELANRWFDLMDINAGTIATGEETIEEVGWKLFHFILDVASGKKKTFSDQWGLHNQLAVF
FT                   NPAPVT"
FT   gene            143717..145015
FT                   /locus_tag="UM146_00715"
FT   CDS_pept        143717..145015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00715"
FT                   /product="putative (D)-galactarate transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69572"
FT                   /protein_id="ADN69572.1"
FT                   /translation="MHTRYLILLIIFIVTAVNYADRATLSIAGTEVAKELQLSAVSMGY
FT                   IFSAFGWAYLLMQIPGGWLLDKFGSKKVYTYSLFFWSLFTFLQGFVDMFPLAWAGISMF
FT                   FMRFMLGFSEAPSFPANARIVAAWFPTKERGTASAIFNSAQYFSLALFSPLLGWLTFAW
FT                   GWEHVFTVMGVIGFVLTALWIKLIHNPTDHPRMSAEELKFISENGAVVDMDHKKPGSAA
FT                   ASGPKLHYIKQLLSNRMMLGVFFGQYFINTITWFFLTWFPIYLVQEKGMSILKVGLVAS
FT                   IPALCGFAGGVLGGVFSDYLIKRGLSLTLARKLPIVLGMLLASTIILCNYTNNTTLVVM
FT                   LMALAFFGKGFGALGWPVISDTAPKEIVGLCGGVFNVFGNVASIVTPLVIGYLVSELHS
FT                   FNAALVFVGCSALMAMVCYLFVVGDIKRMELQK"
FT   gene            145031..145801
FT                   /locus_tag="UM146_00720"
FT   CDS_pept        145031..145801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00720"
FT                   /product="alpha-dehydro-beta-deoxy-D-glucarate aldolase"
FT                   /note="COG3836 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69573"
FT                   /protein_id="ADN69573.1"
FT                   /translation="MNNDVFPNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLV
FT                   LDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKE
FT                   EAEQAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDA
FT                   IAATEGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEAD
FT                   ARRYLEWGATFVAVGSDLGVFRSATQKLADTFKK"
FT   gene            145831..146721
FT                   /gene="garR"
FT                   /locus_tag="UM146_00725"
FT   CDS_pept        145831..146721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garR"
FT                   /locus_tag="UM146_00725"
FT                   /product="tartronate semialdehyde reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69574"
FT                   /protein_id="ADN69574.1"
FT                   /translation="MTMKVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAG
FT                   AETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASR
FT                   EISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTG
FT                   EIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAP
FT                   MVMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGLGMADHSA
FT                   LACYYEKLAKVEVTR"
FT   gene            146818..147963
FT                   /locus_tag="UM146_00730"
FT   CDS_pept        146818..147963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00730"
FT                   /product="glycerate kinase I"
FT                   /note="COG1929 Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69575"
FT                   /protein_id="ADN69575.1"
FT                   /translation="MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGG
FT                   EGTVEAMIAATQGAERHAWVTGPLGEKVNASWGISGDGKTAFIEMAAASGLELVPAEKR
FT                   DPLVTTSRGTGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGF
FT                   GGGSLNTLNDIDISGLDPRLKDCVIRVACDVTNPLVGDSGASRIFGPQKGASEAMIVEL
FT                   DNNLSHYADVIKKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEH
FT                   IHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTNDVGVVHQHGIDA
FT                   VFSVLTSIGTLDEAFRGAYDNICRASRNIAATLAIGMRNAG"
FT   gene            complement(148937..149293)
FT                   /locus_tag="UM146_00735"
FT   CDS_pept        complement(148937..149293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00735"
FT                   /product="DNA-binding transcriptional activator TdcR"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69576"
FT                   /protein_id="ADN69576.1"
FT                   /translation="MSKKMTGITIFYGDNIILYVVNTKKGLRLYFKQLPDNYQAKFELN
FT                   LMSKFSNFIINKPFSAINNAARHIFSRYLLENKHLFYQYFKISNTDIDHLEQLINVNLF
FT                   SSGRTSFCECNRFP"
FT   gene            149471..150409
FT                   /locus_tag="UM146_00740"
FT   CDS_pept        149471..150409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00740"
FT                   /product="DNA-binding transcriptional activator TdcA"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69577"
FT                   /protein_id="ADN69577.1"
FT                   /translation="MSTILLPKTQHLVVFQEVIRSGSIGSAAKELGLTQPAVSKIINDI
FT                   EDYFGVELVVRKNTGVTLTPAGQLLLSRSESITREMKNMVNEISGMSSEAVVEVSFGFP
FT                   SLIGFTFMSGMINKFKEVFPKAQVSMYEAQLSSFLPAIRDGRLDFAIGTLSAEMKLQDL
FT                   HVEPLFESEFVLVASKSRTCTGTTTLESLKNEQWVLPQTNMGYYSELLTTLQRNGISIE
FT                   NIVKTDSVVTIYNLVLNADFLTVIPCDMTSPFGSNQFITIPVEETLPVAQYAAVWSKNY
FT                   RIKKAASVLVELAKEYSSYNGCRRRQLIEVD"
FT   gene            150508..151497
FT                   /locus_tag="UM146_00745"
FT   CDS_pept        150508..151497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00745"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69578"
FT                   /protein_id="ADN69578.1"
FT                   /translation="MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIF
FT                   LKFENMQRTGSFKIRGAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVV
FT                   MPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQG
FT                   TIGLEIMEDLYDVDNVIVPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHS
FT                   GEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVT
FT                   EGAGALACAALLSGKLDQYIQNRKTVSIISGGNIDLSRVSQITGFVDA"
FT   gene            151519..152850
FT                   /locus_tag="UM146_00750"
FT   CDS_pept        151519..152850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00750"
FT                   /product="threonine/serine transporter TdcC"
FT                   /note="COG0814 Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69579"
FT                   /protein_id="ADN69579.1"
FT                   /translation="MSTSDSIVSSQTKQSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAG
FT                   FGGLIPILLMLVLAYPIAFYCHRALARLCLSGSNPSGNITETVEEHFGKTGGVVITFLY
FT                   FFAICPLLWIYGVTITNTFMTFWENQLGFAPLNRGFVALFLLLLMAFVIWFGKDLMVKV
FT                   MSYLVWPFIASLVLISLSLIPYWNSAVIDQVDLGSLSLTGHDGILITVWLGISIMVFSF
FT                   NFSPIVSSFVVSKREEYEKDFGRDFTERKCSQIISRASMLMVAVVMFFAFSCLFTLSPA
FT                   NMAEAKAQNIPVLSYLANHFASMTGTKTTFAITLEYAASIIALVAIFKSFFGHYLGTLE
FT                   GLNGLILKFGYKGDKTKVSLGKLNTISMIFIMGSTWVVAYANPNILDLIEAMGAPIIAS
FT                   LLCLLPMYAIRKAPSLAKYRGRLDNVFVTVIGLLTILNIVYKLF"
FT   gene            152876..154084
FT                   /locus_tag="UM146_00755"
FT   CDS_pept        152876..154084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00755"
FT                   /product="propionate/acetate kinase"
FT                   /EC_number="2.7.2.15"
FT                   /note="COG0282 Acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69580"
FT                   /protein_id="ADN69580.1"
FT                   /translation="MNEFPVVLVINCGSSSIKFSVLNASDCEVLMSGIADGINSENAFL
FT                   SVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDNVALIGHRIAHGGSIFTESAIITDEV
FT                   IDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKY
FT                   YEELGVRRYGFHGTSHRYVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTS
FT                   MGMTPLEGLMMGTRSGDVDFGAMSWVASQTNQSLGDLERVVNKESGLLGISGLSSDLRV
FT                   LEKAWHEGHERAQLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSSLIRRLVME
FT                   HLAVLGVEIDTEMNNRSNSFGERIVSSENARVICAVIPTNEEKMIALDAIHLGKVNAPA
FT                   EFA"
FT   gene            154118..156412
FT                   /locus_tag="UM146_00760"
FT   CDS_pept        154118..156412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00760"
FT                   /product="pyruvate formate-lyase 4/2-ketobutyrate
FT                   formate-lyase"
FT                   /note="COG1882 Pyruvate-formate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69581"
FT                   /protein_id="ADN69581.1"
FT                   /translation="MKVDIDTSDKLYADAWLGFKGTDWKNEINVRDFIQHNYTPYEGDE
FT                   SFLAEATPATTELWEKVMEGIRIENATHAPLDFDTNIATTITAHDAGYIDQPLEKIVGL
FT                   QTDAPLKRALHPFGGINMIRSSFHAYGREMDSEFEYIFTDLRKTHNQGVFDVYSPDMLR
FT                   CRKSGVLTGLPDGYGRGRIIGDYRRVALYGISYLVRERELQFADLQSRLEKGEDLEATI
FT                   RLREELAEHRRALLQIQEMAAKYGFDISRPAQNAQEAVQWLYFAYLAAVKSQNGGAMSL
FT                   GRTASFLDIYIERDFKAGVLNEQQAQELIDHFIMKIRMVRFLRTPEFDSLFSGDPIWAT
FT                   EVIGGMGLDGRTLVTKNSFRYLHTLHTMGPAPEPNLTILWSEALPIAFKKYAAQVSIVT
FT                   SSLQYENDDLMRTDFNSDDYAIACCVSPMVIGKQMQFFGARANLAKTLLYAINGGMDEK
FT                   LKIQVGPKTAPLMDDVLDYDKVMDSLDHFMDWLAVQYISALNIIHYMHDKYSYEASLMA
FT                   LHDRDVYRTMACGIAGLSVATDSLSAIKYARVKPIRDENGLAVDFEIDGEYPQYGNNDE
FT                   RVDSIACDLVERFMKKIKALPTYRNAVPTQSILTITSNVVYGQKTGNTPDGRRAGTPFA
FT                   PGANPMHGRDRKGAVASLTSVAKLPFTYAKDGISYTFSIVPAALGKEDPIRKTNLVGLL
FT                   DGYFHHEADVEGGQHLNVNVMNREMLLDAIEHPEKYPNLTIRVSGYAVRFNALTREQQQ
FT                   DVISRTFTQAL"
FT   gene            156426..156815
FT                   /locus_tag="UM146_00765"
FT   CDS_pept        156426..156815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00765"
FT                   /product="hypothetical protein"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69582"
FT                   /protein_id="ADN69582.1"
FT                   /translation="MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPAD
FT                   VQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPT
FT                   RSCVQVARLPKDVKLEIEAIAVRSA"
FT   gene            156887..158251
FT                   /locus_tag="UM146_00770"
FT   CDS_pept        156887..158251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00770"
FT                   /product="L-serine dehydratase 3"
FT                   /note="COG1760 L-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69583"
FT                   /protein_id="ADN69583.1"
FT                   /translation="MISAFDIFKIGIGPSSSHTVGPMNAGKSFIDRLESSGLLTATSHI
FT                   VVDLYGSLSLTGKGHATDVAIIMGLAGNSPQDVVIDEIPAFIELVTRSGRLPVASGAHI
FT                   VDFPVAKNIIFHPEMLPRHENGMRITAWKGQEELLSKTYYSVGGGFIVEEEHFGLSHDV
FT                   ETPVPYDFHSAGELLKMCDYNGLSISGLMMHNELALRSKAEIDAGFARIWQVMHDGIER
FT                   GMNTEGVLPGPLNVPRRAVALRRQLVSSDNISNDPMNVIDWINMYALAVSEENAAGGRV
FT                   VTAPTNGACGIIPAVLAYYDKFRRPVNERSIARYFLAAGAIGALYKMNASISGAEVGCQ
FT                   GEIGVACSMAAAGLTELLGGSPAQVCNAAEIAMEHNLGLTCDPVAGQVQIPCIERNAIN
FT                   AVKAVNAARMAMRRTSAPRVSLDKVIETMYETGKDMNDKYRETSRGGLAIKVVCG"
FT   gene            158525..159856
FT                   /locus_tag="UM146_00775"
FT   CDS_pept        158525..159856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00775"
FT                   /product="putative amino acid permease"
FT                   /note="COG0814 Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69584"
FT                   /protein_id="ADN69584.1"
FT                   /translation="MEIASNKGVIADASTPAGRAGMSESEWREAIKFDSTDTGWVIMSI
FT                   GMAIGAGIVFLPVQVGLMGLWVFLLSSVIGYPAMYLFQRLFINTLAESPECKDYPSVIS
FT                   GYLGKNWGILLGALYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSDSPFYGLVLI
FT                   CILVAISSRGEKLLFKISTGMVLTKLLVVAALGVSMVGMWHLYNVGSLPPLGLLVKNAI
FT                   ITLPFTLTSILFIQTLSPMVISYRSREKSIEVARHKALRAMNIAFGILFVTVFFYAVSF
FT                   TLAMGHDEAVKAYEQNISALAIAAQFISGDGAAWVKVVSVILNIFAVMTAFFGVYLGFR
FT                   EATQGIVMNILRRKIPAEKINENLVQRGIMIFAILLAWSAIVLNAPVLSFTSICSPIFG
FT                   MVGCLIPAWLVYKVPALHKYKGMSLYLIIVTGLLLCVSPFLAFS"
FT   gene            159884..161194
FT                   /locus_tag="UM146_00780"
FT   CDS_pept        159884..161194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00780"
FT                   /product="hypothetical protein"
FT                   /note="COG3681 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69585"
FT                   /protein_id="ADN69585.1"
FT                   /translation="MFDSTLNPLWQRYILAVQEEVKPALGCTEPISLALAAAVAAAELE
FT                   GPVERVEAWVSPNLMKNGLGVTVPGTGMVGLPIAAALGALGGNANAGLEVLKDATAQAI
FT                   SDAKALLAAGKVSVKIQEPCDEILFSRAKVWNGEKWACVTIVGGHTNIVHIETHNGVVF
FT                   TQQACVTEGEQESPLTVLSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGN
FT                   WGLHIGATLEKQCARGLLAKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITAT
FT                   MPVVVVAEHFGADDERLARALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLV
FT                   DGRYETISMAISSMIGDVSGMICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEG
FT                   IVAHDVEQSIANLCALASHSMQQTDRQIIEIMASKAR"
FT   gene            complement(161326..161490)
FT                   /locus_tag="UM146_00785"
FT   CDS_pept        complement(161326..161490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69586"
FT                   /protein_id="ADN69586.1"
FT                   /translation="MSKKSAKKRQPVKPVVAKEPARTAKNFGYEEMLSELEAIVADAET
FT                   RLAEDEATA"
FT   gene            complement(161513..162214)
FT                   /locus_tag="UM146_00790"
FT   CDS_pept        complement(161513..162214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00790"
FT                   /product="putative pirin-related protein"
FT                   /note="COG1741 Pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69587"
FT                   /protein_id="ADN69587.1"
FT                   /translation="MITTRTARQCGQADYGWLQARYTFSFGHYFDPKLLGYASLRVLNQ
FT                   EVLAPGAAFQPRTYPKVDILNVILDGEAEYRDSEGNHVQASAGEALLLSTQPGVSYSEH
FT                   NLSKDKSLTRMQLWLDACPQRENPLIQKLALNMDKQQLIASPEGGMGSLQLRQQVWLHH
FT                   IVLDKGESANFQLHGPRAYLQSIHGQFHALTHHEEKAALTCGDGAFIRDEANITLVADS
FT                   PLRALLIDLPV"
FT   gene            162319..163215
FT                   /locus_tag="UM146_00795"
FT   CDS_pept        162319..163215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00795"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69588"
FT                   /protein_id="ADN69588.1"
FT                   /translation="MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKL
FT                   EEELDVVLFDRSGHRTKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHLTIVTE
FT                   ALVPTPAFFPLIDKLAAKANTQLAIITEVLAGAWERLEQGRADIVIAPDMHFRSSSEIN
FT                   SRKLYTLMNVYVAAPDHPIHQEPEPLSEVTRVKYRGIAVADTARERPVLTVQLLDKQPR
FT                   LTVSTIEDKRQALLAGLGVATMPYPMVEKDIAEGRLRVVSPESTSEIDIIMAWRRDSMG
FT                   EAKSWCLREIPKLFSGK"
FT   gene            complement(163249..163617)
FT                   /locus_tag="UM146_00800"
FT   CDS_pept        complement(163249..163617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00800"
FT                   /product="putative cytochrome"
FT                   /note="COG3152 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69589"
FT                   /protein_id="ADN69589.1"
FT                   /translation="MDWYLKVLKNYVGFRGRARRKEYWMFILVNIIFTFVLGLLDKMLG
FT                   WQRAGGEGILTTIYGILVFLPWWAVQFRRLHDTDRSAWWALLFLIPFIGWLIIIVFNCQ
FT                   AGTPGENRFGPDPKLEQE"
FT   gene            complement(163900..164886)
FT                   /locus_tag="UM146_00805"
FT   CDS_pept        complement(163900..164886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00805"
FT                   /product="putative transferase"
FT                   /note="COG0435 Predicted glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69590"
FT                   /protein_id="ADN69590.1"
FT                   /translation="MGQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGK
FT                   GGFAAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPG
FT                   ATGDTLYQHEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDAL
FT                   GAKAGDYYPPALQPKIDELNGWIYDTVNNGVYKAGFATSQQAYDEAVAKVFESLARLEQ
FT                   ILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMP
FT                   GIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG"
FT   gene            complement(164956..165438)
FT                   /locus_tag="UM146_00810"
FT   CDS_pept        complement(164956..165438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00810"
FT                   /product="hypothetical protein"
FT                   /note="COG2259 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69591"
FT                   /protein_id="ADN69591.1"
FT                   /translation="MILSIDSNDANSAPLHKKTISSLSGAVESMMKKLEDVGVLVARIL
FT                   MPILFITAGWGKITGYAGTQQYMEAMGVPGFMLPLVILLEFGGGLAILFGFLTRTTALF
FT                   TAGFTLLTAFLFHSNFAEGMNSLMFMKNLTISGGFLLLAITGPGAFSIDRLLNKKW"
FT   gene            complement(165535..165834)
FT                   /locus_tag="UM146_00815"
FT   CDS_pept        complement(165535..165834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69592"
FT                   /protein_id="ADN69592.1"
FT                   /translation="MSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNM
FT                   LLSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLRG"
FT   gene            complement(165824..166228)
FT                   /locus_tag="UM146_00820"
FT   CDS_pept        complement(165824..166228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69593"
FT                   /protein_id="ADN69593.1"
FT                   /translation="MADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVELEEEKA
FT                   NLFQLLLMLGLTMLFAAFGLMSLMVLVIWAVDPQYRLNAMIATTVVLLLLALIGGIWTL
FT                   RKSRKSTLLRHTRHELANDRQLLEEESREQ"
FT   gene            complement(166231..166536)
FT                   /locus_tag="UM146_00825"
FT   CDS_pept        complement(166231..166536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00825"
FT                   /product="hypothetical protein"
FT                   /note="COG4575 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69594"
FT                   /protein_id="ADN69594.1"
FT                   /translation="MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQ
FT                   ALKQSRYRLGETGDAIAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR"
FT   gene            complement(166574..166942)
FT                   /locus_tag="UM146_00830"
FT   CDS_pept        complement(166574..166942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69595"
FT                   /protein_id="ADN69595.1"
FT                   /translation="MKYRIALAVSLFALSAGSYATTLCQEKEQNILKEISYAEKHQNQN
FT                   RIDGLNKALSEVRANCSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRE
FT                   RKLAEAQEELKKLKARDY"
FT   gene            complement(167089..167457)
FT                   /locus_tag="UM146_00835"
FT   CDS_pept        complement(167089..167457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69596"
FT                   /protein_id="ADN69596.1"
FT                   /translation="MSLRQLAWSGAVLLLVSTLLLAWSAVRQQESTLAIRAVHQGTTMP
FT                   DGFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNN
FT                   SQAMQWLTRLRDNSHRFG"
FT   gene            complement(167476..168138)
FT                   /locus_tag="UM146_00840"
FT   CDS_pept        complement(167476..168138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00840"
FT                   /product="hypothetical protein"
FT                   /note="COG0586 Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69597"
FT                   /protein_id="ADN69597.1"
FT                   /translation="MELLTQLLQALWAQDFETLANPSMIGMLYFVLFVILFLENGLLPA
FT                   AFLPGDSLLVLVGVLIAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLS
FT                   HLPAHYHQRAHHLFHKHGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLL
FT                   WVLILTTLGYMLGKTPVFLKYEDQLMSCLMLLPVVLLVFGLAGSLVVLWKKKYGNRG"
FT   gene            complement(168483..169259)
FT                   /locus_tag="UM146_00845"
FT   CDS_pept        complement(168483..169259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00845"
FT                   /product="DNA-binding transcriptional repressor ExuR"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69598"
FT                   /protein_id="ADN69598.1"
FT                   /translation="MEITEPRRLYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVS
FT                   RTVVREAIIMLEVEGYVEVRKGSGIHVVSNQPRHQQAADNNMEFANYGPFELLQARQLI
FT                   ESNIAEFAATQVTKQDIMKLMAIQEQARGEQCFRDSEWDLQFHIQVALATQNSALAAIV
FT                   EKMWTQRSHNPYWKKLHEHIDARTVDNWCDDHDQILKALIRKDPHAAKLAMWQHLENTK
FT                   IMLFNETSDDFEFNADRYLFAENPVVHLDTATSGSK"
FT   gene            complement(169389..170687)
FT                   /locus_tag="UM146_00850"
FT   CDS_pept        complement(169389..170687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00850"
FT                   /product="hexuronate transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69599"
FT                   /protein_id="ADN69599.1"
FT                   /translation="MRKIKGLRWYMIALVTLGTVLGYLTRNTVAAAAPTLMEELNISTQ
FT                   QYSYIIAAYSAAYTVMQPVAGYVLDVLGTKIGYAMFAVLWAVFCGATALAGSWGGLAVA
FT                   RGAVGAAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGAMIAPPLVVWAIVMHSW
FT                   QMAFIISGALSFIWAMAWLIFYKHPRDQKHLTDEERDYIINGQEAQHQVDTAKKMSVGQ
FT                   ILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKVYGFNLKEIAMFAWMPMLFADLGCI
FT                   LGGYLPPLFQRWFGVNLIVSRKMVVTLGAVLMIGPGMIGLFTNPYVAIMLLCIGGFAHQ
FT                   ALSGALITLSSDVFGRNEVATANGLTGMSAWLASTLFALVVGALADTIGFSPLFAVLAV
FT                   FDLLGALVIWTVLQNKPAIEVAQESHNDPAPQH"
FT   gene            171169..172581
FT                   /locus_tag="UM146_00855"
FT   CDS_pept        171169..172581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00855"
FT                   /product="glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="COG1904 Glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69600"
FT                   /protein_id="ADN69600.1"
FT                   /translation="MTPFMTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPQQIAEDY
FT                   RFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWT
FT                   HLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDDPIDS
FT                   LEHHAEIAKDGSFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTAL
FT                   TKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLV
FT                   FLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDRPMAEELSKLLSKQNEE
FT                   NLLPKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMERQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVEAGEAPADINLLGEMVKNICF
FT                   NNARDYFAIELN"
FT   gene            172596..174083
FT                   /locus_tag="UM146_00860"
FT   CDS_pept        172596..174083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00860"
FT                   /product="altronate hydrolase"
FT                   /note="COG2721 Altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69601"
FT                   /protein_id="ADN69601.1"
FT                   /translation="MQYIKIHALDNVAVALADLAEGTEVSVDNQTVTLRQDVARGHKFA
FT                   LTDIAKGANVIKYGLPIGYALADIAAGEHVHAHNTRTNLSDLDQYRYQPDFQDLPAQAA
FT                   DREVQIYRRANGDVGVRNELWILPTVGCVNGIARQIQNRFLKETNNAEGTDGVFLFSHT
FT                   YGCSQLGDDHINTRTMLQNMVRHPNAGAVLVIGLGCENNQVAAFRETLGDIDPERVHFM
FT                   ICQQQDDEIEAGIAHLHQLYSVMRNDKREPGKLSELKFGLECGGSDGLSGITANPMLGR
FT                   FSDYVIANGGTTVLTEVPEMFGAEQLLMDHCRDEATFEKLVTMVNDFKQYFIAHDQPIY
FT                   ENPSPGNKAGGITTLEDKSLGCTQKAGTSVVVDVLRYGERLKTPGLNLLSAPGNDAVAT
FT                   SALAGAGCHMVLFSTGRGTPYGGFVPTVKIATNSELAAKKKHWIDFDAGQLIHGKAMPQ
FT                   LLEEFIDTIVEFANGKQTCNERNDFRELAIFKSGVTL"
FT   gene            174166..174717
FT                   /locus_tag="UM146_00865"
FT   CDS_pept        174166..174717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69602"
FT                   /protein_id="ADN69602.1"
FT                   /translation="MTAYWLAQGVGVIAFLIGITTFFNRDERRFKKQLSVYSAVIGVHF
FT                   FLLGTYPAGASAILNAIRTLITLRTRSLWVMAIFIVLTGGIGLAKFHHPVELLPVIGTI
FT                   VSTWALFRCKGLTMRCVMWFSTCCWVIHNFWAGSIGGTMIEGSFLLMNGLNIIRFWRMQ
FT                   RRGIDPFKVEKTPSAVDERG"
FT   gene            complement(174721..175965)
FT                   /locus_tag="UM146_00870"
FT   CDS_pept        complement(174721..175965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00870"
FT                   /product="serine/threonine transporter SstT"
FT                   /note="COG3633 Na+/serine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69603"
FT                   /protein_id="ADN69603.1"
FT                   /translation="MTTQHSPGLFRRLAHGSLVKQILAGLILGILLAWISKPAAEAVGL
FT                   LGTLFVGALKAVAPILVLMLVMASIANHQHGQKTNIRPILFLYLLGTFSAALAAVIFSF
FT                   AFPSTLHLSSSAGDISPPSGIVEVMRGLVMSMVSNPIDALLKGNYIGILVWAIGLGFAL
FT                   RHGNETTKNLVNDMSNAVTFMVKLVIHFAPIGIFGLVSSTLATTGFSTLWGYAQLLVVL
FT                   VGCMLLVALVVNPLLVWWKIRRNPFPLVLLCLRESGVYAFFTRSSAANIPVNMALCEKL
FT                   NLDRDTYSVSIPLGATINMAGAAITITVLTLAAVNTLGIPVDLPTALLLSVVASLCACG
FT                   ASGVAGGSLLLIPLACNMFGISNDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAA
FT                   CQAEDDRLANSALRN"
FT   gene            complement(176289..177254)
FT                   /locus_tag="UM146_00875"
FT   CDS_pept        complement(176289..177254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00875"
FT                   /product="hypothetical protein"
FT                   /note="COG0861 Membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69604"
FT                   /protein_id="ADN69604.1"
FT                   /translation="MNTVGTPLLWGGFAVVVTIMLAIDLLLQGRRGAHAMTMKQAAAWS
FT                   LVWVTLSLLFNAAFWWYLVQTEGRAVADPQALAFLTGYLIEKSLAVDNVFVWLMLFSYF
FT                   SVPAALQRRVLVYGVLGAIVLRTIMIFTGSWLISQFDWILYIFGAFLLFTGVKMALAHE
FT                   DESGIGDKPLVRWLRGHLRMTDTIDNEHFFVRKNGLLYATPLMLVLILVELSDVIFAVD
FT                   SIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAERFSMLKYGLAVILVFIGIKML
FT                   IVDFYHIPIAVSLGVVFGILVMTFIINAWVNYRHDKQRVE"
FT   gene            complement(177536..178540)
FT                   /locus_tag="UM146_00880"
FT   CDS_pept        complement(177536..178540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00880"
FT                   /product="putative NAD(P)-binding dehydrogenase"
FT                   /note="COG0673 Predicted dehydrogenases and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69605"
FT                   /protein_id="ADN69605.1"
FT                   /translation="MEYPRVMIRFAVIGTNWITRQFVEAAHESGKYKLTAVYSRSLEQA
FT                   QHFANDFSVEHLFTSLEAMAESDAIDAVYIASPNSLHFSQTQLFLSHKIHVICEKPLAS
FT                   NLAEVDAAIACARENQVVLFEAFKTAYLPNFHLLRQALPKVGKLRKVFFNYCQYSSRYQ
FT                   RYLDGENPNTFNPTFSNGSIMDIGFYCLASAVALFGEPKSVQATASLLASGVDAHGVVV
FT                   MDYGDFSVTLQHSKVSDSVLASEIQGEAGSLVIEKLSECQKVCFVPRGSQMQDLTQPQH
FT                   INTMLYEAELFATLVDEHLVNHPGLAVSRITAKLLTEIRRQTGVIFPADNVKL"
FT   gene            complement(178601..179293)
FT                   /locus_tag="UM146_00885"
FT   CDS_pept        complement(178601..179293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00885"
FT                   /product="putative thioredoxin-like protein"
FT                   /note="COG2949 Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69606"
FT                   /protein_id="ADN69606.1"
FT                   /translation="MLRAFARLLLRICFSRRTLKLGCLLLLIAGATIFIADRVMVNASK
FT                   QLTWSDVNAVPARNVGLLLGARPGNRYFTRRIDTAAALYHAGKVKWLLVSGDNGRKNYD
FT                   EASGMQQALIAKGVPAKVIFCDYAGFSTLDSVVRANKVFSENHITIISQEFHNQRAIWL
FT                   AKQYGIDAIGFNAPDLNMKHGLYTQLREKLARVSAVIDAKILHRQPKYLGPLVMIGPFS
FT                   EHGCPAKE"
FT   gene            complement(179370..179873)
FT                   /locus_tag="UM146_00890"
FT   CDS_pept        complement(179370..179873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00890"
FT                   /product="hypothetical protein"
FT                   /note="COG1451 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69607"
FT                   /protein_id="ADN69607.1"
FT                   /translation="MSNLTYLQGYPEQLLSQVRTLINEQRLGDVLAKRYPGTHDYATDK
FT                   ALWQYTQDLKNQFLRNAPPINKVMYDNKIHVLKNALGLHTAVSRVQGGKLKAKAEIRVA
FT                   TVFRNAPEPFLRMIVVHELAHLKEKEHNKAFYQLCCHMEPQYHQLEFDTRLWLTQLSLG
FT                   QDKI"
FT   gene            179958..181094
FT                   /locus_tag="UM146_00895"
FT   CDS_pept        179958..181094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00895"
FT                   /product="putative methyltransferase small domain protein"
FT                   /note="COG2813 16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69608"
FT                   /protein_id="ADN69608.1"
FT                   /translation="MSHLDNGFRSLTLQRFPATDDVNPLQAWEAADEYLLQQLDDTEIR
FT                   GPVLILNDAFGALSCALAEHKPYSIGDSYISELATRENLRLNGIDESSVKFLDSTADYP
FT                   QQPGVVLIKVPKTLALLEQQLRALRKVVTPDTRIIAGAKARDIHTSTLELFEKVLGPTT
FT                   TTLAWKKARLINCTFNEPPLADAPQTVSWKLEGTDWTIHNHANVFSRTGLDIGARFFMQ
FT                   HLPENLEGEIVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSRLNVETNMPEALD
FT                   RCEFMINNALSGVEPFRFNAVLCNPPFHQQHALTDNVAWEMFHHARRCLKINGELYIVA
FT                   NRHLDYFHKLKKIFGNCTTIATNNKFVVLKAVKLGRRR"
FT   gene            complement(181212..183230)
FT                   /locus_tag="UM146_00900"
FT   CDS_pept        complement(181212..183230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00900"
FT                   /product="2,4-dienoyl-CoA reductase, NADH and FMN-linked"
FT                   /note="COG1902 NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69609"
FT                   /protein_id="ADN69609.1"
FT                   /translation="MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYA
FT                   ERARHGVALIVSGGIAPDLTGVGMEGGAMLNDANQIPHHRTITEAVHQEGGKIALQILH
FT                   TGRYSYQPHLVAPSALQAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMG
FT                   SEGYLINEFLTLRTNQRSDQWGGDYRNRMRFAVEVVGAVRERVGNDFIIIYRLSMLDLV
FT                   EGGGTFAETVELAQAIEAAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVS
FT                   LPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQ
FT                   ACLDQIFVGKVTSCLVNPRACHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQ
FT                   VTLFDAHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLKAFD
FT                   ETILASGIVPRIPPIDGIDHPKVLSYLDVLRDKAQVGNKVAIIGCGGIGFDTAMYLSQP
FT                   GESTSQNIAGFCNEWGIDSSLQQAGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTT
FT                   GWIHRTTLLSRGVKMIPGVSYQKIDDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQ
FT                   PLIDSGKTVHLIGGCDVAMELDARRAIAQGTRLALEI"
FT   gene            complement(183401..185752)
FT                   /locus_tag="UM146_00905"
FT   CDS_pept        complement(183401..185752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00905"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="COG0403 Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69610"
FT                   /protein_id="ADN69610.1"
FT                   /translation="MKIKTILTPVACALLMSFSAHAANADNYKNVINRTGAPQYMKDYD
FT                   YDDHQRFNPFFDLGAWHGHLLPDGPNTMGGFPGVALLTEEYINFMASNFDRLTVWQDGK
FT                   KVDFTLEAYSIPGALVQKLISKDVQVEMILRFATPRTSLLETKITSDKPLDLVWDGELL
FT                   EKLEAKEGKPLSDKTIAGEYPDYQRKISATRDGLKVTFGKVRATWDLLTSGESEYQVHK
FT                   SLPVQTEINGNRFTSKAHINGSTTLYTTYSHLLTAQEVSKEQMQIRDILARPAFYLTAS
FT                   QQRWEEYLKKGLTNPDATPEQTRVAVKAIETLNGNWRSPGGAVKYNTVTPSVTGRWFSG
FT                   NQTWPWDTWKQAFAMAHFNPDIAKENIRAVFSWQIQPGDSVRPQDVGFVPDLIAWNLSP
FT                   ERGGDGGNWNERNTKPSLAAWSVMEVYNVTQDKTWLAEMYPKLVAYHDWWLRNRDHNGN
FT                   GVPEYGATRDKAHNTESGEMLFTVKKGDKEETRSGLNNYARVVEKGQYDSLEIPAQVAA
FT                   SWESGRDDAAVFGFIDKEQLDKYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQESVDQ
FT                   ASYMYSDNHYLAEMATILGKPEEAKRYRQLAQQLADYINTCMFDPTTQFYYDVRIEDKP
FT                   LANGCAGKPIVERGKGPEGWSPLFNGAATQANADAVVKVMLDPKEFNTFVPLGTAALTN
FT                   PAFGADIYWRGRVWVDQFWFGLKGMERYGYRDDALKLADTFFQHAKGLTADGPIQENYN
FT                   PLTGAQQGAPNFSWSAAHLYMLYNDFFRKQ"
FT   gene            complement(185769..186839)
FT                   /locus_tag="UM146_00910"
FT   CDS_pept        complement(185769..186839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69611"
FT                   /protein_id="ADN69611.1"
FT                   /translation="MKLITAPCRALLALPFCYAFSVTADEARPAEHDDTKTPAMTSTSS
FT                   PSFRFYGELGVGGYMDLEGENKHKYSDGTYIEGGLEMKYGSWFGLIYGEGWTVQADHDG
FT                   NAWVPDHSWGGFEGGINRFYGGYRTNDGTEIMLSLRQDSSLDDLQWWGDFTPDLGYVIP
FT                   NTRDIMTALKVQNLSGNFRYSVTATPAGHHDESKAWLHFGKYDRYDDKYTYPAMMNGYI
FT                   QYDLAEGITWMNGLEITDGTGQLYLTGLLTPNFAARAWHHTGRADGLDVSGSESGMMVS
FT                   AMYEALKGVYLSTAYTYAKHRPDHADDETTSFMQFGIWYEYGGGRFATAFDSRFYMKNA
FT                   SHDPSDQLFLMQYFYW"
FT   gene            complement(186973..188406)
FT                   /locus_tag="UM146_00915"
FT   CDS_pept        complement(186973..188406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00915"
FT                   /product="putative transporter"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69612"
FT                   /protein_id="ADN69612.1"
FT                   /translation="MSDTKRNTIGKFGLLSLTFAAVYSFNNVINNNIELGLASAPMFFL
FT                   ATIFYFIPFCLIIAEFVSLNKNSEAGVYAWVKSSLGGRWAFITAYTYWFVNLFFFTSLL
FT                   PRVIAYASYAFLGYEYIMTPVATTIISMVLFAFSTWVSTNGAKMLGPITSVTSTLMLLL
FT                   TLSYILLAGTALVGGVQPADPITVDAMIPNFNWAFLGVTTWIFMAAGGAESVAVYVNDV
FT                   KGGSKSFVKVIILAGIFIGVLYSVSSVLINVFVSSKELKFTGGSVQVFHGMAAYFGLPE
FT                   ALMNRFVGLVSFTAMFGSLLMWTATPVKIFFSEIPEGIFGKKTVELNENGVPARAAWIQ
FT                   FLIVIPLMIIPMLGSNTVQDLMNTIINMTAAASMLPPLFIMLAYLNLRAKLDHLPRDFR
FT                   MGSRRTGIIVVSMLIAIFAVGFVASTFPTGANILTIIFYNVGGIVIFLGFAWWKYSKYI
FT                   KGLTAEERHIEATPARNVD"
FT   gene            complement(188469..188918)
FT                   /gene="ebgC"
FT                   /locus_tag="UM146_00920"
FT   CDS_pept        complement(188469..188918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebgC"
FT                   /locus_tag="UM146_00920"
FT                   /product="cryptic beta-D-galactosidase subunit beta"
FT                   /note="COG2731 Beta-galactosidase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69613"
FT                   /protein_id="ADN69613.1"
FT                   /translation="MRIIDNLEQFRQIYASGKKWQRCVEAIENIDNIQPGVAHSIGDSL
FT                   TYRVETDSATDALFTGHRRYFEVHYYLQGQQKIEYAPKETLQVVEYYRDETDREYLKGC
FT                   GETVEVHEGQIVICDIHEAYRFICNNAVKKVVLKVTIEDGYFHNK"
FT   gene            complement(188915..192007)
FT                   /gene="ebgA"
FT                   /locus_tag="UM146_00925"
FT   CDS_pept        complement(188915..192007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebgA"
FT                   /locus_tag="UM146_00925"
FT                   /product="cryptic beta-D-galactosidase subunit alpha"
FT                   /note="COG3250 Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69614"
FT                   /protein_id="ADN69614.1"
FT                   /translation="MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLLLS
FT                   GQWNFHFFDHPLQVPEAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFV
FT                   PSDNPTGAYQRIFTLSDGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDIS
FT                   AMVKTGDNLLCVRVMQWADSTYVEDQDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDE
FT                   AYCDATLSCEVVLENLAASPVVTTLEYTLFDGEHVVHSSAIDHLAIEKLTSASFAFTVE
FT                   QPQQWSAESPYLYHLVMTLKDADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVN
FT                   RHDNDHRKGRAVGMDRVEKDLQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETD
FT                   VESHGFANVGDISRITDDPQWEKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRA
FT                   MYHAAKALDDTRLVHYEEDRDAEVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAM
FT                   GNGPGGLTEYQNVFYKHDCIQGHYVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNF
FT                   CLDGLIYSDQTPGPGLKEYKQVIAPVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVR
FT                   AEGETLATQQIKLRDVAPNSEAPLQITLPQLDAREAFLNITVTKDSRTRYSEAGHSIAT
FT                   YQFPLKENTAQPVPFAPNNARPLTLEDDRLSCTVRGYNFAITFSKTSGKPTSWQVNGES
FT                   LLTREPKINFFKPMIDNHKQEYEGLWQPNHLQIMQEHLRDFVVEQSDDEVLLVSRTVIA
FT                   PPVFDFGMRCTYIWRIAADGQVNVALSGERYGDYPHIIPCIGFTMGINGEYDQVAYYGR
FT                   GPGENYADSQQANIIDIWRSTVDAMFENYPFPQNNGNRQHVRWTALTNRHGNGLLVVPQ
FT                   RPINFSAWHYTQENIHAAQHCNELQRSDDITLNLDHQLLGLGSNSWGSEVLDSWRVWFR
FT                   DFSYGFTLLPVSGGEATAQSLASYEFGAGFFSTNLHSENKQ"
FT   gene            complement(192191..193174)
FT                   /locus_tag="UM146_00930"
FT   CDS_pept        complement(192191..193174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00930"
FT                   /product="DNA-binding transcriptional repressor EbgR"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69615"
FT                   /protein_id="ADN69615.1"
FT                   /translation="MATLKDIAIEAGVSLATVSRVLNDDPTLNVKEETKHRILEIAEKL
FT                   EYKTSSARKLQTGAVNQHHILAIYSYQQELEINDPYYLAIRHGIETQCEKLAIELTNCY
FT                   EHNGLPDIKNVTGILIVGKPTSALRAAACALTDNICFIDFHEPGSGYDAVDIDLARISK
FT                   EIIDFYINQGVNRIGFIGGEDLPGKADIREVAFAEYGRLKHVVREEDIWRGGFSSSSGY
FT                   ELAKQMLAREDYPKALFVASDSIAIGVLRAIHERGLNIPQDISLISVNDIPTARFTFPP
FT                   LSTVRIHSEMMGSQGVNLVYEKARDGRALPLLVFVPSKLKLRGTTR"
FT   gene            193393..193725
FT                   /locus_tag="UM146_00935"
FT   CDS_pept        193393..193725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00935"
FT                   /product="hypothetical protein"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69616"
FT                   /protein_id="ADN69616.1"
FT                   /translation="METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGEKTLQT
FT                   VTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMP
FT                   AGVRIV"
FT   gene            complement(193767..195173)
FT                   /locus_tag="UM146_00940"
FT   CDS_pept        complement(193767..195173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00940"
FT                   /product="putrescine--2-oxoglutarate aminotransferase"
FT                   /EC_number="2.6.1.82"
FT                   /note="COG4992 Ornithine/acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69617"
FT                   /protein_id="ADN69617.1"
FT                   /translation="MIREPPEHILNRLPSSASALACSAHALNLIEKRTLDHEEMKALNR
FT                   EVIEYFKEHVNPGFLEYRKSVTAGGDYGAVEWQAGGLNTLVDTQGQEFIDCLGGFGIFN
FT                   VGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESV
FT                   EAALKLAKAYQSPRGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFG
FT                   NIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDE
FT                   VQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPFLHTT
FT                   TFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGML
FT                   MAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKAL
FT                   AAMRVSVEEA"
FT   gene            195564..197084
FT                   /locus_tag="UM146_00945"
FT   CDS_pept        195564..197084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00945"
FT                   /product="aerotaxis sensor receptor, flavoprotein"
FT                   /note="COG2202 FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69618"
FT                   /protein_id="ADN69618.1"
FT                   /translation="MSSHPYVTQQNTPLADDTTLMSTTDLQSYITHANDTFVQVSGYTL
FT                   QELQGQPHNMVRHPDMPKAAFADMWFTLKKGEPWSGIVKNRRKNGDHYWVRANAVPMVR
FT                   EGKISGYMSIRTRATDEEIAAVEPLYKALNAGRTSKRIHKGLVVRKGWLGKLPSLPLRW
FT                   RARGVMTLMFILLAVMLWFVAAPVVTYILCALVVLLASACFEWQIVRPIENVARQALKV
FT                   ATGERNSVEHLNRSDELGLTLRAVGQLGLMCRWLINDVSSQVSSVRNGSETLAKGTDEL
FT                   NEHTQQTVDNVQQTVATMNQMAASVKQNSATASAADKLSITASNAAVQGGEAMTTVIKT
FT                   MDDIADSTQRIGTITSLINDIAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRHLASR
FT                   SANAANDIRKLIDASADKVQSGSQQVHAAGRTMEDIVAQVKNVTQLIAQISHSTLEQAD
FT                   GLSSLTRAVDELNLITQKNAELVEESAQVSAMVKHRTSRLEDAVTVLH"
FT   gene            complement(197276..197860)
FT                   /locus_tag="UM146_00950"
FT   CDS_pept        complement(197276..197860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00950"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1695 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69619"
FT                   /protein_id="ADN69619.1"
FT                   /translation="MSYHHEGCCKHEGQPRHEGCCKGEKSEHEHCGHGHQHEHGQCCGG
FT                   RHGRGGGRRQRFFGHGELRLVILDILSRDDSHGYELIKAIENLTQGNYTPSPGVIYPTL
FT                   DFLQEQSLITIREEEGGKKQIALTEQGAQWLEENREQVEMIEERIKARCVGAALRQNPQ
FT                   MKRALDNFKAVLDLRVNQSDITDAQIKRSLR"
FT   gene            198137..198901
FT                   /locus_tag="UM146_00955"
FT   CDS_pept        198137..198901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00955"
FT                   /product="siderophore-interacting protein"
FT                   /note="COG2375 Siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69620"
FT                   /protein_id="ADN69620.1"
FT                   /translation="MNNSPRYPQRVRNDLRFRELTVLRAERISAGFQRIVLGGEALDGF
FT                   TSRGFDDHSKLFFPQSDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFF
FT                   IHDGGVASGWAMQAQPGDKLTVAGPRGSLVVPEDYAYQLYVCDESGMPALRRRLETLSK
FT                   LAVKPQVSALVSVRDNACQDYLAHLDGFNIEWLAHDEQAVDERLAQMQIPADDYFIWIT
FT                   GEGKVVKNLSRRFEAEQYDPQRVRAAAYWHAK"
FT   gene            complement(198955..199030)
FT                   /locus_tag="UM146_t23823"
FT   tRNA            complement(198955..199030)
FT                   /locus_tag="UM146_t23823"
FT                   /product="tRNA-Met"
FT   gene            199155..199661
FT                   /locus_tag="UM146_00960"
FT   CDS_pept        199155..199661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00960"
FT                   /product="G/U mismatch-specific DNA glycosylase"
FT                   /note="COG3663 G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69621"
FT                   /protein_id="ADN69621.1"
FT                   /translation="MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAG
FT                   FTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQAL
FT                   AILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQAL
FT                   VVRGR"
FT   gene            complement(199740..201581)
FT                   /locus_tag="UM146_00965"
FT   CDS_pept        complement(199740..201581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00965"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69622"
FT                   /protein_id="ADN69622.1"
FT                   /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVMEEAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMRE
FT                   MGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLIT
FT                   GFVDPNAEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDTADDDNSIDPELAREKFA
FT                   ELRAQYIVTRDTIKAKGRSHAAAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVR
FT                   TQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRA
FT                   LQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGL
FT                   QFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIE
FT                   TINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDS
FT                   HLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEV
FT                   GKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(201776..203521)
FT                   /gene="dnaG"
FT                   /locus_tag="UM146_00970"
FT   CDS_pept        complement(201776..203521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="UM146_00970"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG0358 DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69623"
FT                   /protein_id="ADN69623.1"
FT                   /translation="MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNE
FT                   KTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAGSG
FT                   PSQIERHQRQTLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPP
FT                   GWDNVLKRFGGNPENRQSLVDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRV
FT                   LGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYA
FT                   VASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFL
FT                   PDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLI
FT                   SQVPGETLRIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPVPQLKRTTMRILIGLL
FT                   VQNPELATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLE
FT                   KLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARERTHGLSNEERLELWTLNQ
FT                   ELAKK"
FT   gene            complement(203632..203847)
FT                   /gene="rpsU"
FT                   /locus_tag="UM146_00975"
FT   CDS_pept        complement(203632..203847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="UM146_00975"
FT                   /product="30S ribosomal protein S21"
FT                   /note="COG0828 Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69624"
FT                   /protein_id="ADN69624.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            204085..205098
FT                   /locus_tag="UM146_00980"
FT   CDS_pept        204085..205098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00980"
FT                   /product="putative DNA-binding/iron metalloprotein/AP
FT                   endonuclease"
FT                   /note="COG0533 Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69625"
FT                   /protein_id="ADN69625.1"
FT                   /translation="MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQEALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDV
FT                   PAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   RDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAE
FT                   MMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAA"
FT   gene            complement(205141..206604)
FT                   /locus_tag="UM146_00985"
FT   CDS_pept        complement(205141..206604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00985"
FT                   /product="putative tartrate:succinate antiporter"
FT                   /note="COG0471 Di- and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69626"
FT                   /protein_id="ADN69626.1"
FT                   /translation="MKPSTEWWRYLAPLAVIAIIALLPLPAGLESHTWLYFAVFTGVIV
FT                   GLILEPVPGAVVAMVGISIIAILSPWLLFSPEQLAQPGFKFTAKSLSWAVSGFSNSVIW
FT                   LIFAAFMFGTGYEKTGLGRRIALILVKKMGHRTLFLGYAVMFSELILAPVTPSNSARGA
FT                   GIIYPIIRNLPPLYQSQPNDSSSRSIGSYIMWMGIVADCVTSAIFLTAMAPNLLLIGLM
FT                   KSASNATLSWGDWFLGMLPLSILLVLLVPWLAYVLYPPILKSGDQVPRWAETELQAMGP
FT                   LCSREKRMLGLMVGALVLWIFGGDYIDAAMVGYSVVALMLLLRIICWDDIVSNKAAWNV
FT                   FFWLASLITLATGLNNTGFISWFGKLLAGSLSGYSPTIVMVALIVVFYLLRYFFASATA
FT                   YTSALAPMMIAAALAMPEIPLPVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTVD
FT                   YWRLGAIFGLIFLVLLVITGLLWMPMVLL"
FT   gene            complement(206652..207257)
FT                   /locus_tag="UM146_00990"
FT   CDS_pept        complement(206652..207257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00990"
FT                   /product="L(+)-tartrate dehydratase subunit beta"
FT                   /EC_number="4.2.1.32"
FT                   /note="COG1838 Tartrate dehydratase beta subunit/Fumarate
FT                   hydratase class I, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69627"
FT                   /protein_id="ADN69627.1"
FT                   /translation="MKKILTTPIKAEDLQDIRVGDVIYLTGTLVTCRDVCHRRLIELKR
FT                   PIPYDLNGKAIFHAGPIVRKNGDKWEMVSVGPTTSMRMESFEREFIEQTGVKLVVGKGG
FT                   MGPLTEEGCQKFKALHVIFPAGCAVLAATQVEEIEEVHWTELGMPESLWVCRVKEFGPL
FT                   IVSIDTHGNNLIAENKKLFAERRDPIVEEICEHVHYIK"
FT   gene            complement(207254..208165)
FT                   /locus_tag="UM146_00995"
FT   CDS_pept        complement(207254..208165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_00995"
FT                   /product="tartrate dehydratase subunit alpha"
FT                   /EC_number="4.2.1.32"
FT                   /note="COG1951 Tartrate dehydratase alpha subunit/Fumarate
FT                   hydratase class I, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69628"
FT                   /protein_id="ADN69628.1"
FT                   /translation="MMSESNKQQAVNKLTEIVANFTAMISTRMPDDVVDKLKQLKDAET
FT                   SSMGKIIYHTMFDNMQKAIDLNRPACQDTGEIMFFVKVGSRFPLLGELQSILKQAVEEA
FT                   TVKAPLRHNAVEIFDEVNTGKNTGSGVPWVTWDIVPDGDDAEIEVYMAGGGCTLPGRSK
FT                   VLMPSEGYEGVVKFVFENISTLAVNACPPVLVGVGIATSVETAAVLSRKAILRPIGSRH
FT                   PNPKAAELELRLEEGLNRLGIGPQGLTGNSSVMGVHIESAARHPSTIGVAVSTGCWAHR
FT                   RGTLRVHADLTFENLSHTRSAL"
FT   gene            208372..209304
FT                   /locus_tag="UM146_01000"
FT   CDS_pept        208372..209304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01000"
FT                   /product="transcriptional activator TtdR"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69629"
FT                   /protein_id="ADN69629.1"
FT                   /translation="MLNSWPLAKDLQVLVEIVHSGSFSAAAATLGQTPAFVTKRIQILE
FT                   NTLATTLLNRSARGVALTESGQRCYEHALEILTQYQRLVDDVTQIKTRPEGMIRIGCSF
FT                   GFGRSHIAPAITELMRNYPELQVHFELFDRQIDLVQDNIDLDIRINDAIPDYYIAHLLT
FT                   KNKRILCAAPEYLQKYPQPQSLQELSRHDCLVTKERDMTHGIWELGNGQEKKSVKVSGH
FT                   LSSNSGEIVLQWALEGKGIMLRSEWDVLPFLESGKLVRVLPEYAQSANIWAVYREPLYR
FT                   SMKLRVCVEFLAAWCQQRLGKPDEGYQVM"
FT   gene            complement(209317..209934)
FT                   /locus_tag="UM146_01005"
FT   CDS_pept        complement(209317..209934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01005"
FT                   /product="putative glycerol-3-phosphate acyltransferase
FT                   PlsY"
FT                   /note="COG0344 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69630"
FT                   /protein_id="ADN69630.1"
FT                   /translation="MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATN
FT                   VLRIGGKGAAVAVLIFDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKG
FT                   GKGVATAFGAIAPIGWDLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVSMLSCLILLRHHDNIQRLWRRQETKIWTKFKRKREKDPE"
FT   gene            210039..210407
FT                   /gene="folB"
FT                   /locus_tag="UM146_01010"
FT   CDS_pept        210039..210407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="UM146_01010"
FT                   /product="bifunctional dihydroneopterin
FT                   aldolase/dihydroneopterin triphosphate 2'-epimerase"
FT                   /EC_number="4.1.2.25"
FT                   /note="COG1539 Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69631"
FT                   /protein_id="ADN69631.1"
FT                   /translation="MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSD
FT                   DVADCLSYADIAETVVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVAR
FT                   AANVGVIIERGNNLKENN"
FT   gene            210498..211319
FT                   /locus_tag="UM146_01015"
FT   CDS_pept        210498..211319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01015"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="COG1968 Uncharacterized bacitracin resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69632"
FT                   /protein_id="ADN69632.1"
FT                   /translation="MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTA
FT                   KTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVV
FT                   LGLLFHDTIKSLFNPINVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCF
FT                   QCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTG
FT                   DIPMFAVGFITAFVVALIAIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF"
FT   gene            complement(211507..212745)
FT                   /gene="cca"
FT                   /locus_tag="UM146_01020"
FT   CDS_pept        complement(211507..212745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="UM146_01020"
FT                   /product="multifunctional tRNA nucleotidyl
FT                   transferase/2'3'-cyclic
FT                   phosphodiesterase/2'nucleotidase/phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69633"
FT                   /protein_id="ADN69633.1"
FT                   /translation="MKIYLVGGAVRDALLGLPVKDRDWVVVGSTPQEMLDAGYQQVGRD
FT                   FPVFLHPQTHEEYALARTERKSGSGYTGFTCYAAPDVTLEDDLKRRDLTINALAQDDNG
FT                   EIIDPYNGLGDLQNRLLRHVSPAFGEDPLRVLRVARFAARYAHLCFRIADETLALMREM
FT                   THAGELEHLTPERVWKETENALTTRNPQVFFQVLRDCGALRVLFPEIDALFGVPAPARW
FT                   HPEIDTGIHTLMTLSMAAMLSPQVDVRFATLCHDLGKGLTPPELWPRHHGHGPAGVKLV
FT                   EQLCQRLRVPNEIRDLARLVAEFHDLIHTFPMLNPKTIVKLFDSIDAWRKPQRVEQLAL
FT                   TSEADVRGRTGFESADYPQGRWLREAWEVAQSVPTKAVVEAGFKGVEIREELTRRRIAA
FT                   VAGWKEQRCPKPE"
FT   gene            complement(212809..213429)
FT                   /locus_tag="UM146_01025"
FT   CDS_pept        complement(212809..213429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01025"
FT                   /product="putative signal transduction protein"
FT                   /note="COG3103 SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69634"
FT                   /protein_id="ADN69634.1"
FT                   /translation="MPKLRLIGLTLLALSATAVSHAEETRYVSDELNTWVRSGPGDHYR
FT                   LVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIPLKQLSTEPSLRSRVPDLENQVKT
FT                   LTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQKLKNELIVAQKKVDAASVQLD
FT                   DKQRTIIMQWFMYGGGVLGLGLLLGLVLPHLIPSRKRKDRWMN"
FT   gene            213671..214972
FT                   /locus_tag="UM146_01030"
FT   CDS_pept        213671..214972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01030"
FT                   /product="adenylate cyclase"
FT                   /note="COG3025 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69635"
FT                   /protein_id="ADN69635.1"
FT                   /translation="MAQEIELKFIVNHSAVEALRDHLNTLDGEHHDPVQLLNIYYETPD
FT                   NWLRGHDMGLRIRGENGRYEMTMKVAGRVTGGLHQRPEYNVALSAPTLDLAQLPTEVWP
FT                   NGELPADLASRVQPLFSTDFYREKWLVEVDGSQIEIALDQGEVKAGEFAEPICELELEL
FT                   LSGDMRAVLKLANQLVSQTGLRQGSLSKAARGYHLAQGNPAREIKPTTILHVAAKADVE
FT                   QGLEAALELALAQWQYHEELWVRGNDAAKEQVLAAIGLVRHTLMLFGGIVPRKASTHLR
FT                   DLLTQCEATIASAVSAVTAVYSTETAMAKLALTEWLVSKAWQPFLDAKAQGKMSDSFKR
FT                   FADIHLSRHAAELKSVFCQPLGDRYRDQLPRLTRDIDSILLLAGYYDPVVAQDWLENWQ
FT                   GLRHAIATGQRIEIEHFRNEANNQEPFWLHSGKR"
FT   gene            214995..217835
FT                   /locus_tag="UM146_01035"
FT   CDS_pept        214995..217835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01035"
FT                   /product="bifunctional glutamine-synthetase
FT                   adenylyltransferase/deadenyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="COG1391 Glutamine synthetase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69636"
FT                   /protein_id="ADN69636.1"
FT                   /translation="MKPLSSPLQQYWQTVVERLPEPLAEESLSAQAKSVLTFSDFVQDS
FT                   VIAHPEWLTELESQPPQADEWQHYAAWLQEALSNVSDEAGLMRELRLFRRRIMVRIAWA
FT                   QTLALVTEESILQQLSHLAETLIVAARDWLYDACCREWGTPCNAQGEAQPLLILGMGKL
FT                   GGGELNFSSDIDLIFAWPEHGCTQGGRRELDNAQFFTRMGQRLIKVLDQPTQDGFVYRV
FT                   DMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMGDSDGVYANELRAMLRP
FT                   FVFRRYIDFSVIQSLRNMKGMIAREVRRRGLTDNIKLGAGGIREIEFIVQVFQLIRGGR
FT                   EPSLQSRALLPTLSAIAALHLLSENDAEQLRVAYLFLRRLENLLQSINDEQTQTLPSDE
FT                   LTRARLAWAMDFADWPQLTGVLTAHMANVRRVFNELIGDDESETQEESLSEQWRELWQD
FT                   ALQEDDTTPVLAHLSEDERKQVLMLIADFRKELDKRTIGPRGRQVLDHLMPHLLSDVCA
FT                   REDAAVTLSRITALLVGIVTRTTYLELLSEFPAALKHLISLCAASPMIASQLARYPLLL
FT                   DELLDPNTLYQPTATDAYRDELRQYLLRVPEDDEEQQLEALRQFKQAQLLRIAAADIAG
FT                   TLPVMKVSDHLTWLAEAMIDAVVQQAWVQMVARYGKPNHLNEREGRGFAVVGYGKLGGW
FT                   ELGYSSDLDLIFLHDCPMDAMTDGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDA
FT                   RLRPSGAAGMLVTSAEAFADYQKNEAWTWEHQALVRARVVYGDPQLTAHFDAVRREIMT
FT                   LPREGKTLQTEVREMREKMRAHLGNKHRDRFDIKADEGGITDIEFITQYLVLRYAHEKP
FT                   KLTRWSDNVRILELLAQNDIMEEQEAMALTRAYTTLRDELHHLALQELPGHVSEDCFTA
FT                   ERELVRASWQKWLVEE"
FT   gene            217883..219316
FT                   /locus_tag="UM146_01040"
FT   CDS_pept        217883..219316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01040"
FT                   /product="bifunctional heptose 7-phosphate kinase/heptose
FT                   1-phosphate adenyltransferase"
FT                   /note="COG2870 ADP-heptose synthase, bifunctional sugar
FT                   kinase/adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69637"
FT                   /protein_id="ADN69637.1"
FT                   /translation="MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNT
FT                   IEERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLADVNVKCDFVSVPTHPTI
FT                   TKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIGALVLSDYAKGALASVQQM
FT                   IQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIAD
FT                   YELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATLAAGNSLE
FT                   EACFFANAAAGVVVGKLGTSTVSPIELENAVRGRADTGFGVMTEEELKLAVAAARKRGE
FT                   KVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNSDASTKRLKGDSRPVNPLEQRMIV
FT                   LGALEAVDWVVSFEEDTPQRLIAGILPDLLVKGGDYKPEEIAGSKEVWANGGEVLVLNF
FT                   EDGCSTTNIIKKIQLDKKG"
FT   gene            complement(219735..221396)
FT                   /locus_tag="UM146_01045"
FT   CDS_pept        complement(219735..221396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01045"
FT                   /product="hypothetical protein"
FT                   /note="COG2268 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69638"
FT                   /protein_id="ADN69638.1"
FT                   /translation="MDDIVNSVPSWMFTAIIAVCILFIIGIIFARLYRRASAEQAFVRT
FT                   GLSGQKVVMSGGAIVMPIFHEIIPINMNTLKLEVSRSTIDSLITKDRMRVDVVVAFFVR
FT                   VKPSVEGIATAAQTLGQRTLSPEDLRMLVEDKFVDALRATAAQMTMHELQDTRENFVQG
FT                   VQNTVAEDLSKNGLELESVSLTNFNQTSKEHFNPNNAFDAEGLTKLTQETERRRRERNE
FT                   VEQDVEVAVREKNRDALSRKLEIEQQEAFMTLEQEQQVKTRTAEQNAKIAAFEAERRRE
FT                   AEQTRILAERQIQETEIDREQAVRSRKVEAEREVRIKEIEQQQVTEIANQTKSIAIAAK
FT                   SEQQSQAEARANLALAEAVSAQQNVETTRQTAEADRAKQVALIAAAQDAETKAVELTVR
FT                   AKAEKEAAEMQAAAIVELAEATRKKGLAEAEAQRALNDAINVLSDEQTSLKFKLALLQA
FT                   LPAVIEKSVEPMKAIDGIKIIQVDGLNRGGATGDANTGNVGGGNLAEQALSAALSYRTQ
FT                   APLIDSLLNEIGVSGGSLAALTSSLSSTTPVEEKAE"
FT   gene            complement(221423..222052)
FT                   /locus_tag="UM146_01050"
FT   CDS_pept        complement(221423..222052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01050"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69639"
FT                   /protein_id="ADN69639.1"
FT                   /translation="MILFADYNTPYLFAISFVLLIGLLEIFALICGHMLSGALDAHLDH
FT                   YDSITTGHISQALHYLNIGRLPALVVLCLLAGFFGLIGILLQHACVTLWQSPLPNLFVV
FT                   PVSLLFTIIAVHYTGKVVAPWIPRDHSSAITEEEYVGSMALITGHQATSGNPCEGKLTD
FT                   QFGQIHYLLLEPEEGKTFTKGDKVLIICRLSATRYLAENNPWPQIL"
FT   gene            222321..222521
FT                   /locus_tag="UM146_01055"
FT   CDS_pept        222321..222521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01055"
FT                   /product="glycogen synthesis protein GlgS"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69640"
FT                   /protein_id="ADN69640.1"
FT                   /translation="MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWF
FT                   CARYAWYCQQMMQTRELELEH"
FT   gene            complement(222556..222855)
FT                   /locus_tag="UM146_01060"
FT   CDS_pept        complement(222556..222855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01060"
FT                   /product="hypothetical protein"
FT                   /note="COG2960 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69641"
FT                   /protein_id="ADN69641.1"
FT                   /translation="MIDPKKIEQIARQVHESMPKGIREFGEDVEKKIRQTLQAQLTRLD
FT                   LVSREEFDVQTQVLLRTREKLALLEQRISELEARNNPIAELQSPPAIPPVDKAE"
FT   gene            223229..223882
FT                   /gene="ribB"
FT                   /locus_tag="UM146_01065"
FT   CDS_pept        223229..223882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="UM146_01065"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="COG0108 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69642"
FT                   /protein_id="ADN69642.1"
FT                   /translation="MNQTLLSSFGTPFERVENALAALREGRGVMVLDDEDRENEGDMIF
FT                   PAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMMVENNTSAYGTGFTVTIEAAEG
FT                   VTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGVLTRGGHTEATIDLMTL
FT                   AGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHERKAS"
FT   gene            complement(223936..224985)
FT                   /locus_tag="UM146_01070"
FT   CDS_pept        complement(223936..224985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01070"
FT                   /product="putative fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69643"
FT                   /protein_id="ADN69643.1"
FT                   /translation="MITLFRLLAILCLFFNVSAFAVDCYQDGYRGTTLINGDLPAFKIP
FT                   ENAQPGQKIWESGDINITVYCDNAPGWTTDNPSENIYAWIKLPQINSADMLNNPYLTFG
FT                   VTYNGVDYEGINERIDTHACLDKYEQYYNGYYYDPVCNGSTLQKNVTFNAHFRVYVKFK
FT                   SRPAGDQTVNFGIVNVLQFDGEGGANMSSNAKNLRYVITGLDNISFLDCSVDVRIFPES
FT                   QIVNFGQIAANSIATYRPKAAFSVSTIKDVAADCTEQFDVATSFYTTDTLHDDTHLEMG
FT                   NGLLMRITDQKTQEDIKFNQYKRFTTYIPGQTGAMVTRDYQAELSQKPGETLVYGPFKK
FT                   DLIVKINYN"
FT   gene            complement(224982..225731)
FT                   /locus_tag="UM146_01075"
FT   CDS_pept        complement(224982..225731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01075"
FT                   /product="putative periplasmic pilin chaperone"
FT                   /note="COG3121 P pilus assembly protein, chaperone PapD"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69644"
FT                   /protein_id="ADN69644.1"
FT                   /translation="MNIMKSPLITTGMICLLGICNFAQATVSPDRTRIIFNASNKSATV
FT                   RLTNQSKIDPYLAQSWIEDASGKKTRDYISTLPPMERIEPDEQIQIRLMALASLNDLPQ
FT                   DRETLFYYNVREIPPRAKEQNVMQIAMQSRLKLFWRPKAIELKEGEMIPLQKVTITRTA
FT                   AGLTLNNPTPYHITVGYIGTNGKTLMPGADSIMVVPFTSATQHLSSLPSTFQLGFVADY
FT                   GGLEMFKVECNSIQSLCQSSPAKKGKI"
FT   gene            complement(225738..228260)
FT                   /locus_tag="UM146_01080"
FT   CDS_pept        complement(225738..228260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01080"
FT                   /product="putative outer membrane usher protein"
FT                   /note="COG3188 P pilus assembly protein, porin PapC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69645"
FT                   /protein_id="ADN69645.1"
FT                   /translation="MNNKNTFSRDKLSHAIKNALSGVVCSLLFVLPVHAVEFNVDMIDA
FT                   EDRENIDISRFEKKGYIPPGRYLVRVQINKNMLPQTLILEWVKADNESGSLLCLTKENL
FT                   TNFGLNTEFIESLQNIAGSECLDLSQRQELTTRLDKATMILSLSVPQAWLKYQATNWTP
FT                   PEFWDTGIAGFILDYNVYASQYAPHHGDSTQNVSSYGTLGFNLGAWRLRSDYQYNQNFA
FT                   DGRSVNRDSEFARTYLFRPIPSWSSKFTMGQYDLSSNLYDTFHFTGASLESDESMLPPD
FT                   LQGYAPQITGIAQTNAKVTVAQNGRVLYQTTVAPGPFTISDLGQSFQGLLDVTVEEEDG
FT                   RTSTFQVGSASIPYLTRKGQVRYKTSLGKPTSVGHNDINNPFFWTAEASWGWLNNVSLY
FT                   GGGMFTADDYQAITTGIGFNLNQFGSLSFDVTGADASLQQQNSGNLRGYSYRFNYAKHF
FT                   ESTGSQITFAGYRFSDKDYVSMSEYLSSRNGDESIDNEKESYVISLNQYFETLELNSYL
FT                   NVTRNTYWDSASNTNYSVSVSKNFDIGDFKGISASLAVSRIRWDDDEENQYYFSFSLPL
FT                   QQNRNISYSMQRTGSSNTSQMISWYDSSDRNNIWNISASATDDNIRDGEPTLRGSYQHY
FT                   SPWGRLNINGSVQPNQYNSVTAGWYGSLTATRHGIALHDYSYGDNARMMVDTDGISGIE
FT                   INSNRTVTNGLGIAVIPSLSNYTTSMLRVNNNDLPEGVDVENSVIRTTLTQGAIGYAKL
FT                   NATTGYQIVGVIRQENGRFPPLGVNVTDKATGKDVGLVAEDGFVYLSGIQENSTLHLTW
FT                   GDNTCEVTPPNQSNISESAIILPCKTVK"
FT   gene            complement(228347..228979)
FT                   /locus_tag="UM146_01085"
FT   CDS_pept        complement(228347..228979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01085"
FT                   /product="putative fimbrial protein"
FT                   /note="COG3539 P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69646"
FT                   /protein_id="ADN69646.1"
FT                   /translation="MSIAELILNSNLYFPHPFIKDYSHVKKTLLSMFATALLSGVAFNA
FT                   LADDANQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKSGQKSLPVDVTIHL
FT                   QDCILSDGTNTVDKVKITFSSASVDATDSNLLKNTLEGNIGGATDVGVRLVKSDNTNVT
FT                   LGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDYK"
FT   gene            229481..229651
FT                   /locus_tag="UM146_01090"
FT   CDS_pept        229481..229651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69647"
FT                   /protein_id="ADN69647.1"
FT                   /translation="MFIAWYWIVLIVLLAGGYFLHLKRYCKAFRHDRDALLAARSKLDK
FT                   RSDKEVFEKHQ"
FT   gene            complement(229713..230486)
FT                   /locus_tag="UM146_01095"
FT   CDS_pept        complement(229713..230486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01095"
FT                   /product="zinc transporter ZupT"
FT                   /note="COG0428 Predicted divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69648"
FT                   /protein_id="ADN69648.1"
FT                   /translation="MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIML
FT                   LISLMEMLPAALAAEGMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKS
FT                   IKRTAILLTLGISLHNFPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAA
FT                   TGSKRTAILWAGISGLAEILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMP
FT                   LAKEIDPNNNPSYGVLCGMSVMGFSLVLLQTAGIG"
FT   gene            230629..231417
FT                   /locus_tag="UM146_01100"
FT   CDS_pept        230629..231417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01100"
FT                   /product="hypothetical protein"
FT                   /note="COG3384 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69649"
FT                   /protein_id="ADN69649.1"
FT                   /translation="MSSTRMPALFLGHGSPMNVLEDNLYTRSWQTLGMTLPRPKAIVVV
FT                   SAHWFTRGTGVTAMETPPTIHDFGGFPQALYDTHYPAPGSPALAQRLVELLAPVPVALD
FT                   KEAWGFDHGSWGVLIKMYPDADIPMVQLSIDSSKPAAWHFEMGRKLAALRDEGIMLVAS
FT                   GNVVHNLRTVKWHGDSSPYPWATSFNEYVKANLTWQGPVEQHPLVNYLDHEGGALSNPT
FT                   PEHYLPLLYVLGAWDGQEPITIPVDGIEMGSLSMLSVQIG"
FT   gene            complement(231463..232134)
FT                   /locus_tag="UM146_01105"
FT   CDS_pept        complement(231463..232134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01105"
FT                   /product="putative disulfide oxidoreductase"
FT                   /note="COG1495 Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69650"
FT                   /protein_id="ADN69650.1"
FT                   /translation="MGIKGMWKDLRTSPVDTLVRWQEQRLLWLLMAVAMGALIILAHSF
FT                   FQIYLYMAPCEQCVYIRYAMFVMVIGGLVAAINPKNIILKLIGCVMAFYGSILGLKFSL
FT                   KLNDIHHAVHNPDPDSLFGVQGCSTDPTFPFNLPLAQWAPNWFKPTGDCGYDAPIVPDG
FT                   VTLSSTQQWFVEMYQQSEGWYLLPPWHFMNMAQACMLAFGMCLVLLVIMSGAWALKIIR
FT                   G"
FT   gene            complement(232149..232817)
FT                   /locus_tag="UM146_01110"
FT   CDS_pept        complement(232149..232817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01110"
FT                   /product="Thiol:disulfide interchange protein dsbA
FT                   precursor"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69651"
FT                   /protein_id="ADN69651.1"
FT                   /translation="MSKLGISSLFKTILLTAALAVSFTASAFTEGTDYMVLEKPIPNAD
FT                   KTLIKVFSYACPFCYKYDKAVTGPVSEKVKDIVAFTPFHLETKGEYGKQASEVFAVLIN
FT                   KDKAAGISLFDANSQFKKAKFAYYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQADFE
FT                   AALKEPAVQETLKKWKASYDVAKIQGVPAYVVNGKYLIYTKSIKSIDAMADLIRELASK
FT                   "
FT   gene            complement(232835..234631)
FT                   /locus_tag="UM146_01115"
FT   CDS_pept        complement(232835..234631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01115"
FT                   /product="arylsulfate sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69652"
FT                   /protein_id="ADN69652.1"
FT                   /translation="MFDKYRKTLVAGTVAITLGLSASGVMAAGFKPAPPAGQLGAVIVD
FT                   PYGNAPLTALVDLDSHVISDVKVTVHGKGEKGVEISYPVGQESLKTYDGVPIFGLYQKF
FT                   ANKVTVEWKENGKVMKDDYVVHTSAIVNNYMDNRSISDLQQTKVIKVAPGFEDRLYLVN
FT                   THTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWWLDQDTF
FT                   YDGRDRDINKRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLEDHKLPRGFADATHES
FT                   IETPNGTVLLRVGKSNYRRDDGVHVTTIRDHILEVDKSGRVVDVWDLTKILDPKRDALL
FT                   GALDAGAVCVNVDLAHAGQQAKLEPDTPFGDALGVGPGRNWAHVNSIAYDAKDDSIILS
FT                   SRHQGVVKIGRDKQVKWILAPSKGWEKPLASKLLKPVDANGKPITCNENGLCENSDFDF
FT                   TYTQHTAWISSKGTLTIFDNGDGRHLEQPALPTMKYSRFVEYKIDEKKGTVQQVWEYGK
FT                   ERGYDFYSPITSIIEYQADRNTMFGFGGSIHLFDVGQPTVGKLNEIDYKTKEVKVEIDV
FT                   LSDKPNQTHYRALLVRPQQMFK"
FT   gene            complement(235116..236276)
FT                   /locus_tag="UM146_01120"
FT   CDS_pept        complement(235116..236276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01120"
FT                   /product="putative enzyme"
FT                   /note="COG0754 Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69653"
FT                   /protein_id="ADN69653.1"
FT                   /translation="MERVSITERPDWREKAHEYGFNFHTMYGEPYWCEDAYYKLTLAQV
FT                   EKLEEVTAELHQMCLKVVEKVIASDELMTKFRIPKHTWSFVRQSWLTHQPSLYSRLDLA
FT                   WDGTGEPKLLENNADTPTSLYEAAFFQWIWLEDQLNAGNLPEGSDQFNSLQEKLIDRFV
FT                   ELREQYGFQLLHLTCCRDTVEDRGTIQYLQDCATEAEIATEFLYIDDIGLGEKGQFTDL
FT                   QDQVISNLFKLYPWEFMLREMFSTKLEDAGVRWLEPAWKSIISNKALLPLLWEMFPNHP
FT                   NLLPAYFAEDDHPQMEKYVVKPIFSREGANVSIIENGKTIAAAEGPYGEEGMIVQQFHP
FT                   LPKFGDSYMLIGSWLVNDQPAGIGIREDRALITQDMSRFYPHIFVE"
FT   gene            complement(236282..236953)
FT                   /locus_tag="UM146_01125"
FT   CDS_pept        complement(236282..236953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01125"
FT                   /product="hypothetical protein"
FT                   /note="COG5463 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69654"
FT                   /protein_id="ADN69654.1"
FT                   /translation="MKRTKSIRHASFRKNWSARHLTPVALAVATVFMLAGCEKSDETVS
FT                   LYQNADDCSAANPGKSAECTTAYNNALKEAERTAPKYATREDCVAEFGEGQCQQAPAQA
FT                   GMAPENQAQAQQSSGSFWMPLMAGYMMGRLMGGGAGFAQQPLFSSKNPASPAYGKYTDA
FT                   TGKNYGAAQPGRTMTVPKTAMAPKPATTTTVTRGGFGESVAKQSTMQRSATGTSSRSMG
FT                   G"
FT   gene            complement(237101..238582)
FT                   /gene="tolC"
FT                   /locus_tag="UM146_01130"
FT   CDS_pept        complement(237101..238582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="UM146_01130"
FT                   /product="outer membrane channel protein"
FT                   /note="COG1538 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69655"
FT                   /protein_id="ADN69655.1"
FT                   /translation="MKKLLPILIGLSLSGFSSLSQAENLMQVYQQARLSNPELRKSAAD
FT                   RDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKWR
FT                   ALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT
FT                   QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVEN
FT                   FKTDKPQPVNTLLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDT
FT                   SYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLES
FT                   AHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATT
FT                   TLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPE
FT                   QNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN"
FT   gene            238787..239416
FT                   /gene="nudF"
FT                   /locus_tag="UM146_01135"
FT   CDS_pept        238787..239416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="UM146_01135"
FT                   /product="ADP-ribose pyrophosphatase NudF"
FT                   /EC_number="3.6.1.13"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69656"
FT                   /protein_id="ADN69656.1"
FT                   /translation="MLKPDNLPVTFGKNDVEIIARETLYRGFFSLDLYRFRHRLFNGQM
FT                   SHEVRREIFERGHAAVLLPFDPVRDEVVLIEQIRIAAYDTSETPWLLEMVAGMIEEGES
FT                   VEDVARREAIEEAGLIVKRTKPVLSFLASPGGTSERSSIMVGEVDATTASGIHGLADEN
FT                   EDIRVHVVSREQAYQWVEEGKIDNAASVIALQWLQLHHQALKNEWA"
FT   gene            239417..239839
FT                   /locus_tag="UM146_01140"
FT   CDS_pept        239417..239839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01140"
FT                   /product="hypothetical protein"
FT                   /note="COG3151 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69657"
FT                   /protein_id="ADN69657.1"
FT                   /translation="MKRYTPDFPEMMRLCEMNFSQLRRLLPRNDAPGETVSYQVANAQY
FT                   RLTIVESTRYTTLVTIEQTAPAISYWSLPSMTVRLYHDAMVAEVCSSQQIFRFKARYDY
FT                   PNKKLHQRDEKHQINQFLADWLRYCLAHGAMAIPVY"
FT   gene            239864..240691
FT                   /locus_tag="UM146_01145"
FT   CDS_pept        239864..240691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01145"
FT                   /product="cyclic 3',5'-adenosine monophosphate
FT                   phosphodiesterase"
FT                   /note="COG1409 Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69658"
FT                   /protein_id="ADN69658.1"
FT                   /translation="MESLLTLPLAGEARVRILQITDTHLFAQKHEALLGVNTWESYQAV
FT                   LEAIRPHQHEFDLIVATGDLAQDQSSAAYQHFAEGIASFRAPCVWLPGNHDFQPAMYSA
FT                   LQDAGISPAKRVFIGEQWQILLLDSQVFGVPHGELSEFQLEWLERKLADAPERHTLLLL
FT                   HHHPLPAGCSWLDQHSLRNAGELDTVLAKFPHVKYLLCGHIHQELDLDWNGRRLLATPS
FT                   TCVQFKPHCSNFTLDTIAPGWRTLELHADGTLTTEVHRLADARFQPDTASEGY"
FT   gene            240691..241272
FT                   /locus_tag="UM146_01150"
FT   CDS_pept        240691..241272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01150"
FT                   /product="esterase YqiA"
FT                   /note="COG3150 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69659"
FT                   /protein_id="ADN69659.1"
FT                   /translation="MSTLLYLHGFNSSPRSAKASLLKNWLAEHHPDVEMIIPQLPPYPS
FT                   DAAELLESIVLEHGGDSLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLTDYLG
FT                   QNENPYTGQQYVLESRHIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCR
FT                   QTVIEGGNHAFTGFEDYFNPIVDFLGLHHL"
FT   gene            241301..243193
FT                   /locus_tag="UM146_01155"
FT   CDS_pept        241301..243193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01155"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69660"
FT                   /protein_id="ADN69660.1"
FT                   /translation="MTQTYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVD
FT                   EALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKN
FT                   YQFSGGLHGVGISVVNALSKRVEVNVRRDGQIYNIAFENGEKVQDLQVVGTCGKRNTGT
FT                   SVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDY
FT                   LAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVN
FT                   GLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSR
FT                   QCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAAKKVVRKKLTSGPALPG
FT                   KLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLAS
FT                   QEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFVKHFRALVKHG
FT                   HVYVALPPLYRIDLGKEVYYALTEEEKEGVLEQLKRKKGKPNVQRFKGLGEMNPMQLRE
FT                   TTLDPNTRRLVQLTIDDEDDQRTDAMMDMLLAKKRSEDRRNWLQEKGDMAEIEV"
FT   gene            complement(243257..245398)
FT                   /locus_tag="UM146_01160"
FT   CDS_pept        complement(243257..245398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01160"
FT                   /product="putative iron compound receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69661"
FT                   /protein_id="ADN69661.1"
FT                   /translation="MAMFTPSFSGLKGRALFSLLFAAPMIHATDSVTTKDGETITVTAD
FT                   ANTATEATDGYQPLSTSTATLTDMPMLDIPQVVNTVSDQVLENQNATTLDEALYNVSNV
FT                   VQTNTLGGTQDAFVRRGFGANRDGSIMTNGLRTVLPRSFNAATERVEVLKGPASTLYGI
FT                   LDPGGLINVVTKRPEKTFHGSVSATSSSFGGGTGQLDITGPIEGTQLAYRLTGEVQDED
FT                   YWRNFGKERSTFIAPSLTWFGDNATVTMLYSHRDYKTPFDRGTIFDLTTKQPVNVDRKI
FT                   RFDEPFNITDGQSDLAQLNAEYHLNSQWTARFDYSYSQDKYSDNQARVTAYDATTGTLT
FT                   RRVDATQGSTQRMHATRADLQGNVDIAGFYNEILGGVSYEYYDLLRTDMIRCKKAKDFN
FT                   IYNPVYGNTSKCTTVSASDSDQTIKQENYSAYAQDALYLTDNWIAVAGIRYQYYTQYAG
FT                   KGRPFNVNTDSRDEQWTPKLGLVYKLTPSVSLFANYSQTFMPQSSIASYIGDLPPESSN
FT                   AYEVGAKFELFDGITADIALFDIHKRNVLYTESIGDETIAKTAGRVRSRGVEVDLAGAL
FT                   TENINIIASYGYTDAKVLEDPDYAGKPLPNVPRHTGSLFLTYDIHNMPGNNTLTFGGGG
FT                   HGVSRRSATNGADYYLPGYFVADAFAAYKMKLQYPVTLQLNVKNLFDKTYYTSSIATNN
FT                   LGNQIGDPREVQFTVKMEF"
FT   gene            245772..246581
FT                   /locus_tag="UM146_01165"
FT   CDS_pept        245772..246581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01165"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   (fepC-like)"
FT                   /note="COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69662"
FT                   /protein_id="ADN69662.1"
FT                   /translation="MAHNAKGQGLILDNVSAGYHKKIIVDGVSFSVPTEKMTVLVGANG
FT                   CGKSTLLSTIARILQPMGGSILLDGKAIHEQPTKALSRRLGILPQSPLLPEGLTVYELV
FT                   SRGRFPWQNFIRQWSDADELAVEEALKLTGTQEFAHLPVEKLSGGQRQRCWIAMVLAQK
FT                   TPYILLDEPTTWLDLRYQVEILELLHDLTRHHGRTVVVVLHDLNFAVNYGDTLIFLRQG
FT                   KVVRVLNEGEHCTPELVKAVFDVDVHASINPLTGKPYFMPFRGVEKV"
FT   gene            246578..247561
FT                   /locus_tag="UM146_01170"
FT   CDS_pept        246578..247561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01170"
FT                   /product="putative iron compound permease protein of ABC
FT                   transporter family"
FT                   /note="COG0609 ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69663"
FT                   /protein_id="ADN69663.1"
FT                   /translation="MMRTGLVTVIFLALLLVGCVVYPGIGARFIAPQTVLQAFLHFDPQ
FT                   NFDHNVIVRLRLPRLAAALLTGASLGVAGALLQAVIRNPLGEPHILGLNAGAALAVVAA
FT                   SALGLAFPVGRPLLASTGGALLFLLILLLSSAGRSGLTPMKVTLCGVALSAFVSSITAA
FT                   ILILDEQTLLAMRTWLAGDLAGQDWATLGTSAWFSLGGFVLALYLAPSLNMLALGDRMA
FT                   QGLGVSVLRTRTFTLLAIALLCGAAVSIAGPIGFVGLLVPQIVRRLVSADLRVLLPLSA
FT                   CVGALLLLLADIIARTLFTPHELATGVMTALVGAPVFVIMATRMFK"
FT   gene            247558..248607
FT                   /locus_tag="UM146_01175"
FT   CDS_pept        247558..248607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01175"
FT                   /product="putative iron compound permease protein of ABC
FT                   transporter family"
FT                   /note="COG4779 ABC-type enterobactin transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69664"
FT                   /protein_id="ADN69664.1"
FT                   /translation="MSRIMNVGLRPLRVGKFSTLVRPKNLLLLGGLFLLAVGILIFGLM
FT                   QGSFSVPASEVGRALFAPENVSTDARYIVQDIRLPRVIMALLCGAMLGMAGAAMQSIAR
FT                   NGLADPGLIGVKEGCSVAVLWLIFQFPMLGMFWRPVAGLAGGLLVALIVIFCARDISRP
FT                   RFVLIGIGVSWFFAAGIGVFMTTADVRDVQTALMWLSGSLHAANWMLVGISACWMLPAA
FT                   LLLLFTARTADIALLGHQVATGLGVNSSRLALLRVAAPIILTAVCVSCVGNIGFVGLIA
FT                   PHISRFILRGGQTTLLLGSAVSGALLVILADSIGRLAFLPLQLPAGIIISLIGGPFFLL
FT                   LLWQRRNSF"
FT   gene            248618..249565
FT                   /locus_tag="UM146_01180"
FT   CDS_pept        248618..249565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01180"
FT                   /product="predicted ferrichrome-binding protein"
FT                   /note="COG0614 ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69665"
FT                   /protein_id="ADN69665.1"
FT                   /translation="MRLFFSLLILLSFFSRATEPVQVFTDDLGRKVTVPAHPKRIVSLH
FT                   DLDITIPLIELGVPPVASHGRTRPDGSHFIRSGALLTGVDFDNSSIAFIGTADIDIEAI
FT                   VAAKPDLIITEPTRNTPIEQLEKIAPTVSIDHLKGGAPEIYRKLAELTGTQSQLAILER
FT                   RYQAQINALKATLDSQKITVSVIQANQGKINVMHSYHSLGRVLRDAGFRFPPLIESIPE
FT                   GGRMDVSAERLPELDADFVFATWRGDTGGKPQDELAAMEKVMPGWCQFLTACRSGRYVL
FT                   ISREEAISNSFASLGLMAAQIQSQIAGRPLPEAK"
FT   gene            249562..250449
FT                   /locus_tag="UM146_01185"
FT   CDS_pept        249562..250449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01185"
FT                   /product="putative bifunctional protein: transcriptional
FT                   regulator and sugar phosphate isomerase"
FT                   /note="COG1737 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69666"
FT                   /protein_id="ADN69666.1"
FT                   /translation="MIQKDKARVDIFGERFRTRASQLTPGLRAVASYINEHREVVLEQT
FT                   AMEIAATLNTSDATVIRAIQALGFAGLRDLKRTLEQWLGPALSSSEKMSTTVSNLTSDV
FT                   NTAIDFVLEGHLYTCNVLSEPENRHALAQAVALLVQARQVAIFGIGASGILADYTARLF
FT                   NRIGLPATALNRTGIGLAEQLIALQRGDVLIMMAQKSAHREGLTTLREARRLGIPVILL
FT                   TNALDSRFSKDASIVIHVPRGDEKGKTPLHGTVLLCLEMIVWSVASAVPQRAVKTIKRI
FT                   NDFHRGLKTGRKNG"
FT   gene            complement(250494..250808)
FT                   /locus_tag="UM146_01190"
FT   CDS_pept        complement(250494..250808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01190"
FT                   /product="quinol monooxygenase"
FT                   /note="COG1359 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69667"
FT                   /protein_id="ADN69667.1"
FT                   /translation="MITVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVD
FT                   CAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPGL
FT                   "
FT   gene            complement(250839..251420)
FT                   /locus_tag="UM146_01195"
FT   CDS_pept        complement(250839..251420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01195"
FT                   /product="Modulator of drug activity B"
FT                   /note="COG2249 Putative NADPH-quinone reductase (modulator
FT                   of drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69668"
FT                   /protein_id="ADN69668.1"
FT                   /translation="MSNILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDVRIVRAD
FT                   SDYDVKAEVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYASDGRTRKDP
FT                   SKKYGSGGLVQGKKYMLSLTWNAPMEAFTEKDQFFHGVGVDGVYLPFHKANQFLGMEPL
FT                   PTFIANDVIKMPDVPRYTEEYRKHLVEIFG"
FT   gene            251670..252149
FT                   /locus_tag="UM146_01200"
FT   CDS_pept        251670..252149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01200"
FT                   /product="hypothetical protein"
FT                   /note="COG3157 Hemolysin-coregulated protein
FT                   (uncharacterized)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69669"
FT                   /protein_id="ADN69669.1"
FT                   /translation="MSNMIYLSIKGKIQGLISEGCGSYASIGNKYQINHVDEIFVLQFD
FT                   HSLSREYNVVHHPIKFYKPIDKSSPLLNAALSENEELSAVFNFYRINSGGCIERFYTIE
FT                   LQGAHLSNILTCYPHSITHAGNQPEDVIVLNYKNITWKHHIASTESYSCWEERIF"
FT   gene            252152..252862
FT                   /locus_tag="UM146_01205"
FT   CDS_pept        252152..252862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69670"
FT                   /protein_id="ADN69670.1"
FT                   /translation="MKSDLTIKNRYCTIPQAKFRKWDEMDVLLWKLGKNDSRRRSGVYY
FT                   LNAYKDAYVQYNRDKIIKHAYAAGIRPELLGGVAWIESGGMPENYKFQIYETKRMIGLL
FT                   DMPENKTSFGSMGIQIRTAAITLGLDPSELTTRNQLELATCLMEDDFTFQIAATYLRDL
FT                   VLFDYPSSATLYMTNEQYIMAGIRYNRGVERDLGFFICLINNLPARDTDDYKFISYGMR
FT                   LLEIREHIKKLINE"
FT   gene            252869..253201
FT                   /locus_tag="UM146_01210"
FT   CDS_pept        252869..253201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69671"
FT                   /protein_id="ADN69671.1"
FT                   /translation="MLKKQLLSIFEALLYIMLTYWLIDSFFAFNKYDWMLESGDNICSI
FT                   PSVSGEDRILQAMIAAFFLLTPLIILILRKLFMREMFEFWLYVFSLVICLGCGWWLFWG
FT                   RFIFCY"
FT   gene            complement(253247..254596)
FT                   /locus_tag="UM146_01215"
FT   CDS_pept        complement(253247..254596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01215"
FT                   /product="sensor protein QseC"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69672"
FT                   /protein_id="ADN69672.1"
FT                   /translation="MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFD
FT                   TQLMLFAKRLSTLDLNEINAADRMAQTPNKLKHGHVDDDALTFAIFTHDGRMVLNDGDN
FT                   GEDIPYSYQREGFADGQLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQ
FT                   LIPWLVALPIMLIIMMVLLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVES
FT                   LNQLFARTHAMMVRERRFTSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHS
FT                   GIDRATRLVDQLLTLSRLDSLDNLQDVAEIPLEDLLQSSVMDIYHTAQQANIDVRLTLN
FT                   ANGIKRTGQPLLLSLLVRNLLDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALAR
FT                   IGERFYRPPGQTATGSGLGLSIVQRIAKLHDMNVEFGNAEQGGFEAKVSW"
FT   gene            complement(254593..255252)
FT                   /locus_tag="UM146_01220"
FT   CDS_pept        complement(254593..255252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01220"
FT                   /product="DNA-binding transcriptional regulator QseB"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69673"
FT                   /protein_id="ADN69673.1"
FT                   /translation="MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPY
FT                   DAVILDLTLPGMDGRDILREWREKGQREPVLILTARDALAERVEGLRLGADDYLCKPFA
FT                   LIEVAARLEALMRRTNGQASNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLELLMR
FT                   NAGRVLPRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGEK"
FT   gene            complement(255237..255404)
FT                   /locus_tag="UM146_01225"
FT   CDS_pept        complement(255237..255404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69674"
FT                   /protein_id="ADN69674.1"
FT                   /translation="MFITPFNVCFRAFNKIVLNNFLREKIKFNAVQSALQHGLLAANTV
FT                   IAGMKKCEFY"
FT   gene            255403..255795
FT                   /locus_tag="UM146_01230"
FT   CDS_pept        255403..255795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01230"
FT                   /product="Protein ygiW"
FT                   /note="COG3111 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69675"
FT                   /protein_id="ADN69675.1"
FT                   /translation="MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGS
FT                   VTTVESAKSLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDT
FT                   VEIQGEVDKDWNSVEIDVKQIRKVNP"
FT   gene            255848..256330
FT                   /locus_tag="UM146_01235"
FT   CDS_pept        255848..256330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01235"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG3449 DNA gyrase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69676"
FT                   /protein_id="ADN69676.1"
FT                   /translation="MTNLTLDVNIIDFPSIPVAMLPHRCSPELLNYSVAKFIMWRKETG
FT                   LSPVNQSQTFGVAWDDPATTAPEAFRFDICGSVSEPIPDNRYGVSNGELTGGRYAVARH
FT                   VGELDDISHTIWGIIRHWLPASGEKMRKAPILFHYTNLAEGMTERRLETDIYVPLA"
FT   gene            256439..258046
FT                   /locus_tag="UM146_01240"
FT   CDS_pept        256439..258046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01240"
FT                   /product="putative binding protein"
FT                   /note="COG4166 ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69677"
FT                   /protein_id="ADN69677.1"
FT                   /translation="MYTRNLLWLVSLVSAAPLYAADVPANTPLAPQQVFRYNNHSDPGT
FT                   LDPQKVEENTAAQIVLDLFEGLVWMDGEGQVQPAQAERWEILDDGKRYIFHLRSGLQWS
FT                   DGQPLTAEDFVLGWQRAVDPKTASPFAGYLAQAHINNAAAIVAGKADVTSLGVKATDDR
FT                   TLEVTLEQPVPWFTTMLAWPTLFPVPHHVIAKHGDSWSKPENMVYNGAFVLDKWVVNEK
FT                   ITARKNPKYRDAQHTVLQQVEYLALDNSVTGYNRYRAGEVDLTWVPAQQIPAIEKSQPG
FT                   ELRIIPRLNSEYYNFNLEKPPFNDVRVRRALYLTVDRQLIAQKVLGLRTPATTLTPPEV
FT                   KGFSATTFDELQKPMSERVAMAKVLLKQAGYDASHPLRFELFYNKYDLHEKTAIALSSE
FT                   WKKWLGAQVTLRTMEWKTYLDARRAGDFMLSRQSWDATYNDASSFLNTLKSDSEENVGH
FT                   WKNAQYDALLNQATQITDATKRNALYQQAEVIINQQAPLIPIYYQPLIKLLKPYVGGFP
FT                   LHNPQDYVYSKELYIKAH"
FT   gene            258184..260442
FT                   /locus_tag="UM146_01245"
FT   CDS_pept        258184..260442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01245"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69678"
FT                   /protein_id="ADN69678.1"
FT                   /translation="MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRI
FT                   VYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQG
FT                   NWGAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPN
FT                   ILLNGTTGIAVGMATDIPPHNLREVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEII
FT                   TSRAEIRKIYENGRGSVRMRAVWKKEDGAVVISALPHQVSGARVLEQIAAQMRNKKLPM
FT                   VDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAV
FT                   KNLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEP
FT                   KPALMSRFGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMN
FT                   NLLKKELQADAQAYGDERRSPLQEREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHD
FT                   IDAPGLNYKAGDSFKAAVKGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTL
FT                   PPGATVDHMLMESDDQKLLMASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVV
FT                   IEDASDMLLAITQAGRMLMFPVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPP
FT                   QSTLTIHVGKRKIKLRPEELQKVAGERGRRGTLMRGLQRIDRVEIDSPRRASSGDSEE"
FT   gene            260677..261414
FT                   /locus_tag="UM146_01250"
FT   CDS_pept        260677..261414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01250"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69679"
FT                   /protein_id="ADN69679.1"
FT                   /translation="MLYIFRLIITVIYSILVCVFGSIYCLFSPRNPKHVATFGHMFGRL
FT                   APLFGLKVECRKPADAESYGNAIYIANHQNNYDMVTASNIVQPPTVTVGKKSLLWIPFF
FT                   GQLYWLTGNLLIDRNNRTKAHGTIAEVVNHFKKRRISIWMFPEGTRSRGRGLLPFKTGA
FT                   FHAAIAAGVPIIPVCVSTTSNKINLNRLHNGLVIVEMLPPIDVSQYGKDQVRELAAHCR
FT                   SIMEQKIAELDKEVAEREAAGKV"
FT   gene            261489..262901
FT                   /locus_tag="UM146_01255"
FT   CDS_pept        261489..262901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01255"
FT                   /product="repressor protein for FtsI"
FT                   /note="COG2132 Putative multicopper oxidases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69680"
FT                   /protein_id="ADN69680.1"
FT                   /translation="MSLSRRQFIQASGIALCAGAVPLKASAAGQQQPLPVPPLLESRRG
FT                   QPLFMTVQRAHWSFTPGTRASVWGINGRYLGPTIRVWKGDDVKLIYSNRLTENVSMTVA
FT                   GLQVPGPLMGGPARMMSPNADWAPVLPIRQNAATLWYHANTPNRTAQQVYNGLAGMWLV
FT                   EDEVSKSLPIPNHYGVDDFPVIIQDKRLDNFGTPEYNEPGSGGFVGDTLLVNGVQSPYV
FT                   EVSRGWVRLRLLNASNSRRYQLQMSDGRPLHVISGDQGFLPAPVSVKQLSLAPGERREI
FT                   LVDMSNGDEVSITCGEAASIVDRIRGFFEPSSILVSTLVLTLRPTGLLPLVTDSLPMRL
FT                   LPTEIMAGSPIRSRDISLGDDPGINGQLWDVNRIDVTAQQGTWERWTVRADEPQAFHIE
FT                   GVMFQIRNVNGAMPFPEDRGWKDTVWVDGQVELLVYFGQPSWAHFPFYFNSQTLEMADR
FT                   GSIGQLLVNPVP"
FT   gene            complement(262972..264276)
FT                   /locus_tag="UM146_01260"
FT   CDS_pept        complement(262972..264276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01260"
FT                   /product="c4-dicarboxylate permease"
FT                   /note="COG1593 TRAP-type C4-dicarboxylate transport system,
FT                   large permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69681"
FT                   /protein_id="ADN69681.1"
FT                   /translation="MEFEYIYPVLILFGSFAVMLAIGVPITFAIGLSSLLSIITALPPD
FT                   AAISVISQKMTVGLDGFTLLAIPFFVLAGNIMNTGGIARRLVNLAQALVGRLPGSLAHC
FT                   NILANTLFGAISGSAVASAAAVGGIMSPLQEKEGYDPAFSAAVNIASAPIGLMIPPSNV
FT                   LIVYSLASGGTSVAALFLAGYLPGILTAVALMFVAALYARRHHYPVAERINYRQFLQVF
FT                   RESIPSLMLIFIIIGGIIAGVFTPTEASAIAVIYSLALAMIYREITLKKLNDILLDSVV
FT                   TSSIVLLLVGCSMGMSWAMTNADVPELINELITRVSDNKWVILFIINIILLIVGTFMDI
FT                   TPAILIFTPIFLPIAQHLGIDPIHFGIIMVFNLTIGLCTPPVGTILFVGCSIGKVSIDR
FT                   AIKPLLPMFLALFVVMAIICYFPQLSLMLPGLFST"
FT   gene            complement(264287..264769)
FT                   /locus_tag="UM146_01265"
FT   CDS_pept        complement(264287..264769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01265"
FT                   /product="putative membrane protein; putative TRAP-type
FT                   C4-dicarboxylate transport system, small permease
FT                   component"
FT                   /note="COG3090 TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69682"
FT                   /protein_id="ADN69682.1"
FT                   /translation="MRTLTHILNKILAGCCCIILAIMVFCVTWQVIARFIFNAPSTVLD
FT                   EFTQILFMWMILLGGVYTAGLKKHLAIDLLAQKLPAASVLTLDSFIQIIITVFAVIFMI
FT                   YGGNIVVEKAQHVGQISPVLKWPMDKVYWVMPVSGLILVWYSVMNIIDNYRKRNSH"
FT   gene            complement(264811..265794)
FT                   /locus_tag="UM146_01270"
FT   CDS_pept        complement(264811..265794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01270"
FT                   /product="putative c4-dicarboxylate transport system
FT                   binding protein; putative secreted protein"
FT                   /note="COG1638 TRAP-type C4-dicarboxylate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69683"
FT                   /protein_id="ADN69683.1"
FT                   /translation="MKALRPLTASLMLLTSCLLISNTTLAKTTLKLSHNQDKSHAVHKA
FT                   LSYLADKTKEYSNGELVIRIYPNATLGNERESLELMNSGALQMVKVNAASLESFAPDYS
FT                   LFSLPFLFRDRDHYYRVLQSDLGKKILNSSERKGFVGITYYDGGARSFYSNKPITKPED
FT                   LAGMKIRVQQSPSAIAMMKALGGVATPMAQGELYTALQQGVVDGGENNTVVYADMRHAE
FT                   VAKVYSRDEHTMVPDVLIISTDVLNKLGDKERTALLKAADESMMQMKDVIWPAAEKEAY
FT                   DKMKGMNATVVDVDKSAFKERVKPLYDEFKAKDAQSAKNLELVESM"
FT   gene            complement(265867..266877)
FT                   /locus_tag="UM146_01275"
FT   CDS_pept        complement(265867..266877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01275"
FT                   /product="Ureidoglycolate dehydrogenase"
FT                   /note="COG2055 Malate/L-lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69684"
FT                   /protein_id="ADN69684.1"
FT                   /translation="MTTVYVSEENLKSLVHHKLHTAGLDTDTIQQVTDVLVHADITGVH
FT                   SHGVMRVEHYCTRLAAGGLNKAPQFSIEQISPSVAILDSDDGMGHSALISATEHAIKLA
FT                   QQEGLGFVSVKNTSHCGALSYFAEMITHKGLVAIVMTQTDTCVAPHGGAERFLGTNPIA
FT                   FGFPVENSHPMIVDMATSATAFGKILHAKETGKHIGEGLAIDKNGYGTTDPYKIENLLP
FT                   FGQHKGSGIALAIDALTGVLMNANFGNHIVRMYGDYDKMRKLASLVIAIDPKKLGNPVF
FT                   AKTMAKMVTELHAVKPAPGVEKVLAPNDPQMHYKEKCQQEGIPVPAGIFHYLAEN"
FT   gene            complement(266888..267904)
FT                   /locus_tag="UM146_01280"
FT   CDS_pept        complement(266888..267904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01280"
FT                   /product="putative L-threonine 3-dehydrogenase"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69685"
FT                   /protein_id="ADN69685.1"
FT                   /translation="MKTLICQQPGVMEYVEKDIPTPADNEVLLKIKAVGICGTDIHAFA
FT                   GRQPFFSYPRVLGHEICAEAVSRGSQCQTAQSGQRYSVIPCIPCGECAACREEKTNCCE
FT                   RVSLYGVHQDGGFSEYLAVREDNLVPLPDEVSDSAGALVECFAIGAHAVRRAEIKAEQN
FT                   VLVIGAGPIGLATAAIARAKGAHVVVADIDCQRRQHVVDHLAINVFDPTQEGFIAALSE
FT                   VFGGELACVVLDATGNKASMSHDVNLIRHGGKIVFIGLYIGELVIDDPTFHKKETTLLS
FT                   SRNATREDFALVIELMRSNKIHENLMKNQAFNFFSVGEDYQRNVVENKNMVKGVITF"
FT   gene            complement(267901..269373)
FT                   /locus_tag="UM146_01285"
FT   CDS_pept        complement(267901..269373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01285"
FT                   /product="putative Fructuronate reductase"
FT                   /note="COG0246 Mannitol-1-phosphate/altronate
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69686"
FT                   /protein_id="ADN69686.1"
FT                   /translation="MSGNESIAAAHYDQVTTWPRDGLQADIVHIGFGAFHRGHQAVYTD
FT                   LANQLSDTRWGIFEINLFGDAQLIENLNAQNGLFSVVETSASQSTSRLVRSVAGGIHTP
FT                   RDGIAAAIHKLAEPQVKIVSLTITEKGYCLDPQTRSLDLTNGLINHDLQNPDAPQSAIG
FT                   VIVCALQQRKAAGLAAFSVLSCDNLPDNGHLTRNAVLGFARQLDQPLAQWIEENVSFPG
FT                   TMVDRIVPAMTESQFALLETKTGYADPCGIVCESFRQWVIEDNFVRGRPEWDKAGAMFV
FT                   SNVQPYEEMKLRMLNGSHSFLAYNGSLAGYEFIWQCMEDANFRSITHQLMINEQARTLN
FT                   PDLNINIQEYADLLIERFSNRNVAHRTGQIAMDGSQKLPQRALTPWLKLHQQKQNNAVL
FT                   SLLVAGWLHYVIDAVEKSQSVADPMNDQFQALIKEQQDAWQQALALLHLSAIFGDLSNH
FT                   QPFINEIKIAFANIKNKGIKATISQLLSDEQK"
FT   gene            complement(269696..270445)
FT                   /locus_tag="UM146_01290"
FT   CDS_pept        complement(269696..270445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01290"
FT                   /product="putative regulator"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69687"
FT                   /protein_id="ADN69687.1"
FT                   /translation="MEQVITKRRYYDIGLQIEELLYSGVFKAGERLPSERELSERFNTS
FT                   RTTIREAIIMLELKGVLNVKQGSGIFFVDSTDKLNQKSLMPYSEIGPFELLQARQVIES
FT                   NITGFAASQISFNELQELKKIISLQENAIAAESDRFEDLDHRFHSIIAEATQNRVLIKQ
FT                   AAELWRAVRTENPRWKKLNYKYLHEKHLRLQWLEDHRAIFLALQQKDSELAREASWRHL
FT                   ENSKNELIKIFKQDASISDFDDFFFAR"
FT   gene            270697..272916
FT                   /locus_tag="UM146_01295"
FT   CDS_pept        270697..272916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01295"
FT                   /product="hypothetical protein"
FT                   /note="COG1032 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69688"
FT                   /protein_id="ADN69688.1"
FT                   /translation="MSSISLIQPDRDLFSWPQYWAACFGPAPFLPMSREEMDQLGWDSC
FT                   DIILVTGDAYVDHPSFGMAICGRMLEAQGFRVGIIAQPDWSSKDDFMRLGKPNLFFGVT
FT                   AGNMDSMINRYTADRRLRHDDAYTPDNVAGKRPDRATLVYTQRCKEAWKDVPVILGGIE
FT                   ASLRRTAHYDYWSDTVRRSVLVDSKADMLMFGNGERPLVEVAHRLAMGEPISEIRDVRN
FT                   TAIIVKEALPGWSGVDSTRLDTPGKIDPIPHPYGEDLPCADNKPVAPKKQEAKAVTVQP
FT                   PRPKPWEKTYVLLPSFEKVKGDKVLYAHASRILHHETNPGCARALMQKHGDRYVWINPP
FT                   AIPLSTEEMDSVFALPYKRVPHPAYGNARIPAYEMIRFSVNIMRGCFGGCSFCSITEHE
FT                   GRIIQSRSEDSIINEIEAIRDTVPGFTGVISDLGGPTANMYMLRCKSPRAEQTCRRLSC
FT                   VYPDICPHMDTNHEPTINLYRRARDLKGIKKILIASGVRYDIAVEDPRYIKELATHHVG
FT                   GYLKIAPEHTEEGPLSKMMKPGMGSYDRFKELFDTYSKQAGKEQYLIPYFISAHPGTRD
FT                   EDMVNLALWLKKHRFRLDQVQNFYPSPLANSTTMYYTGKNPLAKIGYKSEDVFVPKGDK
FT                   QRRLHKALLRYHDPANWPLIRQALEAMGKKHLIGSRRDCLVPAPTIEEMREARRQNRNT
FT                   RPALTKHTPMATQRQTPATAKKASSTQSRLQNAGAKKRPKAAVGR"
FT   gene            complement(272958..273215)
FT                   /locus_tag="UM146_01300"
FT   CDS_pept        complement(272958..273215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01300"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69689"
FT                   /protein_id="ADN69689.1"
FT                   /translation="MKTIFTVGAVVLATCLLSGCVNEQKINQLASNVQTLNAKIARLEQ
FT                   DMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCLRMYAE"
FT   gene            complement(273266..274192)
FT                   /locus_tag="UM146_01305"
FT   CDS_pept        complement(273266..274192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69690"
FT                   /protein_id="ADN69690.1"
FT                   /translation="MKIILLFLAALASFTVHAQPPSQTVEQTVRHIYQNYKSDATAPYF
FT                   GETGERAITSARIQQALTLNDNLTLPGNIGWLDYDPVCDCQDFGDLVLESVAITQTDAD
FT                   HADAVVRFRIFKDDKEKTSQTLKMVAENGRWVIGDIVSNHGSVLQAVNSENEKTLAAIA
FT                   SLQKEQPEAFVAELFEHIADYSWPWTWVVSDSYRQAVNAFYKTTFKTANNPDEDMQIER
FT                   QFIYDNPICFGEESLFSRVDEIRVLEKTTDSARIHVRFTLTNGNNEEQELILQRREGKW
FT                   EIADFIRPNSGSLLKQIEAKTAARLKQ"
FT   gene            complement(274392..275219)
FT                   /gene="dkgA"
FT                   /locus_tag="UM146_01310"
FT   CDS_pept        complement(274392..275219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="UM146_01310"
FT                   /product="2,5-diketo-D-gluconate reductase A"
FT                   /EC_number="1.1.1.274"
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69691"
FT                   /protein_id="ADN69691.1"
FT                   /translation="MANPTVIKLQDGNVMPQLGLGVWQASNEEVITAIQKALEVGYRSI
FT                   DTAAAYKNEEGVGKALKNASVNREELFITTKLWNDDHKRPREALLDSLKKLQLDYIDLY
FT                   LMHWPVPAIDHYVEAWKGMIELQKEGLIKSIGVCNFQIHHLQRLIDETGVTPVINQIEL
FT                   HPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHL
FT                   DSGLVVIPKSVTPSRIVENFDVWDFRLDKDELGEIAKLDQGKRLGPDPDQFGG"
FT   gene            complement(275324..276487)
FT                   /locus_tag="UM146_01315"
FT   CDS_pept        complement(275324..276487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01315"
FT                   /product="alcohol dehydrogenase, NAD(P)-dependent"
FT                   /note="COG1979 Uncharacterized oxidoreductases,
FT                   Fe-dependent alcohol dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69692"
FT                   /protein_id="ADN69692.1"
FT                   /translation="MNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTG
FT                   VLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFI
FT                   AAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAF
FT                   HSAHVQPVFAVLDPVYTYTLPSRQVANGVVDAFVHTVEQYVTKPVDAKIQDRFAEGILL
FT                   TLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDH
FT                   AQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVP
FT                   THLSDYGLDGSSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR"
FT   gene            276624..277580
FT                   /locus_tag="UM146_01320"
FT   CDS_pept        276624..277580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01320"
FT                   /product="putative DNA-binding transcriptional regulator,
FT                   ARAC-type"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69693"
FT                   /protein_id="ADN69693.1"
FT                   /translation="MLQNCAQSNCRIIPKKLRDMKREEICRLLADKVNKLKNKENSLSE
FT                   LLPDVRLLYGETPFARTPVMYEPGIIILFSGHKIGYINERVFRYDANEYLLLTVPLPFE
FT                   CETYATSEVPLAGLRLNVDILQLQELLMDIGEDEHFQPSMAASGINSATLSEEILCAAE
FT                   RLLDVMERPLDARILGKQIIREILYYVLTGPCGGALLALVSRQTHFSLISRVLKRIENK
FT                   YTENLSVEQLAAEANMSVSAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAA
FT                   AMRVGYESASQFSREFKRYFGVTPGEDAARMRAMQGN"
FT   gene            complement(277620..278279)
FT                   /locus_tag="UM146_01325"
FT   CDS_pept        complement(277620..278279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01325"
FT                   /product="hypothetical protein"
FT                   /note="COG0586 Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69694"
FT                   /protein_id="ADN69694.1"
FT                   /translation="MAVIQDIIAALWQHDFAALADPHIVSVVYFVMFATLFLENGLLPA
FT                   SFLPGDSLLILAGALIAQGVMDFLPTIAILTAAASLGCWLSYIQGRWLGNTKTVKGWLA
FT                   QLPAKYHQRATCMFDRHGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSGLL
FT                   WVSVVTSFGYALSMIPFVKRHEDQVMTFLMILPIALLTAGLLGTLFVVIKKKYCNA"
FT   gene            complement(278419..279606)
FT                   /locus_tag="UM146_01330"
FT   CDS_pept        complement(278419..279606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01330"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="COG0626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69695"
FT                   /protein_id="ADN69695.1"
FT                   /translation="MADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHA
FT                   TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFVEQGDHV
FT                   LMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVNHLQPNTKIVFLESPGSITMEV
FT                   HDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGT
FT                   AVCNARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHP
FT                   QVARVNHPALPGSKGYEFWKRDFTGSSGLFSFVLKKKLNDEELANYLDNFSLFSMAYSW
FT                   GGYESLILANQPEHIAAIRPQGKIDFSGTLIRLHIGLEDVDDLIADLDAGFARIV"
FT   gene            279858..280592
FT                   /locus_tag="UM146_01335"
FT   CDS_pept        279858..280592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01335"
FT                   /product="biopolymer transport protein ExbB"
FT                   /note="COG0811 Biopolymer transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69696"
FT                   /protein_id="ADN69696.1"
FT                   /translation="MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKS
FT                   VEFFNQKRRLKREQQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDN
FT                   EGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQ
FT                   TTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSR
FT                   DLDLEASAAAHPVRVAQKLRAG"
FT   gene            280599..281024
FT                   /locus_tag="UM146_01340"
FT   CDS_pept        280599..281024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01340"
FT                   /product="biopolymer transport protein ExbD"
FT                   /note="COG0848 Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69697"
FT                   /protein_id="ADN69697.1"
FT                   /translation="MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDV
FT                   KVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFF
FT                   RADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK"
FT   gene            complement(281063..281947)
FT                   /locus_tag="UM146_01345"
FT   CDS_pept        complement(281063..281947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01345"
FT                   /product="oxidoreductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69698"
FT                   /protein_id="ADN69698.1"
FT                   /translation="MSHLKDPTTQYYTGEYPKQKQPTPGIQAKMTPVPDCGEKTYVGSG
FT                   RLKDRKALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEECGRKAVL
FT                   LPGDLSDEKFARSLVHEAHKALGGLDIMALVAGKQVAIPDIADLTSEQFQKTFAINVFA
FT                   LFWLTQEAIPLLPKGASIITTSSIQAYQPSPHLLDYAATKAAILNYSRGLAKQVAEKGI
FT                   RVNIVAPGPIWTALQISGGQTQDKIPQFGQKTPMKRAGQPAELAPVYVYLASQESSYVT
FT                   AEVHGVCGGEHLG"
FT   gene            282138..282632
FT                   /locus_tag="UM146_01350"
FT   CDS_pept        282138..282632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01350"
FT                   /product="hypothetical protein"
FT                   /note="COG2862 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69699"
FT                   /protein_id="ADN69699.1"
FT                   /translation="MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNI
FT                   FSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATS
FT                   LKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHN
FT                   H"
FT   gene            complement(282672..283712)
FT                   /locus_tag="UM146_01355"
FT   CDS_pept        complement(282672..283712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01355"
FT                   /product="aldo-keto reductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69700"
FT                   /protein_id="ADN69700.1"
FT                   /translation="MVWLANPERYGRMQYRYCGKSGLRLPALSLGLWHNFGHVNALESQ
FT                   RAILRKAFDLGITHFDLANNYGPPPGSAEENFGRLLREDFAAYRDELIISTKAGYDMWP
FT                   GPYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENTPMEETASALAHSVQSGKAL
FT                   YVGISSYSPERTQKMVELLREWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAF
FT                   TPLAQGLLTGKYLNGIPQDSRMHREGNKVRGLTPKMLTEANLNSLRLLHEMAQQRGQSM
FT                   AQMALSWLLKDERVTSVLIGASRAEQLEENVQALNNLTFSTEELAQIDQHIADGELNLW
FT                   QASSDK"
FT   gene            283869..284756
FT                   /locus_tag="UM146_01360"
FT   CDS_pept        283869..284756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01360"
FT                   /product="putative enzyme"
FT                   /note="COG0412 Dienelactone hydrolase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69701"
FT                   /protein_id="ADN69701.1"
FT                   /translation="MPRLTAKDFPQELLDYYDYYAHGKISKREFLNLAAKYAVGGMTAL
FT                   ALFDLLKPNYALATQVEFTDPEIVAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAVVVV
FT                   HENRGLNPYIEDVTRRVAKAGYIALAPDGLSSVGGYPGNDDKGRELQQQVDPTKLMNDF
FT                   FAAIEFMQRYPQATGKVGISGFCYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKIE
FT                   APLLLHYAELDSRINEGWPAYEAALKANNKVYEAYIYPEVNHGFHNDSTPRYDKSAADL
FT                   AWQRTLKWFDKYLS"
FT   gene            284875..285162
FT                   /locus_tag="UM146_01365"
FT   CDS_pept        284875..285162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69702"
FT                   /protein_id="ADN69702.1"
FT                   /translation="MNNHFGKGLMAGLKATHADSAVNVTKFCADYKRGFVLGYSHRMYE
FT                   KTGDRQLSAWEAGILTRRYGLDKEMVMDFFRENNSCSTLRFFMAGYRLEN"
FT   gene            285351..286469
FT                   /locus_tag="UM146_01370"
FT   CDS_pept        285351..286469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01370"
FT                   /product="hydrogenase 2 small subunit"
FT                   /EC_number="1.12.99.6"
FT                   /note="COG1740 Ni,Fe-hydrogenase I small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69703"
FT                   /protein_id="ADN69703.1"
FT                   /translation="MTGDNTLIHSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVTN
FT                   PQRPPVIWIGAQECTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHN
FT                   ALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGV
FT                   AAAGVNPTGAVSLQEVLPGKTVINIPGCPPNPHNFLATVAHIITYGKPPKLDDKNRPTF
FT                   AYGRLIHEHCERRPHFDAGRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVG
FT                   GVWPVAIGHPCYGCNEEGIGFHKGIHQLANVENQTPRSQKPDVNAKEGGNVSAGAIGLL
FT                   GGVVGLVAGVSVMAVRELGRQQKKDNADSRGE"
FT   gene            286472..287458
FT                   /locus_tag="UM146_01375"
FT   CDS_pept        286472..287458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01375"
FT                   /product="hydrogenase 2 protein HybA"
FT                   /note="COG0437 Fe-S-cluster-containing hydrogenase
FT                   components 1"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69704"
FT                   /protein_id="ADN69704.1"
FT                   /translation="MNRRNFIKAASCGALLTGALPSVSHAAAENRPPIPGSLGMLYDST
FT                   LCVGCQACITKCQDINFPERNPQGEQTWSNNDKLSPYTNNIIQVWTSGTGVNKDQEENG
FT                   YAYIKKQCMHCVDPNCVSVCPVSALKKDPKTGIVHYDKDVCTGCRYCMVACPYNVPKYD
FT                   YNNPFGALHKCELCNQKGVERLDKGGLPGCVEVCPAGAVIFGTREELMAEAKKRLALKP
FT                   GSEYHYPRQTLKSGDTYLHTVPKYYPHLYGEKEGGGTQVLVLTGVPYENLDLPKLDDLS
FT                   TGARSEHVQHTLYKGMMLPLAVLAGLTVLVRRNTKNDHHDGGDDHES"
FT   gene            287448..288626
FT                   /locus_tag="UM146_01380"
FT   CDS_pept        287448..288626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01380"
FT                   /product="putative hydrogenase 2 b cytochrome subunit"
FT                   /note="COG5557 Polysulphide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69705"
FT                   /protein_id="ADN69705.1"
FT                   /translation="MSHDPQPLGGKIISKPVMIFGPLIVICMLLIVKRLVFGLGSVSDL
FT                   NGGFPWGVWIAFDLLIGTGFACGGWALAWAVYVFNRGQYHPLVRPALLASLFGYSLGGL
FT                   SITIDVGRYWNLPYFYIPGHFNVNSVLFETAVCMTIYIGVMALEFAPALFERLGWKLSL
FT                   KRLNKVMFFIIALGALLPTMHQSSMGSLMISAGYKVHPLWQSYEMLPLFSLLTAFIMGF
FT                   SIVIFEGSLVQAGLRGNGPDEKSLFVKLTNTISVLLAIFIVLRFGELIYRDKLSLAFAG
FT                   DFYSVMFWIEVLLMLFPLVVLRVAKLRNDSRMLFLSALSALLGCATWRLTYSLVAFNPG
FT                   GGYAYFPTWEELLISIGFVAIEICAYIVLIRLLPILPPLKQNDHNRHEASKA"
FT   gene            288623..290326
FT                   /locus_tag="UM146_01385"
FT   CDS_pept        288623..290326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01385"
FT                   /product="hydrogenase 2 large subunit"
FT                   /EC_number="1.12.99.6"
FT                   /note="COG0374 Ni,Fe-hydrogenase I large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69706"
FT                   /protein_id="ADN69706.1"
FT                   /translation="MSQRITIDPVTRIEGHLRIDCEIENGVVSKAWASGTMWRGMEEIV
FT                   KNRDPRDAWMIVQRICGVCTTTHALSSVRAAESALNIDVPVNAQYIRNIILAAHTTHDH
FT                   IVHFYQLSALDWVDITSALQADPTKASEMLKGVSTWHLNSPEEFTKVQNKIKDLVASGQ
FT                   LGIFANGYWGHPAMKLPPEVNLIAVAHYLQALECQRDANRVVALLGGKTPHIQNLAVGG
FT                   VANPINLDGLGVLNLERLMYIKSFIDKLSDFVEQVYKVDTAVIAAFYPEWLTRGKGAVN
FT                   YLSVPEFPTDSKNGSFLFPGGYIENADLSSYRPITSHSDEYLIKGIQESAKHSWYKDEA
FT                   PQAPWEGTTIPAYDGWSDDGKYSWVKSPTFYGKTVEVGPLANMLVKLAAGRESTQNKLN
FT                   EIVAIYQKLTGNTLEVAQLHSTLGRIIGRTVHCCELQDILQNQYSALITNIGKGDHTTF
FT                   VKPNIPATGEFKGVGFLEAPRGMLSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGP
FT                   YEQSLVGTPVADPNKPLEVVRTIHSFDPCMACAVHVVDADGNEVVSVKVL"
FT   gene            290326..290820
FT                   /gene="hybD"
FT                   /locus_tag="UM146_01390"
FT   CDS_pept        290326..290820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybD"
FT                   /locus_tag="UM146_01390"
FT                   /product="hydrogenase 2 maturation endopeptidase"
FT                   /note="COG0680 Ni,Fe-hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69707"
FT                   /protein_id="ADN69707.1"
FT                   /translation="MRILVLGVGNILLTDEAIGVRIVEALEQRYILPDYVEILDGGTAG
FT                   MELLGDMANRDHLIIADAIVSKKNAPGTMMILRDEEVPALFTNKISPHQLGLADVLSAL
FT                   RFTGEFPKKLTLVGVIPESLEPHIGLTPTVEAMIEPALEQVLAALRESGVEAIPREATH
FT                   D"
FT   gene            290813..291301
FT                   /locus_tag="UM146_01395"
FT   CDS_pept        290813..291301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01395"
FT                   /product="hydrogenase 2-specific chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69708"
FT                   /protein_id="ADN69708.1"
FT                   /translation="MTEEIAGFQTSPKVQVQAAFEEIARRSMHDLSFLHPSMPVYVSDF
FT                   TLFEGQWTGCVITPWMLSAVIFPGPDQLWPLRKVSEKIGLQLPYGTMTFTVGELDGVSQ
FT                   YLSCSLMSPLSHSMSIEEGQRLTDDCARMILSLPVTNPDVPHAGRRALLFGRRSGENA"
FT   gene            291294..291635
FT                   /locus_tag="UM146_01400"
FT   CDS_pept        291294..291635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01400"
FT                   /product="hydrogenase nickel incorporation protein HybF"
FT                   /note="COG0375 Zn finger protein HypA/HybF (possibly
FT                   regulating hydrogenase expression)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69709"
FT                   /protein_id="ADN69709.1"
FT                   /translation="MHELSLCQSAVEIIQRQAEQHDVKRVTAVWLEIGALSCVEESAVR
FT                   FSFEIVCHGTVAQGCDLHIVYKPAQAWCWDCSQVVEIHQHDAQCPICHGERLRVDTGDS
FT                   LIVKSIEVE"
FT   gene            291648..291896
FT                   /locus_tag="UM146_01405"
FT   CDS_pept        291648..291896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01405"
FT                   /product="hydrogenase 2 accessory protein HypG"
FT                   /note="COG0298 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69710"
FT                   /protein_id="ADN69710.1"
FT                   /translation="MCIGVPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICEGNPADLL
FT                   GQWVLVHVGFAMSIIDEDEAKATLDALRQMDYDITSA"
FT   gene            complement(292029..292895)
FT                   /locus_tag="UM146_01410"
FT   CDS_pept        complement(292029..292895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01410"
FT                   /product="putative glutathione S-transferase YghU"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69711"
FT                   /protein_id="ADN69711.1"
FT                   /translation="MTDNTYQPAKVWTWDKSAGGAFANINRPVSGPTHEKTLPVGKHPL
FT                   QLYSLGTPNGQKVTIMLEELLALGVTGAEYDAWLIRIGDGDQFSSGFVEVNPNSKIPAL
FT                   RDHTHNPPIRVFESGSILLYLAEKFGYFLPQDLAKRTETMSWLFWLQGAAPFLGGGFGH
FT                   FYHYAPVKIEYAINRFTMEAKRLLDVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLG
FT                   GVYDAAEFLDAGSYKHVQRWAKEVGERPAVKRGRIVNRINGPLNEQLHERHDASDFETN
FT                   TEDKRQG"
FT   gene            293100..294959
FT                   /locus_tag="UM146_01415"
FT   CDS_pept        293100..294959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01415"
FT                   /product="bifunctional glutathionylspermidine
FT                   amidase/glutathionylspermidine synthetase"
FT                   /EC_number="6.3.1.8"
FT                   /note="COG0754 Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69712"
FT                   /protein_id="ADN69712.1"
FT                   /translation="MSKGTTSQDAPFGTLLGYAPGGVAIYSSDYSSLDPQEYEDDAVFR
FT                   SYIDDEYMGHKWQCVEFARRFLFLNYGVVFTDVGMAWEIFSLRFLREVVNDNILPLQAF
FT                   PNGSPRAPVAGALLIWDKGGEFKDTGHVAIITQLHGNKVRIAEQNVIHTPLPQGQQWTR
FT                   ELEMVVENGGYTLKDTFDDTTILGWMIQTEDTEYSLPQPEIAGELLKISGARLENKGQF
FT                   DGKWLDEKDPLQNAYVQANGQVINQDPYHYYTITESAEQELIKATNELHLMYLHATDKV
FT                   LKDDNLLALFDIPKILWPRLRLSWQRRRHHMITGRMDFCMDERGLKVYEYNADSASCHT
FT                   EAGLILERWAEQGYKGNGFNPAEGLINELAGAWKHSRARPFVHIMQDKDIEENYHAQFM
FT                   EQALQQAGFETRILRGLEELRWDAAGQLIDGEGRQVNCVWKTWAWETAFDQIREVSDRE
FT                   FAAVPIRTGHPQNEVRLIDVLLRPEVLVFEPLWTVIPGNKAILPILWSLFPHHRYLLDT
FT                   DFTVNDELVKTGYAVKPIAGRCGSNIDLVSHHEEVLDKTSGKFAEQKNIYQQLWCLPKV
FT                   DGKYIQVCTFTVGGNYGGTCLRGDESLVIKKESDIEPLIVVKE"
FT   gene            295251..296750
FT                   /locus_tag="UM146_01420"
FT   CDS_pept        295251..296750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01420"
FT                   /product="phosphate transporter"
FT                   /note="COG0306 Phosphate/sulphate permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69713"
FT                   /protein_id="ADN69713.1"
FT                   /translation="MLNLFVGLDIYTGLLLLLALAFVLFYEAINGFHDTANAVATVIYT
FT                   RAMQPQLAVVMAAFFNFFGVLLGGLSVAYAIVHMLPTDLLLNMGSTHGLAMVFSMLLAA
FT                   IIWNLGTWFFGLPASSSHTLIGAIIGIGLTNALLTGSSVMDALNLREVTKIFSSLIVSP
FT                   IVGLVIAGGLIFLLRRFWSGTKKRDRIHRIPEDRKKKKGKRKPPFWTRIALIVSAAGVA
FT                   FSHGANDGQKGIGLVMLVLVGIAPAGFVVNMNASGYEITRTRDAVTNFEHYLQQHPELP
FT                   QKLITMEPPLPAASTDGAQVTEFHCHPANTFDAIARVKTMLPGNMESYEPLSVSQRSQL
FT                   RRIMLCISDTSAKLAKLPGVSKEDQNLLKKLRSDMLSTIEYAPVWIIMAVALALGIGTM
FT                   IGWRRVAMTIGEKIGKRGMTYAQGMAAQMTAAVSIGLASYIGMPVSTTHVLSSAVAGTM
FT                   VVDGGGLQRKTVTSILMAWVFTLPAAIFLSGGLYWIALQLI"
FT   gene            complement(296799..297491)
FT                   /locus_tag="UM146_01425"
FT   CDS_pept        complement(296799..297491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01425"
FT                   /product="hypothetical protein"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69714"
FT                   /protein_id="ADN69714.1"
FT                   /translation="MQSIIPPLIAVIGSDGSGKSTVCEHLITVVEKYGAAERVHLGKQA
FT                   GNVGRAVTKLPLMGKSLHKTIERNQVKTAKKLPGPVPALVITAFVARRLLRFRHMLACR
FT                   RRGLIVLTDRYPQDQIPGAYDGTVFPPNVEGGRFVSWLASQERKAFHWMASHKPDLVIK
FT                   LNVDLEVACARKPDHKRESLARKIAITPQLTFGGAQLVDIDANQPLEKVLVDAEKAITD
FT                   FMTARGYH"
FT   gene            297681..298379
FT                   /locus_tag="UM146_01430"
FT   CDS_pept        297681..298379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01430"
FT                   /product="hypothetical protein"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69715"
FT                   /protein_id="ADN69715.1"
FT                   /translation="MSIINSTPVRVIAIVGCDGSGKSTLTASLVNELASRMPTEHIYLG
FT                   QSSGRIGEWISQLPVIGAPFGRYLRSKAAHVHEKPSTPPGNITALVIYLLSCWRAYKFR
FT                   KMLCKNQQGYLLITDRYPQVEVPGFRFDGPQLAKTTGGNGWIKMLRQRELKLYQWMASY
FT                   LPVLLIRLGIDEQTAFARKPDHQLAALQEKIAVTPQLTFNGARILELDGRQPADEILQA
FT                   SLRAIHAALS"
FT   gene            298411..299169
FT                   /locus_tag="UM146_01435"
FT   CDS_pept        298411..299169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01435"
FT                   /product="hypothetical protein"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69716"
FT                   /protein_id="ADN69716.1"
FT                   /translation="MDALQTQTVKSTTAPQPNYIPGLIAVVGCDGTGKSTLTNDLVKSL
FT                   QQHWQTERRYLGLLSGEDGDKIKRLPLVGVWLERRLAAKSSKTQSMKTKSPALWAAVIM
FT                   YCFSLRRMANLRKVQRLAQSGVLVVSDRFPQAEISGFYYDGPGIGVERATGKISRFLAQ
FT                   RERRLYQKMAQYRPELIIRLGIDIDTAISRKPDHDYAELQDKIGVMSTIGYNGTKILEI
FT                   DSRAPYSEVLEQAQKAVSLVAIVSDRRSLT"
FT   gene            299215..300564
FT                   /locus_tag="UM146_01440"
FT   CDS_pept        299215..300564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01440"
FT                   /product="putative membrane protein, conserved protein"
FT                   /note="COG2244 Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69717"
FT                   /protein_id="ADN69717.1"
FT                   /translation="MAVFNIKHWFADGAFRTIIRNSAWLGSSNVVSALLGLLALSCAGK
FT                   GMTPAMFGVLVIVQSYAKSISDFIKFQTWQLVVQYGTPALTNNDPQQFRNVVSFSFSLD
FT                   IVSGAVAIVGGIALLPFLSHSLGLDDQSFWLAALYCTLIPSMASSTPTGILRAVDRFDL
FT                   IAVQQATKPFLRAAGSVVAWYFDFGFAGFVIAWYVSNLVGGTMYWWFAARELRRRNIHN
FT                   AFKLNLFESARHIKGAWSFVWSTNIAHSIWSARNSCSTVLVGIVLGPAAAGLFKIAMTF
FT                   FDAAGTPAGLLGKSFYPEVMRLDPRTTRPWLLGVKSGLLAGGIGILVALAVLIVGKPLI
FT                   SLVFGVKYLEAYDLIQVMLGAIVISMLGFPQESLLLMAGKQRAFLVAQTIASIGYIVLL
FT                   FMFCHLFGVLGAAFAYFGGQCLDVVLSLIPTLKAFFQRHSLLYNSTGEKS"
FT   gene            300564..301400
FT                   /locus_tag="UM146_01445"
FT   CDS_pept        300564..301400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69718"
FT                   /protein_id="ADN69718.1"
FT                   /translation="MMRKYFPLEASERLFVAIEEDDVVDAQVSLPPTIALSCTTEIIHD
FT                   NYALCLKFWLDGVNRQELLRLIRKQAKGDELTTDERKQFKYMRARYKHLRFAQRLYLKK
FT                   HQAGFLFGKTTVFLGHFQDGFRNGKKNIVSFYGNLLRVYLSSPVWWLVNYSLRHGQLET
FT                   VNGFIAYRQKQMYILKEIIAKPQLTGREFHDVRKIISQQVSYYDTLRSLDPENKEALLI
FT                   SRFLAAINGLMGDKHDDMVADDMDNRRSYDAPVALDSDIRQRLELLISRFPLYPEQ"
FT   gene            301400..301960
FT                   /locus_tag="UM146_01450"
FT   CDS_pept        301400..301960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01450"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG3054 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69719"
FT                   /protein_id="ADN69719.1"
FT                   /translation="MPSRWIVALIIALLAPGAAAHNFVTGKTVTPVYIQEGGELLLNSD
FT                   DEIHYQKWNSTQLTGKVRIIQYIAGRKSAKKKNSLLIKAVEAANFSQDRFQPTTIVNTD
FT                   DAIFGTGYFVVGKIEKNKRRYPWAQFVIDGNGLGRVAWQLPEQSSTILVLNKAGRIQWA
FT                   KDGSLTPEEVDHVIALAQKLINE"
FT   gene            301991..303061
FT                   /locus_tag="UM146_01455"
FT   CDS_pept        301991..303061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01455"
FT                   /product="hypothetical protein"
FT                   /note="COG0795 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69720"
FT                   /protein_id="ADN69720.1"
FT                   /translation="MKLVEHYIMRGTRRLVLIIVGFLIFIFASYSAQRYLTEAANGTLA
FT                   LDVVLDIVFYKVLIALEMLLPVGLYASVGVTLGQMYTDSEITAISAAGGSPGRLYKAVL
FT                   YLAIPLSIFVTLLSMYGRPWAYAQIYQLEQQSQSELDVRQLRAKKFNTNDNGRMILSQT
FT                   VDQDNNRLTDALIYTSTANRTRIFRARSVDVVDPSPEKPTVMLHNGTAYLLDHQGRDDN
FT                   EQIYRNLQLHLNPLDQSPNVKRKAKSVTELARSVFPADHAELQWRQSRGLTALLMALLA
FT                   ISLSRVKPRQGRFSTLLPLTLLFVAIFYGGDVCRTLVANGAIPLIPGLWLVPGLMLMGL
FT                   LMLVARDFSLLQKFPR"
FT   gene            303058..304137
FT                   /locus_tag="UM146_01460"
FT   CDS_pept        303058..304137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01460"
FT                   /product="hypothetical protein"
FT                   /note="COG0795 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69721"
FT                   /protein_id="ADN69721.1"
FT                   /translation="MNVFSRYLIRHLFLGFAAAAGLLLPLFTTFNLINELDDVSPGGYR
FT                   WTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALVAL
FT                   VAGILWTVSLGAIDEWVASPLQQQALQIKSTATALGEDNDIIGNMLWARRGNEFVTVKS
FT                   LNEQGQPVGVEIFHYRDDLSLESYIYARSATIEDDKTWILHGVNYKKWLNGKETLETLD
FT                   NLAWQSAFTSMNLEELSMPGNTFSVRQLNHYIHYLQDTGQPSSEYHLALWEKLGQPILT
FT                   LAMILLAVPFTFSVPRSPGMGSRLAVGVIVGLLTWISYQIMVNLGLLFALSAPVTALGL
FT                   PVAFVLVALSLVYWYDRQH"
FT   gene            complement(304172..304960)
FT                   /locus_tag="UM146_01465"
FT   CDS_pept        complement(304172..304960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01465"
FT                   /product="Putative 8-amino-7-oxononanoate synthase"
FT                   /note="COG0156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69722"
FT                   /protein_id="ADN69722.1"
FT                   /translation="MVLLDADSHASIYDACSLGGAEIIRFRHNDVNDLERRMVRLGERA
FT                   KEAIIIVEGIYSMLGDVAPLAEIVDIKRRLGGYLIVDEAHSFGVLGATGRGLAEAVGVE
FT                   DDVDIIVGTFSKSLASIGGFAVGSEAMEVLRYGSRPYIFTASPSPSCIATVRSSLRTIA
FT                   SQPELRQKLMDNANHLYDGLQKLGYELSSHISPVVPVIIGSKEEGLRIWRKLISLGVYV
FT                   NLILPPAAPAGITLLRCSVNAAHSREQIDAIIQAFATQKQ"
FT   gene            complement(304993..305343)
FT                   /locus_tag="UM146_01470"
FT   CDS_pept        complement(304993..305343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01470"
FT                   /product="putative class II aminotransferase"
FT                   /note="COG0156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69723"
FT                   /protein_id="ADN69723.1"
FT                   /translation="MGLYDKYARLAGERLQFSDNGLTPFGTCIDEVYSATEGRIGNKKV
FT                   ILAGTNNYLGLTFNHDAIREGQAALAAQGTGTTGSRMANGSYAPHLALEKEIAEFFNRP
FT                   TAIVFQPVIPLI"
FT   gene            complement(305343..305591)
FT                   /locus_tag="UM146_01475"
FT   CDS_pept        complement(305343..305591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01475"
FT                   /product="hypothetical protein"
FT                   /note="COG0236 Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69724"
FT                   /protein_id="ADN69724.1"
FT                   /translation="MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDL
FT                   LMMLEDRFDISIPINILLDVKTPAQLMETLLPWLENN"
FT   gene            complement(305623..306537)
FT                   /locus_tag="UM146_01480"
FT   CDS_pept        complement(305623..306537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01480"
FT                   /product="putative epimerase"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69725"
FT                   /protein_id="ADN69725.1"
FT                   /translation="MNQTVAVTGATGFIGKYIIDNLLARGFHVRALTRTARAHVNDNLT
FT                   WVRGSLEDTHSLSELVAGASAVVHCAGQVRGHKEEIFTRCNVDGSLRLMQAAKESGFCQ
FT                   RFLFISSLAARHPELSWYANSKHVAEQRLTAMADEITLGVFRPTAVYGPGDKELKPLFD
FT                   WMLRGLLPRLGTPETQLSFLHVTDFAQAVSQWLSAETVQTQTYELCDGVAGGYDWQRVQ
FT                   QLVADVRCGSVRMVGIPQPLLTCLADISTALNRLAGKEPMLTRSKIRELTHADWSASNN
FT                   RISEDINWFPGISLEHALRNGLF"
FT   gene            complement(306534..308225)
FT                   /locus_tag="UM146_01485"
FT   CDS_pept        complement(306534..308225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01485"
FT                   /product="acyl-CoA synthetase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69726"
FT                   /protein_id="ADN69726.1"
FT                   /translation="MRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQTLKARA
FT                   EAGAKRLLSLNLKKGDRVALIAETSSGFVEAFFACQYAGLVAVPLAIPMGVGQRDSWSA
FT                   KLQGLLASCQPAAIITGDEWLPLVNAATHNNNPELHVLSHAWFKALPEADVVLQRPVPN
FT                   DIAYLQYTSGSTRFPRGVIITHHEVMANLRAISHDGIKLRPGDRCVSWLPFYHDMGLVG
FT                   FLLTPVATQLSVDYLRTQDFAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDLA
FT                   ELDLSCWRVAGIGAEPISAEQLHQFAECFRQVNFDDKTFMPCYGLAENALAVSFSDEAC
FT                   GVVVNEVDRDILEYQGKAVAPGAETRAVSTFVNCGKALPEHGIEIRNEADIPVAERVVG
FT                   HICISGPSLMSGYFGDQVSQDEIAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNI
FT                   WPQDIEYIAEQEPEIHSGDAIAFVTAQEKIILQIQCRISDEERRGQLIHALAARIQSEF
FT                   GVTADIDLLPPHSIPRTSSGKPARAEAKKRYQKAYAASLHVQESLA"
FT   gene            308629..309771
FT                   /locus_tag="UM146_01490"
FT   CDS_pept        308629..309771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01490"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69727"
FT                   /protein_id="ADN69727.1"
FT                   /translation="MECDLLMIKIEKVINKKDLKAFIAFPSSLYPDDPNWIPPLFIERS
FT                   EHLSAKNPGTDHIIWQAWVAKKAGQIVGRITAQIDTLHRERYGEDTGHFGMIDSIDDPQ
FT                   VFAALFGTAEAWLKSQGASKISGPFSLNINQESGLLIEGFDTPPCAMMPHGKPWYAAHI
FT                   EQLGYHKGIDLLAWWMQRTDLTFSPALKKLMDQVRKKVTIRCINRQRFAEDMQILREIF
FT                   NSGWQHNWGFVPFTEHEFATMGDQLKYLVPDDMIYIAEIDSAPCAFIVGLPNINEAIVD
FT                   LNGSLFPFGWAKLLWRLKVSGVRTARVPLMGVRDEYQFSRIGPVIALLLIEALHDPFAR
FT                   RKIDALEMSWILETNTGMNNMLERIGAEPYKRYRLYEKQI"
FT   gene            complement(309778..310542)
FT                   /locus_tag="UM146_01495"
FT   CDS_pept        complement(309778..310542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01495"
FT                   /product="DNA-binding transcriptional regulator GlcC"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69728"
FT                   /protein_id="ADN69728.1"
FT                   /translation="MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSR
FT                   SALREGLTVLRGRGIIETAQGRDSRVARLNRVQDASPLIHLFSTQPRTLYDLLDVRALL
FT                   EGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHN
FT                   QVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAAR
FT                   DHVRTVKKNLHDIELEGHHLIRSAVPLEMKQG"
FT   gene            310793..312292
FT                   /locus_tag="UM146_01500"
FT   CDS_pept        310793..312292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01500"
FT                   /product="glycolate oxidase subunit GlcD"
FT                   /note="COG0277 FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69729"
FT                   /protein_id="ADN69729.1"
FT                   /translation="MSILYEERLDGALPEVDRTSVLMALREHVPGLEILHTDEEIIPYE
FT                   CDGLSAYRTRPLLVVLPKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGALPLEKGVLL
FT                   VMARFKEILDINPIGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACSIGGNVAEN
FT                   AGGVHCLKYGLTVHNLLKIEVQMLDGEALTLGSDALDSPGFDLLALFTGSEGMLGVTTE
FT                   VTVKLLPKPPVARVLLASFDSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAAEDFIHA
FT                   GYPVDAEAILLCELDGVESDVQEDCERVNDILLNAGATDVRLAQDEAERVRFWAGRKNA
FT                   FPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMHPLILFD
FT                   ANEPGEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFHAVKA
FT                   AFDPDGLLNPGKNIPTLHRCAEFGAMHVHHGHLPFPELERF"
FT   gene            312292..313344
FT                   /gene="glcE"
FT                   /locus_tag="UM146_01505"
FT   CDS_pept        312292..313344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="UM146_01505"
FT                   /product="glycolate oxidase FAD binding subunit"
FT                   /note="COG0277 FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69730"
FT                   /protein_id="ADN69730.1"
FT                   /translation="MLRECDYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTL
FT                   DVRCHRGIVNYDPTELVITARAGTPLVAIEAALESAGQMLPCEPPHYGEEATWGGMVAC
FT                   GLAGPRRPWSGSVRDFVLGTRIITGTGKHLRFGGEVMKNVAGYDLSRLMAGSYGCLGVL
FT                   TEISMKVLPRPRASLSLRREISLQEAMNEIAQWQLQPLPISGLCYFDNALWIRLEGGEG
FT                   SVKAARELLGGEEVAGQFWQQLREQQLPFFSLPGTLWRISLPSDAPMMDLPGEQLIDWG
FT                   GALRWLKSTADDNQIHRIARNAGGHATRFSAGDGGFAPLPAPLFRYHQQLKQQLDPCGV
FT                   FNPGRMYAEL"
FT   gene            313355..314578
FT                   /gene="glcF"
FT                   /locus_tag="UM146_01510"
FT   CDS_pept        313355..314578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="UM146_01510"
FT                   /product="glycolate oxidase iron-sulfur subunit"
FT                   /note="COG0247 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69731"
FT                   /protein_id="ADN69731.1"
FT                   /translation="MQTRLTEEMRQNARALEADSILRACVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGNEVTLKTQEHLDRCLTCRNCETTCPSGVRYHNLLDIGRDIVEQ
FT                   KVKRPLPERMLREGLRQVVPRPAVFRALTQVGLVLRPFLPEQVRAKLPAETVKAKPRPP
FT                   LRHKRRVLMLEGCAQPTLSPNTNAATARVLDRLGISVMPANEAGCCGAVDYHLNAQEKG
FT                   LARARNNIDAWWPAIEAGAEAILQTASGCGAFVKEYGQMLKNDALYADKARQVSELAVD
FT                   LVELLREEPLEKLAIRGDKKLAFHCPCTLQHAQKLNGEVEKVLLRLGFTLTDVPDSHLC
FT                   CGSAGTYALTHPDLARQLRDNKMNALESGKPEMIVTANIGCQTHLASAGRTSVRHWIEI
FT                   VEQALEKE"
FT   gene            314583..314987
FT                   /locus_tag="UM146_01515"
FT   CDS_pept        314583..314987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01515"
FT                   /product="hypothetical protein"
FT                   /note="COG3193 Uncharacterized protein, possibly involved
FT                   in utilization of glycolate and propanediol"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69732"
FT                   /protein_id="ADN69732.1"
FT                   /translation="MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALS
FT                   RMDDCAPIAAYISQEKARTAALGRRETKGYEEMVNNGRTAFVTAPLLTSLEGGVPVVVD
FT                   GQIIGAVGVSGLTGAQDAQVAKAAAAVLAK"
FT   gene            315009..317180
FT                   /locus_tag="UM146_01520"
FT   CDS_pept        315009..317180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01520"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="COG2225 Malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69733"
FT                   /protein_id="ADN69733.1"
FT                   /translation="MSQTITQGRLRIDANFKRFVDEEVLPGVELDAAAFWHNVDEIVHD
FT                   LAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPDHVTVETTG
FT                   IDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRG
FT                   EQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGD
FT                   TAAPTCILLKNNGLHIELQIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAE
FT                   DKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRQYTAADGSEISLHGRSLLFIRNV
FT                   GHLMTIPVIWDSEGNEIPEGILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEV
FT                   AFANKLFSRVETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTG
FT                   DEMHSVMEAGPMLRKNQMKSTPWIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMAD
FT                   MYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDL
FT                   LTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATL
FT                   RISSQHIANWLRHGILTKDQVQASLENMAKVVDQQNAGDPAYRPMVENFANSCAFKAAC
FT                   DLIFLGVKQPNGYTEPLLHAWRLREKENH"
FT   gene            317536..319218
FT                   /locus_tag="UM146_01525"
FT   CDS_pept        317536..319218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01525"
FT                   /product="glycolate transporter"
FT                   /note="COG1620 L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69734"
FT                   /protein_id="ADN69734.1"
FT                   /translation="MVTWTQMYMPMGGLGLSALVALIPIIFFFVALAVLRLKGHVAGAI
FT                   TLILSILIAIFAFKMPIDMAFAAAGYGFIYGLWPIAWIIVAAVFLYKLTVASGQFDIIR
FT                   SSVISITDDQRLQVLLIGFSFGALLEGAAGFGAPVAITGALLVGLGFKPLYAAGLCLIA
FT                   NTAPVAFGALGVPILVAGQVTGIDPFHIGAMAGRQLPFLSVLVPFWLVAMMDGWKGVKE
FT                   TWPAALVAGGSFAVTQFFTSNYIGPELPDITSALVSIVSLALFLKVWRPKNTETAISMG
FT                   QSAGAMVVNKPSSGGPVPSEYSLGQIIRAWSPFLILTVLVTIWTMKPFKALFAPGGAFY
FT                   SLVINFQIPHLHQQVLKAAPIVAQPTPMDAVFKFDPLSAGGTAIFIAAIISIFILGVGI
FT                   KKGIGVFAETLISLKWPILSIGMVLAFAFVTNYSGMSTTLALVLAGTGVMFPFFSPFLG
FT                   WLGVFLTGSDTSSNALFGSLQSTTAQQINVSDTLLVAANTSGGVTGKMISPQSIAVACA
FT                   ATGMVGRESELFRYTVKHSLIFASVIGIITLLQAYVFTGMLVS"
FT   gene            319834..324264
FT                   /locus_tag="UM146_01530"
FT   CDS_pept        319834..324264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01530"
FT                   /product="putative lipoprotein AcfD-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69735"
FT                   /protein_id="ADN69735.1"
FT                   /translation="MPEVKPDPTPTPEPTPEPTPDPEPTPDPTPDPEPTPEPEPEPVPT
FT                   KTGYLTLGGSQRVTGATCNGESSDGFTFTPGNTVSCVVGSTTIATFNTQSEAARSLRAV
FT                   DKVSFSLEDAQELANSENKKTNAISLVTSSDSCPADAEQLCLTFSSVVDRARFEKLYKQ
FT                   IDLATDNFSKLVNEEVENNAATDKAPSTHTSTVVPVTTEGTKPDLNASFVSANAEQFYQ
FT                   YQPTEIILSEGQLVDSLGNGVAGVDYYTNSGRGVTDENGKFSFSWGETISFGIDTFELG
FT                   SVRGNKSTIALTELGDEVRGANIDQLIHRYSTTGQNNTRVVPDDVRKVFAEYPNVINEI
FT                   INLSLSNGATLDEGDQNVVLPNEFIEQFKTGQAKEIDTAICAKTDGCNEARWFSLTTRN
FT                   VNDGQIQGVINKLWGVDTNYQSVSKFHVFHDSTNFYGSTGNARGQAVVNISNSAFPILM
FT                   ARNDKNYWLAFGEKRAWDKNELAYITEAPSIVQPENVTRDTATFNLPFISLGQVGEGKL
FT                   MVIGNPHYNSILRCPNGYSWGGGVNSKGECTLSGDSDDMKHFMQNVLRYLSNDIWQPNT
FT                   KSIMTVGTNLENVYFKKAGQVLGNSAPFAFHEDFTGITVKQLTSYGDLNPEEIPLLILN
FT                   GFEYVTQWSGDPYAVPLRADTSKPKLTQQDVTDLIAYLNKGGSVLIMENVMSNLKEESA
FT                   SSFVRLLDAAGLSMALNKSVVNNDPQGYPDRVRQRRATGIWVYERYPAADGAQPPYTID
FT                   PNTGEVTWKYQQDNKPDDKPKLEVASWQEEVEGKQVTRYAFIDEAEYTTEESLEAAKAK
FT                   IFEKFPGLQECKDSTYHYEINCLERRPGTDVPVTGGMYVPRYTQLNLDADTAKAMVQAA
FT                   DLGTNIQRLYQHELYFRTKGSKGERLNSVDLERLYQNMSVWLWNDTKYRYEEGKEDELG
FT                   FKTFTEFLNCYANDAYAGGTKCSADLKKSLVDNNMIYGDGSSKAGMMNPSYPLNYMEKP
FT                   LTRLMLGRSWWDLNIKVDVEKYPGSVSAKGESVTENISLYSNPTKWFAGNMQSTGLWAP
FT                   AQQDVTIKSSASVPVTVTVALADDLTGREKHEVALNRPPRVTKTYTLEANGEVTFKVPY
FT                   GGLIYIKGDSKDDVSANFTFTGVVKAPFYKDGEWKNDLDSPAPLGELESASFVYTTPKK
FT                   NLEASNFTGGVAEFAKDLDTFASSMNDFYGRNDEDGKHRMFTYKNLTGHKHRFTNDVQI
FT                   SIGDAHSGYPVMNSSFSTNSTTLPTTPLNDWLIWHEVGHNAAETPLNVPGATEVANNVL
FT                   ALYMQDRYLGKMNRVADDITVAPEYLDESNGQAWARGGAGDRLLMYAQLKEWAEENFDI
FT                   KQWYPDGELPKFYSDRKGMKGWNLFQLMHRKARGDDVGNSTFGGKNYCAESNGNAADTL
FT                   MLCASWVAQADLSEFFKKWNPGASAYQLPGATEMSFQGGVSSSAYSTLASLKLPKPEKG
FT                   PETINKVTEHKMSAE"
FT   gene            324428..325237
FT                   /locus_tag="UM146_01535"
FT   CDS_pept        324428..325237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01535"
FT                   /product="bifunctional prepilin leader peptidase and
FT                   methylase"
FT                   /note="COG1989 Type II secretory pathway, prepilin signal
FT                   peptidase PulO and related peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69736"
FT                   /protein_id="ADN69736.1"
FT                   /translation="MLFDVFQQYPAAMPILATVGGLIIGSFLNVVIWRYPIMLRQQMAE
FT                   FHGETPSTQSKISLALPRSHCPHCQQTIRVRDNIPLLSWLMLKGRCRDCQAKISKRYPL
FT                   VELLTALAFLLASLVWPESGWGLAVMILSAWLIAASIIDLDNQWLPDVFTQGVLWTGLI
FT                   AAWAQQSPLTLQDAVTGVLVGFITFYSLRWIAGIVLRKEALGMGDVLLFAALGGWVGPL
FT                   SLPNVALIASCCGLIYAVITKRGSTTLPFGPCLSLGGIATLYLQALF"
FT   gene            325303..325713
FT                   /locus_tag="UM146_01540"
FT   CDS_pept        325303..325713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69737"
FT                   /protein_id="ADN69737.1"
FT                   /translation="MSIKQMPGRVLISLLLSVTGLLSGCASHNENASLLAKKQAQNISQ
FT                   NLPIKSAGYTLVLAQSSGTTVKMTIISESGTQTTQTPDAFLTSYQRQMCADPTVKLMIT
FT                   EGINYSITINDTRTGNQYQRKLDRTTCGIVKA"
FT   gene            325731..326690
FT                   /locus_tag="UM146_01545"
FT   CDS_pept        325731..326690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01545"
FT                   /product="putative type II secretion protein GspC"
FT                   /note="COG3031 Type II secretory pathway, component PulC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69738"
FT                   /protein_id="ADN69738.1"
FT                   /translation="MARVVFRDARIYLIQWLTKIRHILSQRQSLNTDKEHLRKMVRGMF
FT                   WLMLLIISAKMAYSLWRYFSFSAEYTAVSSSVNKPLRADAKPFDKNDVQLVSQQNWFGK
FT                   YQPVAAPVKQPESAPVAETRLNVVLRGIAFGARPGVVIEEGGKQQVYLQGERLGSHNAV
FT                   IEEINRDHVMLRYQGKMERLSLAEEERPPVAVTSKKAASDEAKQAVAEPVVSAPVEIPA
FT                   AVRQALAKDPQKIFNYIQLTPVRKEGIVGYAVKPGADRSLFDASGFREGDIAIALNQQD
FT                   FTDPRAMIALMRQLPSMDSIQLTVLRKGARYDISIALR"
FT   gene            326720..328780
FT                   /locus_tag="UM146_01550"
FT   CDS_pept        326720..328780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01550"
FT                   /product="general secretion pathway protein D precursor"
FT                   /note="COG1450 Type II secretory pathway, component PulD"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69739"
FT                   /protein_id="ADN69739.1"
FT                   /translation="MFWRDMTLSIWRKKTTGLKTKKRLLPLMLAAALCSSPVWAEEATF
FT                   TANFKDTDLKSFIETVGANLNKTIIMGPGVQGKVSIRTMTPLNERQYYQLFLNLLEAQG
FT                   YAVVPMENDVLKVVKSSAAKVEPLPLVGEGSDNYAGDEMVTKVVPVRNVSVRELAPILR
FT                   QMIDSAGSGNVVNYDPSNVIMLTGRASVVERLTEVIQRVDHAGNRTEEVIPLDNASASE
FT                   IARVLESLTKNSGENQPATLKSQIVADERTNSVIVSGDPATRDKMRRLIRRLDSEMERS
FT                   GNSQVFYLKYSKAEDLVDVLKQVSGTLTAAKEEAEGTVGSGREVVSIAASKHSNALIVT
FT                   APQDIMQSLQSVIEQLDIRRAQVHVEALIVEVAEGSNINFGVQWGSKDAGLMQFANGTQ
FT                   IPIGTLGAAISAAKPQKGSTVISENGATTINPDTNGDLSTLAQLLSGFSGTAVGVVKGD
FT                   WMALVQAVKNDSSSNVLSTPSITTLDNQEAFFMVGQDVPVLTGSTVGSNNSNPFNTVER
FT                   KKVGIMLKVTPQINEGNAVQMVIEQEVSKVEGQTSLDVVFGERKLKTTVLANDGELIVL
FT                   GGLMDDQAGESVAKVPLLGDIPVIGNLFKSTADKKEKRNLMVFIRPTILRDGMAADGVS
FT                   QRKYNYMRAEQIYRDEQGLSLMPHTAQPILPAQNQALPPEVRAFLNAGRTR"
FT   gene            328780..330273
FT                   /locus_tag="UM146_01555"
FT   CDS_pept        328780..330273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01555"
FT                   /product="general secretion pathway protein E"
FT                   /note="COG2804 Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69740"
FT                   /protein_id="ADN69740.1"
FT                   /translation="MVPVAQETTANTVRLPYSFSRRFSLVAWCEASLEILHVHPLSLSV
FT                   LQELQRGLNAPFTLRQIDEAEFEQRLNAVWQRDSSEARQLMEDLGSAEDFFTLAEELPE
FT                   TEDLLESDDDAPIIKLINAMLAEAIKEGASDIHIETFEKSLVIRFRVDGTLHEMLRPGR
FT                   KLASLLVSRIKVMARLDIAEKRVPQDGRIALLLGGRAIDVRVSTMPSAWGERVVLRLLD
FT                   KNQARLTLERLGLSLELTAQLRQLLHKPHGIFLVTGPTGSGKSTTLYAGLQELNNHSRN
FT                   ILTVEDPIEYMIEGIGQTQVNTRVGMTFARGLRAILRQDPDVVMVGEIRDTETAEIAVQ
FT                   ASLTGHLVLSTLHTNTAVGAITRLQDMGVEPFLLSSSLTGVMAQRLVRTLCSDCRQAAP
FT                   ATDEEKRLMGISDTHAVTLYHPQGCPACNHKGFRGRTAIHELIVVDATLRDLIHRQAGE
FT                   LELERYVRQHSAGIRSNGIEKVLAGETSLDEVLRVTMEA"
FT   gene            330273..331496
FT                   /locus_tag="UM146_01560"
FT   CDS_pept        330273..331496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01560"
FT                   /product="General secretion pathway protein F"
FT                   /note="COG1459 Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69741"
FT                   /protein_id="ADN69741.1"
FT                   /translation="MALFYYQALERNGRKTKGMIEADSARHARQLLRGKDLIPVHIEAR
FT                   MNASAGGLLQRRRHAHRRVATADLALFTRQLATLVQAAMPLETCLQAVSEQSEKLHVKS
FT                   LGMALRSRIQEGYTLSDSLREHPRVFDSLFCSMVAAGEKSGHLDVVLNRLADYTEQRQR
FT                   LKSRLLQAMLYPLVLLVVATGVVTILLTAVVPKIIEQFDHLGHALPASTRMLIAMSDAL
FT                   QASGVYWLAGLLGLLVLGQRLLKNPAMRLRWDKTLLRLPVTGRVARGLNTARFSRTLSI
FT                   LTASSVPLLEGIQTAAAVSANRYVEQQLLLAADRVREGSSLRAALADLRLFPPMMLYMI
FT                   ASGEQSGELETMLEQAAVNQEREFDTQVGLALGLFEPALVVMMAGVVLFIVIAILEPML
FT                   QLNNMVGM"
FT   gene            331513..331968
FT                   /locus_tag="UM146_01565"
FT   CDS_pept        331513..331968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01565"
FT                   /product="putative general secretion pathway protein G
FT                   precursor (epsG-like)"
FT                   /note="COG2165 Type II secretory pathway, pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69742"
FT                   /protein_id="ADN69742.1"
FT                   /translation="MNSLSRTQKPRAGFTLLEVMVVIVILGVLASLVVPNLLGNKEKAD
FT                   RQKAISDIVALENALDMYRLDNGRYPTTEQGLEALIQQPANMADARNYRTGGYIKRLPK
FT                   DPWGNDYQYLSPGEKGLFDVYTLGADGQENGEGAGADIGNWNLQEFQ"
FT   gene            331972..332535
FT                   /locus_tag="UM146_01570"
FT   CDS_pept        331972..332535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01570"
FT                   /product="hypothetical protein"
FT                   /note="COG2165 Type II secretory pathway, pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69743"
FT                   /protein_id="ADN69743.1"
FT                   /translation="MPERGFTLLEIMLVIFLIGLASAGVVQTFATASEPPAKKAAQDFL
FT                   TRFAQFKDRAVIEGQTLGVLIDPPGYQFMQRRHGQWLPVSATRLSAQVTVPKQVQMLLQ
FT                   PGSDIWQKEYALELQRRRLTLHDIELELQKEAKKKTPQIRFSPFEPATPFTLRFYSAAQ
FT                   NACWAVKLAHDGALSLNQCDERMP"
FT   gene            332532..332903
FT                   /locus_tag="UM146_01575"
FT   CDS_pept        332532..332903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01575"
FT                   /product="putative type II secretion protein (GspI-like)"
FT                   /note="COG2165 Type II secretory pathway, pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69744"
FT                   /protein_id="ADN69744.1"
FT                   /translation="MKRGFTLLEVMLALAIFALAAMAVLQIASGTLSNQQILEEKTVAG
FT                   WVAENQTALLYLMTREQRAVRHQGESDMAGSRWYWRTIPLNTGNVLLQAVDIEVSLHDD
FT                   FSPVIQSRRAWFSAVGGQQ"
FT   gene            332936..333505
FT                   /locus_tag="UM146_01580"
FT   CDS_pept        332936..333505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01580"
FT                   /product="hypothetical protein"
FT                   /note="COG4795 Type II secretory pathway, component PulJ"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69745"
FT                   /protein_id="ADN69745.1"
FT                   /translation="MLVAIAIFASLALMAQQVTNGVTRVNSAVAGHDQKLNLMQQTMSF
FT                   LTHDLTQMMPRPVRGDQGQREPALLAGAGVLVSESGGMRFVRGGVVNPLMRLPRSNLLT
FT                   VGYRIHDGYLERLAWPLTDAAGSVKPTTQKLIPADSLRLQFYDGTRWQESWSSVQAIPV
FT                   AVRITLHSPQWGEIERIWLLRGPQLS"
FT   gene            333502..334479
FT                   /locus_tag="UM146_01585"
FT   CDS_pept        333502..334479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01585"
FT                   /product="putative type II secretion protein"
FT                   /note="COG3156 Type II secretory pathway, component PulK"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69746"
FT                   /protein_id="ADN69746.1"
FT                   /translation="MITSPPKRGMALVVVLVLLAVMMLVTITLSGRMQQQLGRTRSQQE
FT                   YQQALWYSASAESLALSALSLSLKNEKRVHLAQPWASGPRFFPLPQGQIAVTLRDAQAC
FT                   FNLNALAQPTTASRPLAVQQLIALISRLDVPAYRAELIAESLWEFIDEDRSVQTRLGRE
FT                   DSEYLARSVPFYAANQPLADISEMRVVQGMDAGLYQKLKPLVCALPMARQQININTLDV
FT                   TQSVILEALFDPWLSPVQARALLQQRPAKGWEDVDQFLAQPLLADVDERTKKQLKTILS
FT                   VDSNYFWLRSDITVNEIELTMNSLIVRMGPQHFSVLWHQTGESE"
FT   gene            334476..335654
FT                   /locus_tag="UM146_01590"
FT   CDS_pept        334476..335654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01590"
FT                   /product="GspL-like protein"
FT                   /note="COG3297 Type II secretory pathway, component PulL"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69747"
FT                   /protein_id="ADN69747.1"
FT                   /translation="MSSMLEIFFPLCAADPIRWQRHTPDVEHGIWPDVADERLQQWLQT
FT                   DAIRLYIPGEWISVWQVELPDVPRKQIPTILPALLEEELNQDIDELHFAPLKIDQQLAT
FT                   VAVIHQQHMRNIAQWLQANGITRATVAPDWMSIPCGFMAGDAQRVICRIDECRGWSAGR
FT                   ALAPVMFRAQLNEQNLPISLTVVGIAPEELSAWAGADAERLTVTALPAITTYGESEGNL
FT                   LTGPWQPRVSYRKQWARWRVMILPILLILVALVVERGVTLWSVSEQVAQSRTQAEKKFL
FT                   TLFPEQKRIVNLRSQVTMALKKYRPQADDTRLLAELSAIASTLKSASLSDIEMRGFTFD
FT                   QKRQTLHLQLRAANFASFDKLRSALAADYVVQQDALQKEGDAVSGGVTLRRK"
FT   gene            335656..336192
FT                   /locus_tag="UM146_01595"
FT   CDS_pept        335656..336192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01595"
FT                   /product="putative general secretion pathway protein YghD"
FT                   /note="COG3149 Type II secretory pathway, component PulM"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69748"
FT                   /protein_id="ADN69748.1"
FT                   /translation="MLRDKFIHYFQQWRERQLSRGEHWLTQHLAGRSPREKGMLLAAVV
FT                   FLFSVGYYVLIWQPLSERIEQQETMLQQLVAMNTRLKNAAPDIIAARKSATTTPAQVSR
FT                   VISDSASAHSVAIKRIAERGENIQVWIEPVVFNDLLKWLNALDEKYALRVTQIDVSAAE
FT                   KPGMVNVQRLEFGRG"
FT   gene            337250..338026
FT                   /locus_tag="UM146_01600"
FT   CDS_pept        337250..338026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01600"
FT                   /product="Polysialic acid transport protein"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69749"
FT                   /protein_id="ADN69749.1"
FT                   /translation="MARSGFEVQKVTVEALFLREIRTRFGKFRLGYLWAILEPSAHLLI
FT                   LLGILGYVMHRTMPDISFPVFLLNGLIPFFIFSSISKRSIGAIEANQGLFNYRPVKPID
FT                   TIIARALLETLIYVAVYILLMLIVWMTGEYFEITNFLQLVLTWSLLIILSCGVGLIFMV
FT                   VGKTFPEMQKVLPILLKPLYFISCIMFPLHSIPKQYWSYLLWNPLVHVVELSREAVMPG
FT                   YISEGVSLNYLAMFTLVTLFIGLALYRTREEAMLTS"
FT   gene            338023..338682
FT                   /locus_tag="UM146_01605"
FT   CDS_pept        338023..338682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01605"
FT                   /product="Polysialic acid transport ATP-binding protein"
FT                   /note="COG1134 ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69750"
FT                   /protein_id="ADN69750.1"
FT                   /translation="MIKIENLTKSYRTPTGRHYVFKNLNIIFPKGYNIALIGQNGAGKS
FT                   TLLRIIGGIDRPDSGNIITEHKISWPVGLAGGFQGSLTGRENVKFVARLYAKRDELNER
FT                   VDFVEEFSELGKYFDMPIKTYSSGMRSRLAFGLSMAFKFDYYLIDEITAVGDAKFKKKC
FT                   SDIFDKIREKSHLIMVSHSERALKEYCDVAIYLNKEGQGKFYKNVTEAIADYKKDL"
FT   gene            338732..339355
FT                   /locus_tag="UM146_01610"
FT   CDS_pept        338732..339355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01610"
FT                   /product="NeuD protein involved in sialic acid synthesis"
FT                   /note="COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69751"
FT                   /protein_id="ADN69751.1"
FT                   /translation="MSKKLIIFGAGGFSKSIIDSLNHKHYELIGFIDKYKSGYHQSYPI
FT                   LGNDIADIENKDNYYYFIGIGKPSTRKHYLNIIRKHNLRLINIIDKTAILSPNIILGDG
FT                   IFIGKMCILNRDTRIHDAVVINTRSLIEHGNEIGCCSNISTNVVLNGDVSVGEETFVGS
FT                   CTVVNGQLKLGSKSIIGSGSVVIRNIPSNVVVAGTPTRLIRGNE"
FT   misc_feature    339352..340391
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218560025|ref|YP_002392938.1|
FT                   N-acylneuraminate-9-phosphate synthase"
FT   gene            340391..341647
FT                   /locus_tag="UM146_01625"
FT   CDS_pept        340391..341647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01625"
FT                   /product="N-acylneuraminate cytidylyltransferase"
FT                   /note="COG1083 CMP-N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69752"
FT                   /protein_id="ADN69752.1"
FT                   /translation="MRTKIIAIIPARSGSKGLRNKNALMLIDKPLLAYTIEAALQSEMF
FT                   EKVIVTTDSEQYGAIAESYGADFLLRPEELATDKASSFEFIKHALSIYTDYESFALLQP
FT                   TSPFRDSTHIIEAVKLYQTLEKYQCVVSVTRSNKPSQIIRPLDDYSTLSFFDLDYSKYN
FT                   RNSIVEYHPNGAIFIANKQHYLHTKHFFGRYSLAYIMDKESSLDIDDRMDFELAITIQQ
FT                   KKNRQKILYQNIHNRINEKRNEFDSVSDITLIGHSLFDYWDVKKINDIEVNNLGIAGIN
FT                   SKEYYEYIIEKELIVNFGEFVFIFFGTNDIVVSDWKKEDTLWYLKKTCQYIKKKNAASK
FT                   IYLLSVPPVFGRIDRDNRIINDLNSYLRENVDFAKFISLDHVLKDSYGNLNKMYTYDGL
FT                   HFNSNGYTVLENEIAEIVK"
FT   gene            341644..342819
FT                   /locus_tag="UM146_01630"
FT   CDS_pept        341644..342819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01630"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="COG0381 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69753"
FT                   /protein_id="ADN69753.1"
FT                   /translation="MKKILYVTGSRAEYGIVRRLLTMLRETPEIQLDLAVTGMHCDNAY
FT                   GNTIHIIEQDNFNIIKVVDININTTSHTHILHSMSVCLNSFGDFFSNNTYDAVMVLGDR
FT                   YEIFSVAIAASMHNIPLIHIHGGEKTLANYDEFIRHSITKMSKLHLTSTEEYKKRVIQL
FT                   GEKPGSVFNIGSLGAENALSLHLPNKQELELKYGSLLKRYFVVVFHPETLSTQSVNDQI
FT                   DELLSAISFFKNTHDFIFIGSNADTGSDIIQRKVKYFCKEYKFRYLISIRSEDYLAMIK
FT                   YSCGLIGNSSSGLIEVPSLKVATINIGDRQKGRVRGASVIDVPVEKNAIVRGINISQDE
FT                   KFISVVQSSSNPYFKENALINAVRIIKDFIKSKNKDYKDFYDIPECTTSYD"
FT   gene            342812..343903
FT                   /locus_tag="UM146_01635"
FT   CDS_pept        342812..343903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01635"
FT                   /product="polysialic acid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69754"
FT                   /protein_id="ADN69754.1"
FT                   /translation="MTRKKVLCFVFRYDSHFLALKNIFEQIDVDSYDLFFCCLDNSLQE
FT                   FVKKNLDEKIVVFYPDDFVCFFTFINIEFIFCSTGGKDLHEIVNTVRTKDTIIISCFPG
FT                   IVLTSQIEAFISKSNSHYLLINSPKDIKTYKKICKIIGVPFNGILFGPPWIKNVNINAK
FT                   SENSCLIVDQVNEPLTPIKRIEYARFLIRVIQKHPHMNFIFKTRNPLISPDSIVFDIKE
FT                   YIERFDLKNITFSDDNIDSLISKVEYCITISSSVAIYCLANKIKVYLINGFNHTCNGQC
FT                   YFSRSGLIVDYNKFNFKHIPRIKKKWMEENFYYSRDIQHKILNDILKMPSNVNVRTFGI
FT                   KRSTLIILFLIFFNFFFSLGPKK"
FT   gene            343949..345178
FT                   /locus_tag="UM146_01640"
FT   CDS_pept        343949..345178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01640"
FT                   /product="Poly-alpha-2,8 sialosyl sialyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69755"
FT                   /protein_id="ADN69755.1"
FT                   /translation="MIFDASLKKLRKLFVNPIGFFRDSWFFNSKNKAEELLSPLKIKSK
FT                   NIFIISNLGQLKKAESFVQKFSKRSNYLIVLATEKNTEMPKIIVEQINNKLFSSYKVLF
FT                   IPTFPNVFSLKKVIWFYNVYNYLVLNSKAKDAYFMSYAQHYAIFVYLFKKNNIRCSLIE
FT                   EGTGTYKTEKENPVVNINFYSEIINSIILFHYPDLKFENVYGTYPILLKKKFNAQKFVE
FT                   FKGAPSVKSSTRIDNVIHKYSITRDDIIYANQKYLIEHTLFADSLISILLRIDKPDNAR
FT                   IFIKPHPKEPKKNINAIQKAIKKAKCRDIILITEPDFLIEPVIKKAKIKHLIGLTSSSL
FT                   VYAPLVSKRCQSYSIAPLMIKLCDNDKSQKGINTLRLHFDILKNFDNVKILSDDITSPS
FT                   LHDKRIFLGE"
FT   gene            complement(345328..346533)
FT                   /locus_tag="UM146_01645"
FT   CDS_pept        complement(345328..346533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01645"
FT                   /product="capsule polysaccharide biosynthesis protein"
FT                   /note="COG3562 Capsule polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69756"
FT                   /protein_id="ADN69756.1"
FT                   /translation="MQGNALTVLLSGKKYLLLQGPMGPFFNDVAEWLESLGRNAVNVVF
FT                   NGGDRFYCRHRQYLAYYQTPKEFPGWLRDLHRQYDFDTILCFGDCRPLHKEAKRWAKSK
FT                   GIRFLAFEEGYLRPQFITVEEDGVNAYSSLPRDPDFYRKLPDMPTPHVENLKPSTMKRI
FT                   GHAMWYYLMGWHYRHEFPRYRHHKSFSPWYEARCWVRAYWRKQLYKVTQRKVLPRLMNE
FT                   LDQRYYLAVLQVYNDSQIRNHSNYNDVRDYINEVMYSFSRKAPKESYLVIKHHPMDRGH
FT                   RLYRPLIKRLSKEYGLSERVIYVHDLPMPELLRHAKAVVTINSTAGISALIHNKPLKVM
FT                   GNALYDIKGLTYQGHLHQFWQADFKPDMKLFKKFRGYLLMKTQVNWVYYGGNTTNCQHN
FT                   IY"
FT   gene            complement(346568..348595)
FT                   /locus_tag="UM146_01650"
FT   CDS_pept        complement(346568..348595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01650"
FT                   /product="Capsule polysaccharide export protein"
FT                   /note="COG3563 Capsule polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69757"
FT                   /protein_id="ADN69757.1"
FT                   /translation="MIGIYSPGIWRIPHLEKFLAQPCQKLSLLRPVPQEVNAIAVWGHR
FT                   PSAAKPVAIAKAAGKPVIRLEDGFVRSLDLGVNGEPPLSLVVDDCGIYYDASKPSALEK
FT                   LVQDKAGNTALISQAREAMHTIVTGDMSKYNLAPAFVADESERTNIVLVVDQTFNDMSV
FT                   TYGNAGPHEFAAMLEAAMAENPQAEIWVKVHPDVLEGKKTGYFADLRATQRVRLIAENV
FT                   SPQSLLRHVSRVYVVTSQYGFEALLAGKPVTCFGQPWYASWGLTDDRHPQSALLSARRG
FT                   SATLEELFAAAYLRYCRYIDPQTGEVSDLFTVLQWLQLQRRHLQQRNGYLWAPGLTLWK
FT                   SAILKPFLRTPTNRLSFSRRCTAASACVVWGVKGEQQWRAEAQRKSLPLWRMEDGFLRS
FT                   SGLGSDLLPPLSLVLDKRGIYYDATRPSDLEVLLNHSQLTLAQQMRAEKLRQRLVESKL
FT                   SKYNLGADFSLPAKAKDKKVILVPGQVEDDASIKTGTVSIKSNLELLRTVRERNPHAYI
FT                   VYKPHPDVLVGNRKGDIPAELTAELADYQALDADIIQCIQRADEVHTMTSLSGFEALLH
FT                   GKHVHCYGLPFYAGWGLTVDEHRCPRRERKLTLADLIYQALIVYPTYIHPTRLQPITVE
FT                   EAAEYLIQTPRKPMFITRKKAGRVIRYYRKLIMFCKVRFG"
FT   gene            complement(348592..349332)
FT                   /locus_tag="UM146_01655"
FT   CDS_pept        complement(348592..349332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01655"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="COG1212 CMP-2-keto-3-deoxyoctulosonic acid
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69758"
FT                   /protein_id="ADN69758.1"
FT                   /translation="MSKAVIVIPARYGSSRLPGKPLLDIVGKPMIQHVYERALQVAGVA
FT                   EVWVATDDQRVEKAVQAFGGKAIMTRNDHESGTDRLVEVMHKVEADIYINLQGDEPMIR
FT                   PRDVDTLLQGMRDDPALPVATLCHAISAEEATEPSTVKVVVNTHQDALYFSRSPIPYPR
FT                   NAEKARYLKHVGIYAYRRDVLQNYSQLPESMPEQAESLEQLRLMSAGINIRTFEVAATG
FT                   PGVDTPACLEKVRALMAQELAENA"
FT   gene            complement(349342..351018)
FT                   /locus_tag="UM146_01660"
FT   CDS_pept        complement(349342..351018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01660"
FT                   /product="Polysialic acid transport protein precursor"
FT                   /note="COG1596 Periplasmic protein involved in
FT                   polysaccharide export"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69759"
FT                   /protein_id="ADN69759.1"
FT                   /translation="MKLFKSILLIAACHAAQASAAIDINADPNLTGAAPLTGILNGQQS
FT                   DTQNMSGFDNTPPPSPPVVMSRMFGAQLFNGTSADSGATVGFNPDYILNPGDSIQVRLW
FT                   GAFTFDGALQVDPKGNIFLPNVGPVKVAGVSNSQLNALVTSKVKEVYQSNVNVYASLLQ
FT                   AQPVKVYVTGFVRNPGLYGGVTSDSLLNYLIKAGGVDPERGSYVDIVVKRGNRVRSNVN
FT                   LYDFLLNGKLGLSQFADGDTIIVGPRQHTFSVQGDVFNSYDFEFRESSIPVTEALSWAR
FT                   PKPGATHITIMRKQGLQKRSEYYPISSAPGRMLQNGDTLIVSTDRYAGTIQVRVEGAHS
FT                   GEHAMVLPYGSTMRAVLEKVRPNSMSQMNAVQLYRPSVAQRQKEMLNLSLQKLEEASLS
FT                   AQSSTKEEASLRMQEAQLISRFVAKARTVVPKGEVILNESNIDSVLLEDGDVINIPEKT
FT                   SLVMVHGEVLFPNAVSWQKGMTTEDYIEKCGGLTQKSGNARIIVIRQNGAAVNAEDVDS
FT                   LKPGDEIMVLPKYESKNIEVTRGISTILYQLAVGAKVILSL"
FT   gene            complement(351042..352190)
FT                   /locus_tag="UM146_01665"
FT   CDS_pept        complement(351042..352190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01665"
FT                   /product="Capsule polysaccharide export inner-membrane
FT                   protein kpsE"
FT                   /note="COG3524 Capsule polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69760"
FT                   /protein_id="ADN69760.1"
FT                   /translation="MLIKVKSAVSWMRARLSAISLADIQKHLAKIIILAPMAVLLIYLA
FT                   IFSQPRYMSESKVAIKRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLAAL
FT                   DKQLNFREAFSHSGLDFLNHLSKDETAEGFLKYYKDRINVSYDDKTGLLNIQTQGFSPE
FT                   FALKFNQTVLKESERFINEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNV
FT                   LDPQAQAQAASTLVNTLMGQKIQMEADLRNLLTYLREDAPQVVSARNAIQSLQAQIDEE
FT                   QSKITAPQGDKLNRMAVDFEEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVISS
FT                   PQLPQESSFPNIPYLIACWLLVCCLLFGTLKLLLAVIEDHRD"
FT   gene            complement(352262..353281)
FT                   /locus_tag="UM146_01670"
FT   CDS_pept        complement(352262..353281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01670"
FT                   /product="Polysialic acid capsule expression protein"
FT                   /note="COG0794 Predicted sugar phosphate isomerase involved
FT                   in capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69761"
FT                   /protein_id="ADN69761.1"
FT                   /translation="MTVALFPCKGADMSERHLPDDQSSTIDPYLITSVRQTLAEQGAAL
FT                   QNLSKQLDSGQYQRVLNLIMNCKGHVILSGMGKSGHVGRKMSATLASTGTPSFFIHPAE
FT                   AFHGDLGMITPYDLLILISASGETDEILKLVPSLKNFGNRIIAITNNGNSTLAKNADAV
FT                   LELHMANETCPNNLAPTTSTTLTMAIGDALAIAMIRQRKFMPNDFARYHPGGSLGRRLL
FT                   TRVADVMQHDVPAVQLDASFKTVIQRITSGCQGMVMVEDAEGGLAGIITDGDLRRFMEK
FT                   EDSLTSATAAQMMTREPLTLPEDTMIIEAEEKMQKHRVSTLLVTNKANKVTGLVRIFD"
FT   gene            complement(354055..354210)
FT                   /locus_tag="UM146_01675"
FT   CDS_pept        complement(354055..354210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01675"
FT                   /product="hypothetical protein"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69762"
FT                   /protein_id="ADN69762.1"
FT                   /translation="MAALVVTWFNPVIKAFYMHLSAAGKTKKMALVDCMRKLLTILNAM
FT                   LRKNEE"
FT   gene            complement(354435..354510)
FT                   /locus_tag="UM146_t23825"
FT   tRNA            complement(354435..354510)
FT                   /locus_tag="UM146_t23825"
FT                   /product="tRNA-Phe"
FT   gene            complement(354616..355323)
FT                   /locus_tag="UM146_01680"
FT   CDS_pept        complement(354616..355323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01680"
FT                   /product="hypothetical protein"
FT                   /note="COG1811 Uncharacterized membrane protein, possible
FT                   Na+ channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69763"
FT                   /protein_id="ADN69763.1"
FT                   /translation="MVIGPFINASAVLLGGVFGALLSQRLPERIRVSMTSIFGLASLGI
FT                   GILLVVKCANLPAMVLATLLGALIGEICLLEKGVNTVVAKAHNLFHHSRKKPAHESFIQ
FT                   NFVAIIVLFCASGTGIFGAMNEGMTGDPSILIAKSFLDFFTAMIFACSLGIAVSVISIP
FT                   LLIIQLTLAWAAALILPLTTPSMMADFSAVGGLLLLATGLRICGIKMFPVVNMLPALLL
FT                   AMPLSAAWTAWFA"
FT   gene            355722..357857
FT                   /locus_tag="UM146_01685"
FT   CDS_pept        355722..357857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01685"
FT                   /product="ornithine decarboxylase"
FT                   /note="COG1982 Arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69764"
FT                   /protein_id="ADN69764.1"
FT                   /translation="MKSMNIAASSELVSRLSTHRCVVALGDTDFTDVAAVVITAADSRS
FT                   GILALLKRTGFHLPVFLYSEHAVELPAGVTAVINGNEQQWLELESAACQYEENLLPPFY
FT                   DTLTQYVEMGNSTFACPGHQHGAFFKKHPAGRHFYDFFGENIFRADMCNADVKLGDLLI
FT                   HEGSAKDAQKFAAKVFHADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKSNHHG
FT                   ALIQAGATPVYLEASRNPFGFIGGIDAHCFNEEYLRQQIRDVAPEKADLPRPFRLAIIQ
FT                   LGTYDGTVYNARQVIDTVGHLCDYILFDSAWVGYEQFIPMMADSSPLLLELNENDPGIF
FT                   VTQSVHKQQAGFSQTSQIHKKDNHIRGQARFCPHKRLNNAFMLHASTSPFYPLFAALDV
FT                   NAKIHEGESGRRLWAECVELGIESRKAILARCKLFRPFIPPVVDGKLWQDYPTSVLASD
FT                   RRFFSFDPGAKWHGFEGYAADQYFVDPCKLLLTTQGIDAETGEYSDFGVPATILAHYLR
FT                   ENGIVPEKCDLNSILFLLTPAESHEKLAQLVAMLAQFEQHIEDDSPLAEVLPSVYNKYP
FT                   VRYRDYTLRQLCQEMHDLYVSFDVKDLQKAMFRQQSFPSVVMNPQDAHSAYIRGEVELV
FT                   RIRDAEGRIAAEGALPYPPGVLCVVPGEVWGGAVQRYFLALEEGVNLLPGFSPELQGVY
FT                   SETDANGMKRLYGYVLK"
FT   gene            complement(357906..359162)
FT                   /locus_tag="UM146_01690"
FT   CDS_pept        complement(357906..359162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01690"
FT                   /product="transport of nucleosides, permease protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69765"
FT                   /protein_id="ADN69765.1"
FT                   /translation="MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYS
FT                   SLGIAAVFMPALLGIVADKWLSAKWVYAICHTIGAITLFMAAEVTTPEAMFLVILINSF
FT                   AYMPTLGLINTISYYRLQNAGMDIVTDFPPIRIWGTIGFIMAMWVVSLSGFELSHMQLY
FT                   IGAALSAILVLFTLTLPHIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGA
FT                   ELQITNMFGNTFLHSFDKDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIK
FT                   NVMMISIVAWILRFALFAYGDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVSPA
FT                   IRASAQGMFLMMTNGFGCILGGIVSGKVVEMYTQNGITDWQTVWLIFAGYSVVLAFAFM
FT                   AMFKYKHVRVPTGTQTVSH"
FT   gene            complement(359364..360443)
FT                   /gene="mltC"
FT                   /locus_tag="UM146_01695"
FT   CDS_pept        complement(359364..360443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="UM146_01695"
FT                   /product="murein transglycosylase C"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69766"
FT                   /protein_id="ADN69766.1"
FT                   /translation="MKKYLALALIAPLLISCSTTKKGDTYNEAWVKDTNGFDILMGQFA
FT                   HNIENIWGFKEVVIAGPKDYVKYTDQYQTRSHINFDDGTITIETIAGTEPAAHLRRAII
FT                   KTLLMGDDPSSVDLYSDVDDITISKEPFLYGQVVDNTGQPIRWEGRASNFADYLLKNRL
FT                   KSRSNGLRIIYSVTINMVPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTESSFNP
FT                   YAVSRSDALGLMQVVQHTAGKDVFRSQGKSGTPSRSFLFDPASNIDTGTAYLAMLNNVY
FT                   LGGIDNPTSRRYAVITAYNGGAGSVLRVFSNDKIQAANIINTMTPGDVYQTLTTRHPSA
FT                   ESRRYLYKVNTAQKSYRRR"
FT   gene            complement(360508..360783)
FT                   /locus_tag="UM146_01700"
FT   CDS_pept        complement(360508..360783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01700"
FT                   /product="hypothetical protein"
FT                   /note="COG2924 Fe-S cluster protector protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69767"
FT                   /protein_id="ADN69767.1"
FT                   /translation="MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHK
FT                   QTMLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTPEDKK"
FT   gene            complement(360811..361863)
FT                   /locus_tag="UM146_01705"
FT   CDS_pept        complement(360811..361863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01705"
FT                   /product="adenine DNA glycosylase"
FT                   /note="COG1194 A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69768"
FT                   /protein_id="ADN69768.1"
FT                   /translation="MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQV
FT                   ATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKF
FT                   PETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENK
FT                   LWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGK
FT                   KPKQTLPERTGYFLLLQHEDEVLLAQRPSSGLWGGLYCFPQFADEESLRQWLAQRQISA
FT                   DNLTQLTAFRHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERL
FT                   LQQLRTGAPV"
FT   gene            362024..362743
FT                   /gene="trmB"
FT                   /locus_tag="UM146_01710"
FT   CDS_pept        362024..362743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="UM146_01710"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COG0220 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69769"
FT                   /protein_id="ADN69769.1"
FT                   /translation="MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVM
FT                   GVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACL
FT                   SSAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAE
FT                   LVKSKLQLGGIFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQR
FT                   GHRLGHGVWDLMFERVK"
FT   gene            362743..363069
FT                   /locus_tag="UM146_01715"
FT   CDS_pept        362743..363069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01715"
FT                   /product="hypothetical protein"
FT                   /note="COG3171 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69770"
FT                   /protein_id="ADN69770.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVAWRFPEGTSEEQIDKTVDDF
FT                   INEVIEPNKLAFDGSGYLAWEGLICMQEIGKCTEEHQAIVRKWLEERKLEEVRTSELFD
FT                   VWWD"
FT   gene            363092..363232
FT                   /locus_tag="UM146_01720"
FT   CDS_pept        363092..363232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69771"
FT                   /protein_id="ADN69771.1"
FT                   /translation="MQNCLMCYAYQAYKDARSSRPDKAFTPHPAWKTRTLLSIWGQQML
FT                   A"
FT   gene            363256..363972
FT                   /locus_tag="UM146_01725"
FT   CDS_pept        363256..363972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69772"
FT                   /protein_id="ADN69772.1"
FT                   /translation="MRKMLLAAALSVTAMTAHADYQCSVTPRDDVIVSPQTVQVKGENG
FT                   NLVITPDGNVMYNGKQYSLNAAQREQAKDYQAELRSTLPWIDEGAKSRVEKARIALDKI
FT                   IVQEMGESSKMRSRLTKLDAQLKEQMNRIIETRSDGLTFHYKAIDQVRAEGQQLVNQAM
FT                   GGILQDSINEMGAKAVLKSGGNPLQNVLGSLGGLQSSIQTEWKKQEKDFQQFGKDVCSR
FT                   VVTLEDSRKALVGNLK"
FT   gene            364148..365194
FT                   /gene="ansB"
FT                   /locus_tag="UM146_01730"
FT   CDS_pept        364148..365194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="UM146_01730"
FT                   /product="L-asparaginase II"
FT                   /EC_number="3.5.1.1"
FT                   /note="COG0252 L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69773"
FT                   /protein_id="ADN69773.1"
FT                   /translation="MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKS
FT                   NYTAGKVGVENLVNAVPQLKDIANVKGEQVVNIGSQDMNDDVWLTLAKKINTDCDKTDG
FT                   FVITHGTDTMEETAYFLDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKAS
FT                   ANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSD
FT                   TPFDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKTVFDTLAT
FT                   AAKNGTAVVRSSRVPTGATTQDAEVDDAKYGFVASGMLNPQKARVLLQLALTQTKDPQQ
FT                   IQQIFNQY"
FT   gene            365311..366318
FT                   /locus_tag="UM146_01735"
FT   CDS_pept        365311..366318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69774"
FT                   /protein_id="ADN69774.1"
FT                   /translation="MKKQWIVGTALFMLMTGNVWADGEPPTENILKDQFKKQYHGILKL
FT                   DVITLKNLDAKGNQATWSAEGDVSSSDDLYTWVGQLADYELLEQTWTKDKPVKFSAMLT
FT                   SKGTPASGWSVNFYSFQAAASDRGRVVDDIKTNNKYLIVNSEDFNYRFSQLESALNNQN
FT                   NSIPALKKDVKALDKQMVAAQKAADAYWGKDANGKQMTREDAFKKIHQQRDDFNKQNDS
FT                   EAFAVKYDKEVYQPAIAACHKQSEECYEVPIQQKRDFDINEQRRQTFLQSQKLSRKLQD
FT                   DWITLEKGQYPLTMKVSEINSKKVAILMKIDDINQANERWKKDTEQLRRNGVIK"
FT   gene            complement(366387..367523)
FT                   /locus_tag="UM146_01740"
FT   CDS_pept        complement(366387..367523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01740"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="COG0635 Coproporphyrinogen III oxidase and related
FT                   Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69775"
FT                   /protein_id="ADN69775.1"
FT                   /translation="MVKLPPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLN
FT                   DLDNDVAYAQGREVQTIFIGGGTPSLLSGPAMQTLLDGVRARLPLTADAEITMEANPGT
FT                   VEADRFVDYQRAGVNRISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRSFNLD
FT                   LMHGLPDQSLEEALGDLRQAIELNPPHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFE
FT                   QGHQLLTAAGYQQYETSAYSKPGYQCQHNLNYWRFGDYIGIGCGAHGKVTFPDGRILRT
FT                   TKTRHPRGFMQGRYLESQRDVEAADKPFEFFMNRFRLLEAAPRVEFSQYTGLSEEVIRP
FT                   QLEEAIAQGYLTECADYWQITEHGKLFLNSLLELFLAE"
FT   gene            complement(367516..368109)
FT                   /locus_tag="UM146_01745"
FT   CDS_pept        complement(367516..368109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01745"
FT                   /product="putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /note="COG0127 Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69776"
FT                   /protein_id="ADN69776.1"
FT                   /translation="MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLT
FT                   FIENAILKARHAAKVTGLPAIADDSGLAVDALGGAPGIYSARYSGEDATDQKNLQKLLE
FT                   TMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVP
FT                   SEGKTAAELTREEKSAISHRGQALKLLLDALRNG"
FT   gene            complement(368117..368407)
FT                   /locus_tag="UM146_01750"
FT   CDS_pept        complement(368117..368407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01750"
FT                   /product="hypothetical protein"
FT                   /note="COG1872 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69777"
FT                   /protein_id="ADN69777.1"
FT                   /translation="MSAVTVNDDGLVLRLYIQPKASRDSIVGLHGDEVKVAITAPPVDG
FT                   QANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAALIN"
FT   gene            complement(368404..368970)
FT                   /locus_tag="UM146_01755"
FT   CDS_pept        complement(368404..368970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01755"
FT                   /product="YGGT family protein"
FT                   /note="COG0762 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69778"
FT                   /protein_id="ADN69778.1"
FT                   /translation="MNTLTFLLSTVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQ
FT                   PIIGPLRRVIPAMGPIDSASLLVAYILSFIKAIVLFKVVTFLPIIWIAGLLILLKTIGL
FT                   LIFWVLLVMAIMSWVSQGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMILVLLLY
FT                   VINMGVAEVLQATGNMLLPGLWMAL"
FT   gene            complement(368988..369692)
FT                   /locus_tag="UM146_01760"
FT   CDS_pept        complement(368988..369692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01760"
FT                   /product="putative enzyme"
FT                   /note="COG0325 Predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69779"
FT                   /protein_id="ADN69779.1"
FT                   /translation="MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAE
FT                   AIDAGQRQFGENYVQEGVDKIRHFQELSVTGLEWHFIGPLQSNKSRLVAEHFDWCHTID
FT                   RLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGL
FT                   MAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIG
FT                   TAIFGARDYSKK"
FT   gene            369710..370690
FT                   /locus_tag="UM146_01765"
FT   CDS_pept        369710..370690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01765"
FT                   /product="transporter"
FT                   /note="COG2805 Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69780"
FT                   /protein_id="ADN69780.1"
FT                   /translation="MNMEEIVALSVKHNVSDLHLCSAWPARWRIRGRMEAAPFDAPDVE
FT                   ELLREWLDDDQRAILLENGQLDFAVSLAENQRLRGSAFAQRQGISLALRLLPSHCPQLE
FT                   QLGAPPVLPELLKSENGLILVTGATGSGKSTTLAAMVGYLNQHADAHILTLEDPVEYLY
FT                   TSQRCLIQQREIGLHCMTFASGLRAALREDPDVILLGELRDSETIRLALTAAETGHLVL
FT                   ATLHTRGAAQAVERLVDSFPAQEKDPVRNQLAGSLRAVLSQKLEVDKQEGRVALFELLI
FT                   NTPAVGNLIREGKTHQLPHVIQTGQQVGMITFQQSYQQRVKEGRL"
FT   gene            complement(370864..371280)
FT                   /locus_tag="UM146_01770"
FT   CDS_pept        complement(370864..371280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01770"
FT                   /product="Holliday junction resolvase-like protein"
FT                   /note="COG0816 Predicted endonuclease involved in
FT                   recombination (possible Holliday junction resolvase in
FT                   Mycoplasmas and B. subtilis)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69781"
FT                   /protein_id="ADN69781.1"
FT                   /translation="MSGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNII
FT                   ERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEAR
FT                   SGLFEQGGYRALNKGKVDSASAVIILESYFEQGY"
FT   gene            complement(371280..371843)
FT                   /locus_tag="UM146_01775"
FT   CDS_pept        complement(371280..371843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01775"
FT                   /product="hypothetical protein"
FT                   /note="COG1678 Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69782"
FT                   /protein_id="ADN69782.1"
FT                   /translation="MNLQHHFLIAMPALQDPIFRRSVVYICEHNTNGAMGIIVNKPLEN
FT                   LKIEGILEKLKITPEPRDESIRLDKPVMLGGPLAEDRGFILHTPPSNFASSIRISDNTV
FT                   MTTSRDVLETLGTDKQPSDVLVALGYASWEKGQLEQEILDNAWLTAPADLNILFKTPIA
FT                   DRWREAAKLIGVDILTMPGVAGHA"
FT   gene            complement(371952..372902)
FT                   /locus_tag="UM146_01780"
FT   CDS_pept        complement(371952..372902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01780"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="COG0189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69783"
FT                   /protein_id="ADN69783.1"
FT                   /translation="MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYL
FT                   INGEARARTRTLSVEQNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILER
FT                   AEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLD
FT                   GMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYC
FT                   LARIPQGGETRGNLAAGGRGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTE
FT                   INVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ"
FT   gene            complement(372915..373646)
FT                   /locus_tag="UM146_01785"
FT   CDS_pept        complement(372915..373646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01785"
FT                   /product="16S ribosomal RNA methyltransferase RsmE"
FT                   /note="COG1385 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69784"
FT                   /protein_id="ADN69784.1"
FT                   /translation="MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDG
FT                   SNQVFDAEITSASKKSVEVKVLEGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGV
FT                   SLITPLFSERCGVKLDSERLNKKLQQWQKIAIAACEQCGRNRVPEIRPAMDLEAWCAEQ
FT                   DEGLKLNLHPRASNSINTLPLPVERVRLLIGPEGGLSADEIAMTARYQFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            complement(373726..374433)
FT                   /locus_tag="UM146_01790"
FT   CDS_pept        complement(373726..374433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01790"
FT                   /product="endonuclease I"
FT                   /note="COG2356 Endonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69785"
FT                   /protein_id="ADN69785.1"
FT                   /translation="MYRYLSIAAVVLSAAFSGPALAEGINSFSQAKAAAVKVHADAPGT
FT                   FYCGCKINWQGKKGVVDLQSCGYQVRKNENRASRVEWEHVVPAWQFGHQRQCWQDGGRK
FT                   NCAKDPVYRKMESDMHNLQPSVGEVNGDRGNFMYSQWNGGEGQYGQCAMKVDFKEKVAE
FT                   PPARARGAIARTYFYMRDQYNLTLSRQQTQLFNAWDKMYPVTDWECERDERIAKVQGNH
FT                   NPYVQRACQARKS"
FT   gene            complement(374528..375025)
FT                   /locus_tag="UM146_01795"
FT   CDS_pept        complement(374528..375025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01795"
FT                   /product="hypothetical protein"
FT                   /note="COG3091 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69786"
FT                   /protein_id="ADN69786.1"
FT                   /translation="MKTSRLPIAIQQAVMRRLREKLAQANLKLGRNYPEPKLSYTQRGT
FT                   SAGTAWLESYEIRLNPVLLLENSEAFIEEVVPHELAHLLVWKHFGRVAPHGKEWKWMME
FT                   SVLGVPARRTHQFELQSVRRNTFPYRCKCQEHQLTVRRHNRVVRGEAVYRCVHCGEQLV
FT                   AK"
FT   gene            complement(375102..376457)
FT                   /locus_tag="UM146_01800"
FT   CDS_pept        complement(375102..376457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01800"
FT                   /product="D-galactose transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69787"
FT                   /protein_id="ADN69787.1"
FT                   /translation="MTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVV
FT                   SSMMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGL
FT                   AVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGV
FT                   IIIPAILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVK
FT                   QSGWALFKENSNFRRAVFLGVLLQIMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTV
FT                   IVGLTNVLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIA
FT                   MLLMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTL
FT                   GNANTFWVYAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD"
FT   gene            complement(376933..378087)
FT                   /locus_tag="UM146_01805"
FT   CDS_pept        complement(376933..378087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01805"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG0192 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69788"
FT                   /protein_id="ADN69788.1"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDIN
FT                   QGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRP
FT                   DAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATK
FT                   FFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYG
FT                   LIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK"
FT   gene            378143..378394
FT                   /locus_tag="UM146_01810"
FT   CDS_pept        378143..378394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69789"
FT                   /protein_id="ADN69789.1"
FT                   /translation="MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTQFPLFFES
FT                   CLILLKTWLEIFPDNAGILRIYLLQFSAIVGYKTRRAA"
FT   gene            378742..378873
FT                   /locus_tag="UM146_01815"
FT   CDS_pept        378742..378873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69790"
FT                   /protein_id="ADN69790.1"
FT                   /translation="MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII"
FT   gene            378960..380858
FT                   /locus_tag="UM146_01820"
FT   CDS_pept        378960..380858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01820"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69791"
FT                   /protein_id="ADN69791.1"
FT                   /translation="MSSQEASKMLRTYNIAWWGNNYYDVNELGHISVCPDPDVPEARVD
FT                   LAQLVKTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDYFLVYPIKVNQ
FT                   HRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKM
FT                   GHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQGSGKWQSSGGEKSKFGLAAT
FT                   QVLQLVETLREAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKLGVNIQCF
FT                   DVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITESGRAVT
FT                   AHHTVLVSNIIGVERNEYTVPTAPAEDAPRALQSMWETWQEMHEPGTRRSLREWLHDSQ
FT                   MDLHDIHIGYSSGTFSLQERAWAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQERMADK
FT                   MYVNFSLFQSMPDAWGIDQLFPVLPLEGLDQVPERRAVLLDITCDSDGAIDHYIDGDGI
FT                   ATTMPMPEYDPENPPMLGFFMVGAYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELSDE
FT                   GDTVADMLQYVQLDPKTLLTQFRDQVKKTDLDAELQQQFLEEFEAGLYGYTYLEDE"
FT   gene            381004..381735
FT                   /locus_tag="UM146_01825"
FT   CDS_pept        381004..381735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69792"
FT                   /protein_id="ADN69792.1"
FT                   /translation="MKKWKVRSALVALIVLLAGCSSNAQYNSSASGNVGTAWGGDVHST
FT                   VHGVSAERAWRDPAEMIVISYSTNVPSGYDRVYSIRINELEYAIRDGNFKSLPITRVYD
FT                   SSNNEPRYIVHARVGMNYQLYVRNYSRNTNYEIVATVDGLDVLNGKQGSLNNNGYIVNA
FT                   GDSLAIKGFRKDKHTEAAFQFANVADSYAANSAQGDVRNTGVIGFAAFELQGPAKNALP
FT                   PCSGQAFPADNNGYAPPPCRK"
FT   gene            381871..382791
FT                   /locus_tag="UM146_01830"
FT   CDS_pept        381871..382791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01830"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="COG0010 Arginase/agmatinase/formimionoglutamate
FT                   hydrolase, arginase family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69793"
FT                   /protein_id="ADN69793.1"
FT                   /translation="MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMA
FT                   TSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEK
FT                   LQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDH
FT                   GTMFYTAPKEGLIDPNHSVQIGIRTEFDKDNGFTVLDACQVNDRSVDDIIAQVKQIVGD
FT                   MPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQ
FT                   SEITALAAATLALEMLYIQAAKKGE"
FT   gene            complement(382995..383753)
FT                   /locus_tag="UM146_01835"
FT   CDS_pept        complement(382995..383753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01835"
FT                   /product="putative peptidase"
FT                   /note="COG0501 Zn-dependent protease with chaperone
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69794"
FT                   /protein_id="ADN69794.1"
FT                   /translation="MKIRALLVAMSVATVLTGCQNMDSSGLLSSGAEAFQAYSLSDAQV
FT                   KKLSDQACQEMDSKATIAPANSEYARRLTTISRALGDNINGQPVNYKVYMAKDVNAFAM
FT                   ANGCIRVYSGLMDMMTDNEVEAVLGHEMGHVALGHVKKGMQVALGTNAIRVAAASAGGI
FT                   VGSLSQSQLGDLGEKLVNSQFTQRQESEADDYSYDLLRQRGISPAGLATSFEKLAKLEE
FT                   GRQSSMFDDHPASAERAQHIRDRMSADGVK"
FT   gene            384031..386022
FT                   /locus_tag="UM146_01840"
FT   CDS_pept        384031..386022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01840"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG0021 Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69795"
FT                   /protein_id="ADN69795.1"
FT                   /translation="MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFL
FT                   KHNPQNPSWADRDRFVLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEVG
FT                   YTAGVETTTGPLGQGIANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGIS
FT                   HEVCSLAGTLKLGKLIAFYDDNGISIDGHVEGWFTDDTAMRFEAYGWHVIRDIDGHDAA
FT                   SIKRAIEEARAVTDKPSLLMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREQLGWKY
FT                   APFEIPSEIYAQWDAKEAGQAKESAWNEKFAAYAKAYPQEAAEFTRRMKGEMPSDFDAK
FT                   AKEFIAKLQANPAKIASRKASQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINED
FT                   AAGNYIHYGVREFGMTAIANGISLHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMV
FT                   YTHDSIGLGEDGPTHQPVEQIASLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALI
FT                   LSRQNLAQQERTEEQLANIARGGYVLKDCAGQPELIFIATGSEVELAVAAYEKLTAEGV
FT                   KARVVSMPSTDAFDKQDAAYRESVLPKAVTARVAVEAGIADYWYKYVGLNGAIVGMTTF
FT                   GESAPAEQLFEEFGFTVDNVVAKAKALL"
FT   gene            complement(386242..387150)
FT                   /locus_tag="UM146_01845"
FT   CDS_pept        complement(386242..387150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01845"
FT                   /product="putative membrane protease"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69796"
FT                   /protein_id="ADN69796.1"
FT                   /translation="MKAPVSLTSFRPQKSLAIAIGVLAVVVLPFLSYYTVNEGERGILL
FT                   RYGKIVKVAEPGLGFKIPFMESVEKISTRNQAVVYQGLQAYSRDQQPAQMTVSVSFHIK
FT                   PSEAGAVYTTYNTIEALKDRLIVRQLPTQLENVFGQYTAISAVQDRTKLVQDLQNAMRK
FT                   AVVGPVVIDGVQIENIDFSDAYEKSIEDRMKAEVAIATRKQNLETEKIQAQIAVTQAQA
FT                   EADSKLAAAKAEAETIRVRGAAEAETIRLKSAAEAEAIRLRGEALRENPGLVALTTAER
FT                   WDGKLPDTMIPGSTVPFISTK"
FT   gene            387527..387970
FT                   /gene="cmtB"
FT                   /locus_tag="UM146_01850"
FT   CDS_pept        387527..387970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmtB"
FT                   /locus_tag="UM146_01850"
FT                   /product="putative mannitol phosphotransferase subunit
FT                   EIIA"
FT                   /note="COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69797"
FT                   /protein_id="ADN69797.1"
FT                   /translation="MRLIDYFPELSISVIHSTKDWQEAINFSMASLLAKNYISENYIQA
FT                   IKDSTISNGPYYILAPGVAMPHARPECGALKTGMSLTLLKQGVYFPGNDEPIKLLIGLS
FT                   AADADSHIAAIQALSELLCEEEILEQLLTASSEKQLAGIISRG"
FT   gene            387998..389386
FT                   /locus_tag="UM146_01855"
FT   CDS_pept        387998..389386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01855"
FT                   /product="fused mannitol-specific PTS enzymes: IIB
FT                   component ; IIC component"
FT                   /note="COG2213 Phosphotransferase system, mannitol-specific
FT                   IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69798"
FT                   /protein_id="ADN69798.1"
FT                   /translation="MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLP
FT                   NEHFAKIVGPMITYLLPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIM
FT                   GPLGGLVIKYIDKSLEKRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVK
FT                   ECIEALVHAGYLPLLSVINEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNP
FT                   GPGLGLLLAFTLFGKGMSKRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSG
FT                   TWMFNLLDGGLVAGPSPGSIFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKT
FT                   VETESDDEFAQSANAVKAMKQEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAG
FT                   LAIEVKHYAIENVPADADIVVTHASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTA
FT                   EHKH"
FT   gene            389401..390678
FT                   /locus_tag="UM146_01860"
FT   CDS_pept        389401..390678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01860"
FT                   /product="putative dehydrogenase"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69799"
FT                   /protein_id="ADN69799.1"
FT                   /translation="MKTKVAAIYGKRDVRLREFELPEITDNELLVNVISDSVCLSTWKA
FT                   ALLGSEHKRVPDDLENHPVITGHECAGVIVEVGKNLTGKYKKGQRFVLQPAMGLPGGYS
FT                   AGYSYEYFGGNATYMIIPEIAINLGCVLPYHGSYFAAASLAEPMCCIIGAYHANYHTTQ
FT                   YVYEHRMGVKPGGNIALLACAGPMGIGAIDYAINGGIQPSRVVVVDIDDKRLAQVQMLL
FT                   PVELAASKGIELVYMNTKGVSDPVQTLRALTDDAGFDDVFVYAAVPSVVEMADELLAED
FT                   GCLNFFAGPTDKNFKVPFNFYNVHYNSTHVVGTSGGSTDDMKEAIALSATGQLQPSFMV
FT                   THIGGLDAVPETVLNLPDIPGGKKLIYNGVTMPLTAIADFAEKGKTDPLFKELARLVEK
FT                   THGIWNEQAEKYLLAQFGVDIGEAAQ"
FT   gene            390675..390863
FT                   /locus_tag="UM146_01865"
FT   CDS_pept        390675..390863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01865"
FT                   /product="hypothetical protein"
FT                   /note="COG1494 Fructose-1,6-bisphosphatase/sedoheptulose
FT                   1,7-bisphosphatase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69800"
FT                   /protein_id="ADN69800.1"
FT                   /translation="MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDSLAVTAMRQALND
FT                   VAFRGRVVIGEGERYPL"
FT   gene            390874..390990
FT                   /locus_tag="UM146_01870"
FT   CDS_pept        390874..390990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01870"
FT                   /product="fructose-1,6-bisphosphatase II-like protein"
FT                   /note="COG1494 Fructose-1,6-bisphosphatase/sedoheptulose
FT                   1,7-bisphosphatase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69801"
FT                   /protein_id="ADN69801.1"
FT                   /translation="MTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSLH"
FT   gene            391012..391521
FT                   /locus_tag="UM146_01875"
FT   CDS_pept        391012..391521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01875"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG3722 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69802"
FT                   /protein_id="ADN69802.1"
FT                   /translation="MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDN
FT                   DEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQFWHYLNEQDET
FT                   PGFADDMAWDFISNVNSIIRNASLYDALKAMKFADFAVWSEARFSGMVKTALMLAVTTT
FT                   LKELTP"
FT   gene            391518..392231
FT                   /gene="frcK"
FT                   /locus_tag="UM146_01880"
FT   CDS_pept        391518..392231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcK"
FT                   /locus_tag="UM146_01880"
FT                   /product="putative fructose transport system kinase"
FT                   /note="COG1072 Panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69803"
FT                   /protein_id="ADN69803.1"
FT                   /translation="MKIELTVNGLKVQAQYSDDEIENVHKPLLRMLAALQTVNPQRRTV
FT                   VFLCAPPGTGKSTLTTFWEYLAQQDPELPAIQTLPMDGFHHYNSWLDVHQLRPFKGAPE
FT                   TFNVAKLAENLCRVVEGDCTWPQYDRQKHDPVEDVLHVTAPLVIVEGNWLLLDDEKWCQ
FT                   LAQFCDFSIFIKAPASALRERLVGRKLAGGLSLADAEAFYDRTDGPNVRRVLEESLPAN
FT                   LTLMMTATGEYRLMD"
FT   gene            complement(392203..392880)
FT                   /locus_tag="UM146_01885"
FT   CDS_pept        complement(392203..392880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01885"
FT                   /product="putative ATP-binding protein of ABC transport
FT                   system"
FT                   /note="COG1118 ABC-type sulfate/molybdate transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69804"
FT                   /protein_id="ADN69804.1"
FT                   /translation="MLTLNQISYRWPGAATDCLCDISLQLKQGEWLALTGDNGAGKSTL
FT                   LRVMAGLLTPTAGTVMLQQQAMKNLKNRQRAAKIGVLFQEAENQLFHSTVADEIAFGLI
FT                   LQKCPADEITQHTNAALQCCQLADTASAHPLDLHSAQRRMVAVACLEALSPPLLLLDEP
FT                   SRDFDENWLSVFESWLEKCRQRGTSVVAISHDAAFTRRHFSRVVRLEDGVIRNVNPSDD
FT                   IHP"
FT   gene            complement(392874..393551)
FT                   /locus_tag="UM146_01890"
FT   CDS_pept        complement(392874..393551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01890"
FT                   /product="putative ATP-binding protein of ABC transport
FT                   system"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69805"
FT                   /protein_id="ADN69805.1"
FT                   /translation="MVTLEQFRYCPTHSTHPPFCYDFHYVKPGMVAIFGDNGSGKSTLA
FT                   QLMAGWYPDFLPGEITGTGTLLGTPIGRLPLNEQSATIQLVQQSPYLQLSGCTFSVEEE
FT                   VAFGPENLCLAEKEIMARIDAALALTECQPLRHRHPATLSGGETQRVVIACAIAMQPKL
FT                   LILDEAFSRLTPQAREMLLQRLQHWALERGSLIILFERHHTPFLNHCQQAWQLQNGALQ
FT                   PLC"
FT   gene            complement(393539..394246)
FT                   /locus_tag="UM146_01895"
FT   CDS_pept        complement(393539..394246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01895"
FT                   /product="putative ABC-type transport system"
FT                   /note="COG0619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69806"
FT                   /protein_id="ADN69806.1"
FT                   /translation="MHPFTSLTLWALAACTTLILPTQTILPVYSAATFFCLIALKATRR
FT                   RAKYVVWLMFSLGAGLWLVHGGWLTEWLSGTPRSPERWAHAITLWLRILAIVSTSQLWM
FT                   QYVPVQRFIRALFASRLPPGVAYLFAGPLLVVEQLKRQLAIIHEAQRARGVPLDEGWYQ
FT                   RLRAMPALIIPLTHNALNDLAVRGAALDMRAFRINNRRTTLWAPADSTLQRVARYAMIL
FT                   LMLAEFGAWIWLR"
FT   gene            complement(394247..394825)
FT                   /locus_tag="UM146_01900"
FT   CDS_pept        complement(394247..394825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01900"
FT                   /product="putative ABC-type transport system"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69807"
FT                   /protein_id="ADN69807.1"
FT                   /translation="MARRHFSSQALVLIVISIAINMIGGQLASMVKLPIFLDSIGTLIS
FT                   AVLLGPVIGMLTGLLTNLLWGLLTDPIAAAFAPVAMVIGLVAGWLARAGWFRTLPKVVV
FT                   SGVIITLAVTVVAVPLRTALFGGVTGSGADLFVAWMHSMGQNLVESVAITVIGANLVDK
FT                   ILTAVIVWLLLRQLPIRTTRHFPAMAAVR"
FT   gene            complement(394848..395279)
FT                   /locus_tag="UM146_01905"
FT   CDS_pept        complement(394848..395279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01905"
FT                   /product="hypothetical protein"
FT                   /note="COG1661 Predicted DNA-binding protein with PD1-like
FT                   DNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69808"
FT                   /protein_id="ADN69808.1"
FT                   /translation="MMTLPYPYSSSARFYALRLLPGQEVLSQLRAFAQQQQLHAAWIAG
FT                   CTGSLTDVALRYAGQENTALLSGKFEVIALNGTLEQSGEHLHLCVSDPHGTMLGGHMMP
FT                   GCTVRTTLELVIGCLEELAFSRQLCALSGYDELHISPVK"
FT   gene            395651..396670
FT                   /locus_tag="UM146_01910"
FT   CDS_pept        395651..396670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01910"
FT                   /product="erythrose 4-phosphate dehydrogenase"
FT                   /note="COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69809"
FT                   /protein_id="ADN69809.1"
FT                   /translation="MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMA
FT                   HLLKYDTSHGRFAWEVRQERDQLFVGDDAIRVLHERSLQSLPWRELGVDVVLDCTGVYG
FT                   SREHGEAHIAAGAKKVLFSHPGSNDLDTTVVYGVNQDQLRAEHRIVSNASCTTNCIIPV
FT                   IKLLDDAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRF
FT                   FPQFNDRFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGAFHGIVDYTEL
FT                   PLVSVDFNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR"
FT   gene            396720..397883
FT                   /gene="pgk"
FT                   /locus_tag="UM146_01915"
FT   CDS_pept        396720..397883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="UM146_01915"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COG0126 3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69810"
FT                   /protein_id="ADN69810.1"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIE
FT                   LALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDGVDVAEG
FT                   ELVVLENVRFNKGEKKDDETLSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACA
FT                   GPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFI
FT                   AAQGHDVGKSLYEADLVDEAKRLLTTCNIPVPSDVRVATEFSETAPATLKSVNDVKADE
FT                   QILDIGDASAQELAEILKNAKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSIAGG
FT                   GDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLEERAKK"
FT   gene            398098..399177
FT                   /locus_tag="UM146_01920"
FT   CDS_pept        398098..399177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01920"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COG0191 Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69811"
FT                   /protein_id="ADN69811.1"
FT                   /translation="MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINA
FT                   VLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVP
FT                   VILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLE
FT                   RMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAAS
FT                   FGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSY
FT                   GVVKMNIDTDTQWATWEGVLNYYKENEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQT
FT                   SMIARLEKAFQELNAIDVL"
FT   gene            399368..400228
FT                   /locus_tag="UM146_01925"
FT   CDS_pept        399368..400228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01925"
FT                   /product="mechanosensitive channel MscS"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69812"
FT                   /protein_id="ADN69812.1"
FT                   /translation="MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIA
FT                   RMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAG
FT                   LAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKII
FT                   VIPNGKIIAGNIINFSREPARRNEFIIGVAYDSDIDQVKQILTDIIQSEDRILKDREMT
FT                   VRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVK
FT                   EDKAA"
FT   gene            400409..400999
FT                   /locus_tag="UM146_01930"
FT   CDS_pept        400409..400999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01930"
FT                   /product="arginine exporter protein"
FT                   /note="COG1279 Lysine efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69813"
FT                   /protein_id="ADN69813.1"
FT                   /translation="MILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGS
FT                   ALLMQSPWLLALTWGGVAFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVT
FT                   WLNPHVYLDTFVVLGSLGGQLDVEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAK
FT                   SQRIINLVVGCVMWFIALQLARDGIAHAQALFS"
FT   gene            401092..401832
FT                   /locus_tag="UM146_01935"
FT   CDS_pept        401092..401832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01935"
FT                   /product="hypothetical protein"
FT                   /note="COG2968 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69814"
FT                   /protein_id="ADN69814.1"
FT                   /translation="MKFKVIALAALMGISGMAAQANELPDGPHIVTSGTASVDAVPDIA
FT                   TLAIEVNVAAKDAATAKKQADERVAQYISFLELNQIAKKDISSANLRTQPDYDYQDGKS
FT                   ILKGYRAVRTVEVTLRQLDKLNSLLDGALKAGLNEIRSVSLGVAQPDAYKDKARKAAID
FT                   NAIHQAQELANGFHRKLGPVYSVRYHVSNYQPSPMVRMMKADAAPVSAQETYEQAAIQF
FT                   DDQVDVIFQLEPVDQPPAKTPAAH"
FT   gene            401990..402886
FT                   /locus_tag="UM146_01940"
FT   CDS_pept        401990..402886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01940"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69815"
FT                   /protein_id="ADN69815.1"
FT                   /translation="MDIFISKKMRNFILLAQTNNIARAAEKIHMTASRFGKSIAALEEQ
FT                   IGYTLFTRKDNNISLNKAGQELYQKLFPVYQRLSAIDNEIHNSGRRSRDIVIGIDNTYP
FT                   TIIFDQLISLGDKYEGVTAQPVEFSANGVIDNLFDRQLDFIISPQHVSARVQELENLTI
FT                   SELPPLRLGFLVSRRYEERQEQELLQELPWLQMRFQNWANFEAMIDANMRPCGINPTII
FT                   YRPYSFMAKISDVERGHFLTVIPHFAWRLVNPATLKYFDAPHRPMYMQEYLYSIRNHRY
FT                   TATMLQHIAEDRDGTNH"
FT   gene            complement(402883..403938)
FT                   /locus_tag="UM146_01945"
FT   CDS_pept        complement(402883..403938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01945"
FT                   /product="hypothetical protein"
FT                   /note="COG1884 Methylmalonyl-CoA mutase, N-terminal
FT                   domain/subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69816"
FT                   /protein_id="ADN69816.1"
FT                   /translation="MSNVQEWQQLANKELSRREKTVDSLVQQTAEGIAIKPLYTEADLD
FT                   NLEVTGTLPGLPPYVRGPRATMYTAQPWTIRQYAGFSTAKESNAFYRRNLAAHRGYDSD
FT                   NPRVAGDVGKAGVAIDTGEDMKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIVAAEEQGV
FT                   TSDKLTGTIQNDILKEYLCRNTYIYPPKPSMRIIADIIAWCSGNMPRFNTISISSYHMG
FT                   EAGANCVQQVAFTLADRIEYIKAAISAGLKIDGFVPRLSFFFGIGMDLFMNAAMLRAAR
FT                   YLWSEAVSGFGAQDPYNNVIRTTIDHCAHPMCRDYLHRYLENASGGHIHHDLSHVFDLH
FT                   RNLIATGSMLG"
FT   gene            complement(404141..405034)
FT                   /locus_tag="UM146_01950"
FT   CDS_pept        complement(404141..405034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01950"
FT                   /product="chromosome replication initiation inhibitor
FT                   protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69817"
FT                   /protein_id="ADN69817.1"
FT                   /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENM
FT                   FGQPLLVRTVPPRPTEQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLAT
FT                   WLLPALAPVLADSPIRLNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALD
FT                   YLFVSSKPFAEKYFPNGVTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVN
FT                   SSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRK
FT                   VTDALLDYGHKVLRQD"
FT   gene            405175..405405
FT                   /locus_tag="UM146_01955"
FT   CDS_pept        405175..405405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01955"
FT                   /product="hypothetical protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69818"
FT                   /protein_id="ADN69818.1"
FT                   /translation="MHFAQRVRALVVLNGVALLPQFACKQGLANGELVRLFAPWSGIPR
FT                   PLYALFAGRKGMPAIARYFMDELTTRLANGV"
FT   gene            405461..406120
FT                   /locus_tag="UM146_01960"
FT   CDS_pept        405461..406120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01960"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="COG0120 Ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69819"
FT                   /protein_id="ADN69819.1"
FT                   /translation="MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQ
FT                   IEGAVSSSDASTEKLKSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREK
FT                   IIASVAEKFICIADASKQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTD
FT                   NGNVILDVHGMEILDPIAMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK"
FT   gene            406376..407608
FT                   /locus_tag="UM146_01965"
FT   CDS_pept        406376..407608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01965"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69820"
FT                   /protein_id="ADN69820.1"
FT                   /translation="MAKVSLEKDKIKFLLVEGVHQKALESLRAAGYTNIEFHKGALDDE
FT                   QLKESIRDAHFIGLRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNA
FT                   PFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIG
FT                   TQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMG
FT                   AKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPL
FT                   CEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVNFPEVSLPLHGGRRL
FT                   MHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDIEADEDVAEKALQAMKA
FT                   IPGTIRARLLY"
FT   gene            complement(407998..408546)
FT                   /locus_tag="UM146_01970"
FT   CDS_pept        complement(407998..408546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01970"
FT                   /product="putative ligase"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69821"
FT                   /protein_id="ADN69821.1"
FT                   /translation="MIRQRRRTLTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDG
FT                   ELDTQPLIEQLWRAGKRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDV
FT                   LPLSRLDVLITPLVAFDEYGQRLGMGGGFYDRTLQNWQHYKMQPVGYAHDCQLVEKLPV
FT                   EKWDIPLPAVVTPSKVWEW"
FT   gene            complement(408846..409175)
FT                   /locus_tag="UM146_01975"
FT   CDS_pept        complement(408846..409175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01975"
FT                   /product="Z-ring-associated protein"
FT                   /note="COG3027 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69822"
FT                   /protein_id="ADN69822.1"
FT                   /translation="MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERT
FT                   RVTNTEQLVFIAALNISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKT
FT                   NQNFE"
FT   gene            409343..409921
FT                   /locus_tag="UM146_01980"
FT   CDS_pept        409343..409921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01980"
FT                   /product="hypothetical protein"
FT                   /note="COG3079 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69823"
FT                   /protein_id="ADN69823.1"
FT                   /translation="MSIQNEMPGYNEMNQYLNQQGTGLTPAEMHGLISGMICGGNDDSS
FT                   WLPLLHDLTNEGMAFGHELAQALRKMHSATSDALQDDGFLFQLYLPDGDDVSVFDRADA
FT                   LAGWVNHFLLGLGVTQPKLDKVTGETGEAIDDLRNIAQLGYDEDEDQEELEMSLEEIIE
FT                   YVRVAALLCHDTFTHPQPTAPEVQKPTLH"
FT   gene            409946..411271
FT                   /locus_tag="UM146_01985"
FT   CDS_pept        409946..411271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01985"
FT                   /product="proline aminopeptidase P II"
FT                   /note="COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69824"
FT                   /protein_id="ADN69824.1"
FT                   /translation="MSDISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYR
FT                   QNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLG
FT                   VDRALAFSEINQQLYQLLNGLDVVYHAQGEHAYADEIVNSALEKLRKGSRQNLTAPATM
FT                   IDWRPVVHEMRLFKSPEEIAVLRRAGEITALAHTRAMEKCRPGMFEYHLEGEIHHEFNR
FT                   HGARYPSYNTIVGSGENGCILHYTENECELRDGDLVLIDAGCEYKGYAGDITRTFPVNG
FT                   KFTQAQREIYDIVLESLETSLRLYRPGTSIQEVTGEVVRIMVSGLVKLGILKGEVDELI
FT                   AQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQY
FT                   RGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMAAARKQ"
FT   gene            411268..412446
FT                   /locus_tag="UM146_01990"
FT   CDS_pept        411268..412446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01990"
FT                   /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69825"
FT                   /protein_id="ADN69825.1"
FT                   /translation="MRVIIVGGGMAGATLALAISRLSHGALPVHLIEATAPESHAHPGF
FT                   DGRAIALAAGTCQQLARIGVWQSLADCATAITTVHVSDRGHAGFVTLAAEDYQLAALGQ
FT                   VVELHNVGQRLFALLRKAPGVTLHCPDRVANVARTQSHVEVTLESGETLTGRVLVAADG
FT                   THSALATVCGVDWQQEPYEQLAVIANVATSVAHEGRAFERFTQHGPLAMLPMSDGRCSL
FT                   VWCHPLERREEVLSWSDEKFCRELQSAFGWRLGKITHAGKRSAYPLALTRAAKPITHRT
FT                   VLVGNAAQTLHPIAGQGFNLGMRDVMSLAETLTQAQERGEDMGDYGVLCRYQQRRQSDR
FT                   EATIGVTDSLVHLFANRWTPLVVGRNIGLMTMELFTPARDVLAQRTLGWVAR"
FT   gene            412469..413671
FT                   /locus_tag="UM146_01995"
FT   CDS_pept        412469..413671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_01995"
FT                   /product="hypothetical protein"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69826"
FT                   /protein_id="ADN69826.1"
FT                   /translation="MQSVDVAIVGGGMVGLAVACGLQGSGLRVAVLEQRVPEPLAADAP
FT                   PQLRVSAINAASEKLLTRLGVWQDILSRRASCYHGMEVWDKDSFGHISFDDQSMGYSHL
FT                   GHIVENSVIHYALWNKARQSSDITLLAPAELQQVAWGENETFLTLKDGSMLTARLVIGA
FT                   DGANSWLRNKADIPLTFWDYQHHALVATIRTEEPHDAVARQVFHGEGILAFLPLSDPYL
FT                   CSIVWSLSPEEALRMQQASEDEFNRALNIAFDNRLGLCKVESERLVFPLTGRYARQFAA
FT                   HRLALVGDAAHTIHPLAGQGVNLGFMDAAELIAELKRLHRQGKDIGQYIYLRRYERSRK
FT                   HSAALMLAGMQGFRDLFSGANPAKKLLRDIGLKLADTLPGVKPQLIRQAMGLNDLPEWL
FT                   R"
FT   gene            414119..415213
FT                   /gene="gcvT"
FT                   /locus_tag="UM146_02000"
FT   CDS_pept        414119..415213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="UM146_02000"
FT                   /product="glycine cleavage system aminomethyltransferase T"
FT                   /EC_number="2.1.2.10"
FT                   /note="COG0404 Glycine cleavage system T protein
FT                   (aminomethyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69827"
FT                   /protein_id="ADN69827.1"
FT                   /translation="MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAG
FT                   MFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYF
FT                   TEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDA
FT                   QRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLG
FT                   ARDTLRLEAGMNLYSQEMDETISPLAANMGWTIAWEPADRDFIGREALEAQREHGTEKL
FT                   VGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIV
FT                   QIRNREMPVKVTKPVFVRNGKAVA"
FT   gene            415237..415626
FT                   /locus_tag="UM146_02005"
FT   CDS_pept        415237..415626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02005"
FT                   /product="glycine cleavage system protein H"
FT                   /note="COG0509 Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69828"
FT                   /protein_id="ADN69828.1"
FT                   /translation="MSNIPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDL
FT                   PEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFK
FT                   IKASDESELESLLDATAYEALLEDE"
FT   gene            415744..418617
FT                   /locus_tag="UM146_02010"
FT   CDS_pept        415744..418617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02010"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="COG0403 Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69829"
FT                   /protein_id="ADN69829.1"
FT                   /translation="MTQTLSQLENSGAFIERHIGPDAAQQQEMLNAVGAQSLNALTGQI
FT                   VPKDIQLATPPQVGAPATEYAALAELKAIASRNKRFTSYIGMGYTAVQLPPVILRNMLE
FT                   NPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDEATAAAEAMAMAKR
FT                   VSKLKNANRFFVASDVHPQTLDVVRTRAETFGFEVIVDDAQKVLDHQDVFGVLLQQVGT
FT                   TGEIHDYTALISELKSRKIVVSVAADIMALVLLTAPGKQGADIVFGSAQRFGVPMGYGG
FT                   PHAAFFAAKDEYKRSMPGRIIGVSKDAAGNTALRMAMQTREQHIRREKANSNICTSQVL
FT                   LANIASLYAVYHGPVGLKRIANRIHRLTDILAAGLQQKGLKLRHAHYFDTLCVEVVDKA
FT                   GVLARAEAAEINLRSDILNAVGITLDETTTRENVMQLFSVLLGDNHGLDIDTLDKDVAH
FT                   DSRSIQAAMLRDDEILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLN
FT                   AAAEMIPITWPEFAELHPFCPPEQAEGYQQMIAQLADWLVKLTGYDAVCMQPNSGAQGE
FT                   YAGLLAIRHYHESRNEGHRDICLIPASAHGTNPASAHMAGMQVVVVACDKNGNIDLTDL
FT                   RAKAEQAGDNLSCIMVTYPSTHGVYEETIREVCEVVHQFGGQVYLDGANMNAQVGITSP
FT                   GFIGADVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFVPGHSVVQIEGMLTRQGAVS
FT                   AAPFGSASILPISWMYIRMMGAEGLKKASQVAILNANYIASRLQDAFPVLYTGRDGRVA
FT                   HECILDIRPLKEETGISELDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKVELDRF
FT                   IDAMLAIRAEIDQVKAGVWPLEDNPLVNAPHIQSELVAEWAHPYSREVAVFPAGVADKY
FT                   WPTVKRLDDVYGDRNLFCSCVPISEYQ"
FT   gene            complement(418783..420276)
FT                   /locus_tag="UM146_02015"
FT   CDS_pept        complement(418783..420276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02015"
FT                   /product="6-phospho-beta-glucosidase A"
FT                   /note="COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69830"
FT                   /protein_id="ADN69830.1"
FT                   /translation="MSFGCMVLFPVRIDSSGAYDSEKLTLPKDFLWGGAVAAHQVEGGW
FT                   NKGGKGPSICDVLTGGAHGVPREITKEVVPGKYYPNHEAVDFYGHYKEDIKLFAEMGFK
FT                   CFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDELLKYNIEPVITLSHFEMPLHLVQQY
FT                   GSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEINNQRNWRAPLFGYCCSGVVYTEH
FT                   ENPEETMYQVLHHQFVASALAVKVAHRINPEMKVGCMLAMVPLYPYSCNPDDVMFAQES
FT                   MRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMTNAV
FT                   KAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYALCELYERYQKPLFIVENGFG
FT                   AYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGYTPWGCIDCVSFTTGQYSK
FT                   RYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL"
FT   gene            420260..420571
FT                   /locus_tag="UM146_02020"
FT   CDS_pept        420260..420571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02020"
FT                   /product="hypothetical protein"
FT                   /note="COG3097 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69831"
FT                   /protein_id="ADN69831.1"
FT                   /translation="MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFE
FT                   DDGYFCTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPDQTQFYVIEFKCL"
FT   gene            420735..421394
FT                   /locus_tag="UM146_02025"
FT   CDS_pept        420735..421394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02025"
FT                   /product="hypothetical protein"
FT                   /note="COG1272 Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69832"
FT                   /protein_id="ADN69832.1"
FT                   /translation="MVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLN
FT                   ASATAITSYSLYGGSMILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLL
FT                   VGLDSPLARGLMIVIWSLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKL
FT                   AAGSVTLLAVGGVVYSLGVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQA"
FT   gene            complement(421471..422451)
FT                   /locus_tag="UM146_02030"
FT   CDS_pept        complement(421471..422451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02030"
FT                   /product="putative global regulator"
FT                   /note="COG0354 Predicted aminomethyltransferase related to
FT                   GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69833"
FT                   /protein_id="ADN69833.1"
FT                   /translation="MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQV
FT                   TADVSQMTEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVF
FT                   SKVTIAPDDERVLLGVAGFQARAALANLFSELPSREKQVVKEGATTLLWFEHPAERFLI
FT                   VTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGI
FT                   SFKKGCYTGQEMVARAKFRGANKRALWLLKGSASRLPEAGEDLELKMGENWRRTGTVLA
FT                   AVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLRIEPLPYSLEE"
FT   gene            422694..422960
FT                   /locus_tag="UM146_02035"
FT   CDS_pept        422694..422960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02035"
FT                   /product="hypothetical protein"
FT                   /note="COG2938 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69834"
FT                   /protein_id="ADN69834.1"
FT                   /translation="MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIR
FT                   LLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI"
FT   gene            422941..423348
FT                   /locus_tag="UM146_02040"
FT   CDS_pept        422941..423348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69835"
FT                   /protein_id="ADN69835.1"
FT                   /translation="MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVL
FT                   LSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDSG
FT                   KRQHLWLAADSMDEAEWRDLRRILLQQETQR"
FT   gene            complement(423388..423909)
FT                   /locus_tag="UM146_02045"
FT   CDS_pept        complement(423388..423909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02045"
FT                   /product="flavodoxin FldB"
FT                   /note="COG0716 Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69836"
FT                   /protein_id="ADN69836.1"
FT                   /translation="MNMGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQ
FT                   YDVLILGIPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGML
FT                   HDKLSTKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQ
FT                   ILNEMAEHYA"
FT   gene            424021..424917
FT                   /gene="xerD"
FT                   /locus_tag="UM146_02050"
FT   CDS_pept        424021..424917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="UM146_02050"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /note="COG4974 Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69837"
FT                   /protein_id="ADN69837.1"
FT                   /translation="MKQELARIEQFLDALWLEKNLAENTLNAYRRDLSMMVEWLHHRGL
FT                   TLATAQSDDLQALLAERLEGGYKATSSARLLSAVRRLFQYLYREKFREDDPSAHLASPK
FT                   LPQRLPKDLSEAQVERLLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLR
FT                   QGVVRVIGKGNKERLVPLGEEAVYWLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQT
FT                   FWHRIKHYAVLAGIDSEKLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTH
FT                   VATERLRQLHQQHHPRA"
FT   gene            424942..425652
FT                   /locus_tag="UM146_02055"
FT   CDS_pept        424942..425652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02055"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69838"
FT                   /protein_id="ADN69838.1"
FT                   /translation="MKKGFMLFTLLAAFSGFVQADDAAIQQTLAKMGIKSSDIQPAPVA
FT                   GMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAP
FT                   QEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAK
FT                   DKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKDM
FT                   KEFLDEHQKMTSGK"
FT   gene            425658..427391
FT                   /locus_tag="UM146_02060"
FT   CDS_pept        425658..427391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02060"
FT                   /product="ssDNA exonuclease RecJ"
FT                   /note="COG0608 Single-stranded DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69839"
FT                   /protein_id="ADN69839.1"
FT                   /translation="MKQQIQLRRREVDETADLPAELPPLLRRLYASRGVRSAQELERSV
FT                   KGMLPWQQLSGVEKAVEILYNAFREGTRIIVVGDFDADGATSTALSVLAMRSLGCSNID
FT                   YLVPNRFEDGYGLSPEVVDQAHARGAQLIVTVDNGISSHAGVEHARSLGIPVIVTDHHL
FT                   PGDTLPAAEAIINPNLRDCNFPSKSLAGVGVAFYLMLALRTFLRDQGWFDERGIAIPNL
FT                   AELLDLVALGTVADVVPLDANNRILTWQGMSRIRAGKCRPGIKALLEVANRDPQKLAAS
FT                   DLGFALGPRLNAAGRLDDMSVGVALLLCDNIGEARVLANELDALNQTRKEIEQGMQVEA
FT                   LTLCEKLERSRDTLPGGLAMYHPEWHQGVVGILASRIKERFHRPVIAFAPAGDGTLKGS
FT                   GRSIQGLHMRDALERLDTLYPGMMLKFGGHAMAAGLSLEEDKFELFQQRFGELVTEWLD
FT                   PSLLQGEVVSDGPLSPAEMTMEVAQLLRDAGPWGQMFPEPLFDGHFRLLQQRLVGERHL
FT                   KVMVEPVGGGPLLDGIAFNVDTALWPDNGVREVQLAYKLDINEFRGNRSLQIIIDNIWP
FT                   I"
FT   gene            427699..428580
FT                   /gene="prfB"
FT                   /locus_tag="UM146_02065"
FT   CDS_pept        427699..428580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="UM146_02065"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69840"
FT                   /protein_id="ADN69840.1"
FT                   /translation="MKQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRR
FT                   MFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGI
FT                   KSVTIKISGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEIN
FT                   PADLRIDVYRASGAGGQHVNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAK
FT                   LYELEMQKKNAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSL
FT                   DQFIEASLKAGL"
FT   gene            428590..430107
FT                   /gene="lysS"
FT                   /locus_tag="UM146_02070"
FT   CDS_pept        428590..430107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="UM146_02070"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COG1190 Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69841"
FT                   /protein_id="ADN69841.1"
FT                   /translation="MSEQHAQGADAVVDLNNELKTRREKLANLREQGIAFPNDFRRDHT
FT                   SDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDL
FT                   PEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQ
FT                   EARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARP
FT                   FITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELY
FT                   MAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPET
FT                   DMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSP
FT                   LARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYD
FT                   EDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK"
FT   gene            complement(430149..430697)
FT                   /locus_tag="UM146_02075"
FT   CDS_pept        complement(430149..430697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02075"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="COG1443 Isopentenyldiphosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69842"
FT                   /protein_id="ADN69842.1"
FT                   /translation="MQTEHVILLNAQGVPTGTLEKYAAHTADTLLHLAFSSWLFNAKGQ
FT                   LLVTRRALSKKAWPGVWTNSVCGHPQLGESNEEAVIRRCRYELGVEITPPESIYPDFRY
FT                   RATDPNGIVENEVCPVFAARTTSALQINDDEVMDYQWCDLAAVLRGIDATPWAFSPWMV
FT                   MQATNREARKRLSAFTQLK"
FT   gene            complement(430820..430957)
FT                   /locus_tag="UM146_02080"
FT   CDS_pept        complement(430820..430957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69843"
FT                   /protein_id="ADN69843.1"
FT                   /translation="MENNMNLLMRAIFSLLLLFTLSIPVISDCVAMAIESRFKYMMLLF
FT                   "
FT   gene            complement(430947..432395)
FT                   /locus_tag="UM146_02085"
FT   CDS_pept        complement(430947..432395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02085"
FT                   /product="transporter"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69844"
FT                   /protein_id="ADN69844.1"
FT                   /translation="MNAIDSQLPSSSGQDRPTDEVDRILSPGKLIILGLQHVLVMYAGA
FT                   VAVPLMIGDRLGLSKEAIAMLISSDLFCCGIVTLLQCIGIGRFMGIRLPVIMSVTFAAV
FT                   TPMIAIGMNPDIGLLGIFGATIAAGFITTLLAPLIGRLMPLFPPLVTGVVITSIGLSII
FT                   QVGIDWAAGGKGNPQYGNPVYLGISFAVLIFILLITRYAKGFMSNVAVLLGIVFGFLLS
FT                   WMMNEVNLSGLHDASWFAIVTPMSFGMPIFDPVSILTMTAVLIIVFIESMGMFLALGEI
FT                   VGRKLSSHDIIRGLRVDGVGTMIGGTFNSFPHTSFSQNVGLVSVTRVHSRWVCIASGII
FT                   LILFGMVPKMAVLVASIPQFVLGGAGLVMFGMVLATGIRILSRCNYTTNRYNLYIVAIS
FT                   LGVGMTPTLSHDFFSKLPAVLQPLLHSGIMLATLSAVVLNVFFNGYQHHADLVKESVSD
FT                   KDLKVRTVRMWLLMRKLKKNEHGE"
FT   gene            432816..434750
FT                   /locus_tag="UM146_02090"
FT   CDS_pept        432816..434750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02090"
FT                   /product="putative oxidoreductase Fe-S binding subunit"
FT                   /note="COG1142 Fe-S-cluster-containing hydrogenase
FT                   components 2"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69845"
FT                   /protein_id="ADN69845.1"
FT                   /translation="MKGMQMNKFIAAEAAECIGCHACEIACAVAHNQENWPLSHSDFRP
FT                   RIHVVGKGQAANPVACHHCNNAPCVTACPVNALTFQSDSVQLDEQKCIGCKRCAIACPF
FT                   GVVEMVDTIAQKCDLCNQRSSGTQACIDVCPTQALRLMDDKGLQQIKVARQRKTAAGKA
FT                   SSDAQPSRSAALLPVNSRKGADKISASERKTHFGEIYCGLDPQQATYESDRCVYCAEKA
FT                   NCNWHCPLHNAIPDYIRLVQEGKIIEAAELCHQTSSLPEICGRVCPQDRLCEGACTLKD
FT                   HSGAVSIGNLERYITDTALAMGWRPDVSKVVPRSEKVAVIGAGPAGLGCADILARAGVQ
FT                   VDVFDRHPEIGGMLTFGIPPFKLDKTVLSQRREIFTAMGIDFHLNCEIGRDISFNELTA
FT                   EYDAVFLGVGTYGMMRADLPHEDAPGVIQALPFLTAHTRQLMGLPESAEYPLTDVEGKR
FT                   VVVLGGGDTTMDCLRTSIRLNAASVTCAYRRDEVSMPGSRKEVVNAREEGVEFQFNVQP
FT                   QYIACDEDGRLTAVGLIRTAMGEPGPDGRRRPRPVAGSEFELPADVLIMAFGFQAHTMP
FT                   WLQGSGIKLDKWGLIQTGDVGYLPTQTHLKKVFAGGDAVHGADLVVTAMAAGRQAARDM
FT                   LTLFDTKAS"
FT   gene            434750..435238
FT                   /locus_tag="UM146_02095"
FT   CDS_pept        434750..435238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02095"
FT                   /product="putative oxidoreductase, 4Fe-4S ferredoxin-type
FT                   subunit"
FT                   /note="COG1142 Fe-S-cluster-containing hydrogenase
FT                   components 2"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69846"
FT                   /protein_id="ADN69846.1"
FT                   /translation="MKSLIIVNPADCIGCRTCEVACVVAHPSEQELNADIFLPRLKVQR
FT                   LDSISAPVMCHQCENAPCVGACPVGALTMGEQVVQANSARCIGCQSCVSACPFGMITIQ
FT                   SLPGDTRQQIVKCDLCEQREEGPACVESCPTQALQLLTERELRRVRQQRIVASSENPL"
FT   gene            complement(435274..436641)
FT                   /locus_tag="UM146_02100"
FT   CDS_pept        complement(435274..436641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02100"
FT                   /product="predicted transporter"
FT                   /note="COG2252 Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69847"
FT                   /protein_id="ADN69847.1"
FT                   /translation="MSGDILQTPDAPKPQGALDNYFKITARGSTVRQEVLAGLTTFLAM
FT                   VYSVIVVPGMLGKAGFPPAAVFVATCLVAGFGSLLMGLWANLPMAIGCAISLTAFTAFS
FT                   LVLGQQISVPVALGAVFLMGVIFTAISVTGVRTWILRNLPMGIAHGTGIGIGLFLLLIA
FT                   ANGVGMVIKNPIEGLPVALGAFTSFPVMMSLLGLAVIFGLEKCRVPGGILLVIIAISII
FT                   GLIFDPAVKYHGLVAMPSLTGEDGKSLIFSLDIMGALQPTVLPSVLALVMTAVFDATGT
FT                   IRAVAGQANLLDKDNQIINGGKALTSDSVSSIFSGLVGAAPAAVYIESAAGTAAGGKTG
FT                   LTATVVGVLFLMILFLSPLSFLIPGYATAPALMYVGLLMLSNVSKLDFNDFIDAMAGLV
FT                   CAVFIVLTCNIVTGIMLGFVTLVVGRVFAREWQKLNIGTVIITAALVAFYAGGWAI"
FT   gene            complement(436677..437993)
FT                   /locus_tag="UM146_02105"
FT   CDS_pept        complement(436677..437993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02105"
FT                   /product="guanine deaminase"
FT                   /note="COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69848"
FT                   /protein_id="ADN69848.1"
FT                   /translation="MSGEHTLKAVRGSFIDVTRTVDNPEEIASALRFIEDGLLLIKQGK
FT                   VEWFGEWEDGKHQIPDTIRVRDYRGKLIVPGFIDTHIHYPQSEMVGAYGEQLLEWLNKH
FT                   TFPTERRYEDLEYAREMSAFFIKQLLRNGTTTALVFGTVHPQSVDALFEAASHINMRMI
FT                   AGKVMMDRNAPDYLLDTAESSYHQSKELIERWHKNGRLLYAITPRFAPTSSPEQMAMAQ
FT                   RLKEEYPDTWVHTHLCENKDEIAWVKSLYPDHDGYLDVYHQYGLTGKNCVFAHCVHLEE
FT                   KEWDRLSETKSSIAFCPTSNLYLGSGLFNLKKAWQKKVKVGMGTDIGAGTTFNMLQTLN
FT                   EAYKVLQLQGYRLSAYEAFYLATLGGAKSLGLDDLIGNFLPGKEADFVVMEPTATPLQQ
FT                   LRYDNSVSLVDKLFVMMTLGDDRSIYRTYVDGRLVYERN"
FT   gene            complement(438011..439411)
FT                   /locus_tag="UM146_02110"
FT   CDS_pept        complement(438011..439411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02110"
FT                   /product="putative transporter"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69849"
FT                   /protein_id="ADN69849.1"
FT                   /translation="MSDINHAGSDLIFELEDRPPFHQALVGAITHLLAIFVPMVTPALI
FT                   VGAALQLSAETTAYLVSMAMIASGIGTWLQVNRYGIVGSGLLSIQSVNFSFVTVMIALG
FT                   SSMKSDGFHEELIMSSLLGVSFVGAFLVVGSSFILPYLRRVITPTVSGIVVLMIGLSLI
FT                   KVGIIDFGGGFAAKSSGTFGNYEHLGVGLLVLIVVIGFNCCRSPLLRMGGIAIGLCVGY
FT                   IASLCLGMVDFSSMRNLPLITIPHPFKYGFSFSFHQFLVVGTIYLLSVLEAVGDITATA
FT                   MVSRRPIQGEEYQSRLKGGVLADGLVSVIASAVGSLPLTTFAQNNGVIQMTGVASRYVG
FT                   RTIAVMLVILGLFPMIGGFFTTIPSAVLGGAMTLMFSMIAIAGIRIIITNGLKRRETLI
FT                   VATSLGLGLGVSYDPEIFKILPASIYVLVENPICAGGLTAILLNIILPGGYRQENVLPG
FT                   ITSAEEMD"
FT   gene            complement(439576..442446)
FT                   /locus_tag="UM146_02115"
FT   CDS_pept        complement(439576..442446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02115"
FT                   /product="putative selenate reductase subunit YgfN"
FT                   /note="COG2080 Aerobic-type carbon monoxide dehydrogenase,
FT                   small subunit CoxS/CutS homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69850"
FT                   /protein_id="ADN69850.1"
FT                   /translation="MIIHFTLNGAPQELTVNPGENVQKLLFNMGMHSVRNSDDGFGFAG
FT                   SDAIIFNGNIVNASLLIAAQLEKADIRTAESLGKWNELSLVQQAMVDVGVVQSGYNDPA
FT                   AALIITDLLDRIDAPTREEIDDALSGLFSRDAGWQQYYQVIELAVARKNNPQATIDIAP
FT                   TFRDDLEVIGKHYPKTDAAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSK
FT                   AEALPGVVHVITHLNCPDIYYTPGGQSAPEPSPLDRRMFGKKMRHVGDRVAAVVAESED
FT                   IALEALKLIDVEYEVLKPVMSIDEAMAEDAPVVHDEPVVYVAGAPDTLEDDNSHAAQRG
FT                   EHMIINFPIGSRPRKNIAASIHGHIGDMDKGFADADVIIERTYNSTQAQQCPTETHICF
FT                   TRMDGDRLVIHASTQVPWHLRRQVARLVGMKQHKVHVIKERVGGGFGSKQDILLEEVCA
FT                   WATCVTGRPVLFRYTREEEFIANTSRHVAKVTVKLGAKKDGRLTAVKMDFRANTGPYGN
FT                   HSLTVPCNGPALSLPLYPCDNVDFQVTTYYSNICPNGAYQGYGAPKGNFAITMALAELA
FT                   EQLQIDQLEIIERNRVHEGQELKILGAIGEGKAPTSVPSAASCALEEILRQGREMIQWS
FT                   SPKPQNGDWHIGRGVAIIMQKSGIPDIDQANCMIKLESDGTFIVHSGGADIGTGLDTVV
FT                   TKLAAEVLHCPPQDVHVISGDTDHALFDKGAYASSGTCFSGNAARLAAENLREKILFHG
FT                   AQMLGEPVADVQLATPGVVRGKKGEVSFGEIAHKGETGTGFGSLVGTGSYITPDFAFPY
FT                   GANFAEVAVNTRTGEIRLDKFYALLDCGTPVNPELALGQIYGATLRAIGHSMSEEIIYD
FT                   AEGHPLTRDLRSYGAPKIGDIPRDFRAVLVPSDDKVGPFGAKSISEIGVNGAAPAIATA
FT                   IHDACGIWLREWHFTPEKILTALEKI"
FT   gene            complement(442443..443222)
FT                   /locus_tag="UM146_02120"
FT   CDS_pept        complement(442443..443222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02120"
FT                   /product="putative selenate reductase subunit YgfM"
FT                   /note="COG1319 Aerobic-type carbon monoxide dehydrogenase,
FT                   middle subunit CoxM/CutM homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69851"
FT                   /protein_id="ADN69851.1"
FT                   /translation="MIEQFFRPDSVEQALELKRRYQDEAVWFAGGSKLNATPTRTDKKI
FT                   AISLQDLELDWIDWDNGALRIGAMSRLQPLRDARFIPAALCEALGFVYSRHVRNQSTIG
FT                   GEIAARQEESVLLPVLLALDAELVFGNGETLSIEDYLACPCDRLLTEIIIKDPYRTCAT
FT                   RKISRSQAGLTVVTAAVAITDHDGMRIALDGVASKALRLHDVETQNLEGNALEQAVANA
FT                   IFPQEDLRGSVAYKRYITGVLVADLYADCQQAGEEAV"
FT   gene            complement(443273..444601)
FT                   /locus_tag="UM146_02125"
FT   CDS_pept        complement(443273..444601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02125"
FT                   /product="putative chlorohydrolase/aminohydrolase"
FT                   /note="COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69852"
FT                   /protein_id="ADN69852.1"
FT                   /translation="MLILKNVTAVQLHPAKVQEGVDIAIENDVIVAIDDALTQRYPDAS
FT                   YKEMHGRIVMPGIVCSHNHFYSGLSRGIMANIAPCPDFISTLKNLWWRLDRALDEESLY
FT                   YSGLICSLEAIKSGCTSVIDHHASPAYIDGSLSTLRNAFLKVGLRAMTCFETTDRNNGI
FT                   KELQEGVEENIRFARQIDEAKKAATEPYLVEAHIGAHAPFTVPDAGLEMLREAVKSTGR
FT                   GLHIHAAEDLYDVSYSHHWYGKDLLARLAQFDLIDSKTLVAHGLYLSKDDIALLNQRDA
FT                   FLVHNARSNMNNHVGYNHHLSDIRNLALGTDGIGSDMFEEMKFAFFKHRDAGGPLWPDS
FT                   FAKALANGNELMSRNFGAKFGLLEAGYKADLTICDYNSPTPLLADNIAGHIAFGMGSGS
FT                   VHSVMVNGVMVYEDRQFNFDCDSIYAQARKAAASMWRRMDALA"
FT   gene            complement(444604..447702)
FT                   /locus_tag="UM146_02130"
FT   CDS_pept        complement(444604..447702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02130"
FT                   /product="putative selenate reductase subunit YgfK"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69853"
FT                   /protein_id="ADN69853.1"
FT                   /translation="MGDIMRPIPFEELLTRIFDEYQQQRSIFGIPEQQFYSPVKGKTVS
FT                   VFGETCATPVGPAAGPHTQLAQNIVTSWLTGGRFIELKTVQILDRLELEKPCIDAEDEC
FT                   FNTEWSTEFTLLKAWDEYLKAWFALHLLEAMFQPSDSGKSFIFNMSVGYNLEGIKQPPM
FT                   QQFIDNMMDASDHPKFAQYRDALNKLLQDEAFLARHGLQEKRESLQALPARIPTSMVQG
FT                   VTLSTMHGCPPHEIEAICRYMLEEKGLNTFVKLNPTLLGYARVREILDVCGFGYIGLKE
FT                   ESFDHDLKLTQALEMLERLMALAKEKSLGFGVKLTNTLGTINNKGALPGEEMYMSGRAL
FT                   FPLSINVAAVLSRAFDGKLPISYSGGASQLTIRDIFDTGIRPITMATDLLKPGGYLRLS
FT                   ACMRELEGSDAWGLDHVDVERLNRLAADALTMEYTQKHWKPEERIEVAEDLPLTDCYVA
FT                   PCVTACAIKQDIPEYIRLLGEHRYADALELIYQRNALPAITGHICDHQCQYNCTRLDYD
FT                   SALNIRELKKVALEKGWDEYKQRWHKPAGSGSRHPVAVIGAGPAGLAAGYFLARAGHPV
FT                   TLFEREANAGGVVKNIIPQFRIPAELIQHDIDFVADHGVKFEYGCSPDLTVEQLKNQGF
FT                   HYVLIATGTDKNSGVKLAGDNQNVWKSLPFLREYNKGTALKLGKHVVVVGAGNTAMDCA
FT                   RAALRVPGVEKATVVYRRSLQEMPAWREEYEEALHDGVEFRFLNNPERFDADGTLTLRV
FT                   MSLGEPDEKGRRRPVETNETVTLHVDSLITAIGEQQDTEALNAMGVPLDKNGWPDVDHN
FT                   GETRLSDVFMIGDVQRGPSSIVAAVGTARRATDAILSRENIRSHQNDKYWNNVNPAEIY
FT                   QRKGDISVTLVNSDDRDAFVAQEAARCLECNYVCSKCVDVCPNRANVSIAVPGFQNRFQ
FT                   TLHLDAYCNECGNCAQFCPWNGKPYKDKITVFSLSQDFDNSSNPGFLVEDCRVRVRLNN
FT                   QSWVLNIDSEGQFNNVPPELNDMCRIISHVHQHHHYLLGRVEV"
FT   gene            complement(448024..448602)
FT                   /locus_tag="UM146_02135"
FT   CDS_pept        complement(448024..448602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02135"
FT                   /product="hypothetical protein"
FT                   /note="COG2068 Uncharacterized MobA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69854"
FT                   /protein_id="ADN69854.1"
FT                   /translation="MSAIDCIITAAGLSSRMGQWKMMLPWQQGTILDTSIKNALQFCSR
FT                   IILVTGYRGNELHERYANQSNITIIHNPDYAQGLLTSVKAAVPAVQTEHCFLTHGDMPT
FT                   LTIDIFRKIWSLRNDGAILPLHNGIPGHPILVSKPCLMQAIQRPNVTNMRQALLMGEHY
FT                   SVEIENAEIILDIDTPDDFITAKKRYTEI"
FT   gene            448706..449476
FT                   /locus_tag="UM146_02140"
FT   CDS_pept        448706..449476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02140"
FT                   /product="hypothetical protein"
FT                   /note="COG0552 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69855"
FT                   /protein_id="ADN69855.1"
FT                   /translation="MKSIIDPSALFIDLGAQKRPTVISIVGAGGKTSLLFWLAELFQAS
FT                   GRRVLITTTTHMFMPTSHWPVVFCRDPAMLPHASFISPISFCFHCWKANQGKVQGFTPE
FT                   AIDALVQRPECDVILIEADGSRGMPLKAPDEHEPCIPKSSCCVIAVMGGHILGAKVSTE
FT                   NVHRWSQFADITGLTPDAPLQLSDLVALVRHPQGAFKNVPQGCRRVWFINRFSQCENAI
FT                   AQSELLQPLQQHNVEAIWLGDIQEHPAIARRFVN"
FT   gene            449524..451149
FT                   /locus_tag="UM146_02145"
FT   CDS_pept        449524..451149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02145"
FT                   /product="hypothetical protein"
FT                   /note="COG1975 Xanthine and CO dehydrogenases maturation
FT                   factor, XdhC/CoxF family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69856"
FT                   /protein_id="ADN69856.1"
FT                   /translation="MNIFTEAAKLEEQNCPFAMAQIVDSRGSTPRHSAQMLVRADGSIV
FT                   GTIGGGMVERKVIEESLQALQERKPRLFHGRMARNGADAVGSDCGGAMSVFISVHGMRP
FT                   RLVLIGAGHVNRAIAQSAALLGFDIAVADIYRESLNPELFPPSTTLLHAESFGAAVEAL
FT                   DIRPDNFVLIATNNQDREALDKLIEQPIAWLGLLASRRKVQLFLRQLREKGVAEEHIAR
FT                   LHAPVGYNIGAETPQEIAISVLAEILQVKNNAPGGLMMKPSHPSGHQLVVIRGAGDIAS
FT                   GVALRLYHAGFKVIMLEVEKPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLT
FT                   ERGFIPVMVDPTCSLLDELKPLCVVDAILAKQNLGTRADMAPVTIALGPGFTAGKDCHA
FT                   VIETNRGHWLGQVIYSGCAQENTGVPGNIMGHTTRRVIRAPAAGIMRSNVKLGDLVKEG
FT                   DVIAWIGEHEIKAPLTGMVRGLLNDGLAVVGGFKIGDIDPRGETADFTSVSDKARAIGG
FT                   GVLEALMMLMHQGVKATKEVLEVA"
FT   gene            complement(451190..452122)
FT                   /locus_tag="UM146_02150"
FT   CDS_pept        complement(451190..452122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02150"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="COG0549 Carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69857"
FT                   /protein_id="ADN69857.1"
FT                   /translation="MSKKIVLALGGNALGDDLAGQMKAVKITSQAIVDLIAQGHEVIVT
FT                   HGNGPQVGMINQAFEAAAKTEAHSPMLPMSVCVALSQGYIGYDLQNALREELLSRGINK
FT                   PVATLVTQVEVDANDPAFLNPTKPIGSFFTEQEAELLTKQGYTLKEDAGRGYRRVVASP
FT                   KPVDIIEKETVKALVDAGQVVITVGGGGIPVIREGNHLRGASAVIDKDWASARLAEMID
FT                   ADMLIILTAVEKVAINFGKENEQWLDRLSLSDAERFIEEGHFAKGSMLPKVEAAASFAR
FT                   SRAGREALITVLSKAKEGIEGKTGTVICQ"
FT   gene            complement(452170..453555)
FT                   /locus_tag="UM146_02155"
FT   CDS_pept        complement(452170..453555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02155"
FT                   /product="phenylhydantoinase"
FT                   /EC_number="3.5.2.-"
FT                   /note="COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69858"
FT                   /protein_id="ADN69858.1"
FT                   /translation="MRVLIKNGIVVNADGQAKQDLLIESGIVRQLGTDISPQLPCEEID
FT                   ASGCYVFPGGVDVHTHFNIDVGIARSCDDFFTGTRAAACGGTTTIIDHMGFGPNGCRLR
FT                   HQLEVYRGYAAHKAVIDYSFHGVIQHINHAILDEIPMMVEEGLSSFKLYLTYQYKLNDD
FT                   EVLQALRRLHESGALTTVHPENDAAIASKRAEFIAAGLTAPRYHALSRPLECEAEAIAR
FT                   MINLAQIAGNAPLYIVHLSNGLGLDYLRLARANHQPVWVETCPQYLLLDERSYDTEDGM
FT                   KFILSPPLRNVREQDKLWCGISDGAIDVVATDHCTFSMAQRLQISKGDFSRCPNGLPGV
FT                   ENRMQLLFSSGVMTGRISLERFVELTSAMPARLFGLWPQKGILAPGSDGDVVIIDPRQS
FT                   QQIQHRHLHDNADYSPWEGFTCQGAIVRTLSRGETIFCDGTFTGKAGRGRFLRRKPFVP
FT                   PVL"
FT   gene            complement(453608..454819)
FT                   /locus_tag="UM146_02160"
FT   CDS_pept        complement(453608..454819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02160"
FT                   /product="peptidase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69859"
FT                   /protein_id="ADN69859.1"
FT                   /translation="MAKNIPFKLILEKAKDYQADMTRFLRDMVAIPSESCDEKRVVHRI
FT                   KEEMEKVGFDKVEIDPMGNVLGYIGHGPRLVAMDAHIDTVGIGNIKNWDFDPYEGMETD
FT                   ELIGGRGTSDQEGGMASMVYAGKIIKDLGLEDEYTLLVTGTVQEEDCDGLCWQYIIEQS
FT                   GIRPEFVVSTEPTDCQVYRGQRGRMEIRIDVQGVSCHGSAPERGDNAIFKMGPILGELQ
FT                   ELSQRLGYDEFLGKGTLTVSEIFFTSPSRCAVADSCAVSIDRRLTWGETWEGALDEIRA
FT                   LPAVQKANAVVSMYNYDRPSWTGLVYPTECYFPTWKVEEDHFTVKALVNAYEGLFGKAP
FT                   VVDKWTFSTNGVSIMGRHGIPVIGFGPGKEPEAHAPNEKTWKSHLVTCAAMYAAIPLSW
FT                   LATE"
FT   gene            complement(454877..456073)
FT                   /locus_tag="UM146_02165"
FT   CDS_pept        complement(454877..456073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02165"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /EC_number="4.3.1.15"
FT                   /note="COG0133 Tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69860"
FT                   /protein_id="ADN69860.1"
FT                   /translation="MSVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYHPT
FT                   PLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSFEH
FT                   LKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIV
FT                   TDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGV
FT                   TPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVNVGGD
FT                   MATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESG
FT                   AVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVAP"
FT   gene            complement(456131..457318)
FT                   /locus_tag="UM146_02170"
FT   CDS_pept        complement(456131..457318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02170"
FT                   /product="aspartate/ornithine carbamoyltransferase family
FT                   protein"
FT                   /note="COG0078 Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69861"
FT                   /protein_id="ADN69861.1"
FT                   /translation="MKTVNELIKDINSLTSHLHEKDFLLTWEQTPDELKQVLDVAAALK
FT                   ALRAENISTKVFNSGLGISVFRDNSTRTRFSYASALNLLGLAQQDLDEGKSQIAHGETV
FT                   RETANMISFCADAIGIRDDMYLGAGNAYMREVGAALDDGYKQGVLPQRPALVNLQCDID
FT                   HPTQSMADLAWLREHFGSLENLKGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVT
FT                   LAHPEGYDLIPDVVEVAKNNAKASGGSFRQVTSMEEAFKDADIVYPKSWAPYKVMEERT
FT                   ELLRANDHEGLKALEKQCLAQNAQHKDWHCTEEMMELTRDGEALYMHCLPADISGVSCK
FT                   EGEVTEGVFEKYRIATYKEASWKPYIIAAMILSRKYAKPGALLEQLLKEAQERVK"
FT   gene            457797..459575
FT                   /locus_tag="UM146_02175"
FT   CDS_pept        457797..459575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02175"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG3829 Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69862"
FT                   /protein_id="ADN69862.1"
FT                   /translation="MELATTQSVLMQIQPTIQRFARMLASVLQLEVEIVDENLCRVAGT
FT                   GAYGKFLGRQLSGNSRLLRHVLETKTEKVVTQSRFDPLCEGCDSKENCREKAFLGTPVI
FT                   LQERCVGVISLIAVTHEQQEHISDNLREFSDYVRHISTIFVSKLLEDQGPGDNISKIFA
FT                   TMIDNMDQGVLVVDADNRVQFVNQTALKTLGVVQNNIIGKPVRFRPLTFESNFTHGHMQ
FT                   HIVSWDDKSELIIGQLHNIQGRQLFLMAFHQSHTSFSVANAPDEPHIEQLVGECRVMRQ
FT                   LKRLISRIAPSPSSVMVVGESGTGKEVVARAIHKLSGRRNKPFIAINCAAIPEQLLESE
FT                   LFGYVKGAFTGASANGKTGLIQAANTGTLFLDEIGDMPLMLQAKLLRAIEAREILPIGA
FT                   SSPIQVDIRIISATNQNLAQFIAEGKFREDLFYRLNVIPITLPPLRERQEDIELLVHYF
FT                   LHLHTRRLGSVYPGIAPDVVEILRKHRWPGNLRELSNLMEYLVNVVPSGEVIDSTLLPP
FT                   NLLNNGTTEQSDVTEVSEAHLSLDDAGGTALEEMDKQMIREALSRHNSKKEVADELGIG
FT                   IATLYRKIKKYELLNT"
FT   gene            complement(459615..460094)
FT                   /locus_tag="UM146_02180"
FT   CDS_pept        complement(459615..460094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02180"
FT                   /product="xanthine dehydrogenase subunit XdhC"
FT                   /note="COG2080 Aerobic-type carbon monoxide dehydrogenase,
FT                   small subunit CoxS/CutS homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69863"
FT                   /protein_id="ADN69863.1"
FT                   /translation="MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCC
FT                   VGECGACTVLVDGTAIDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCG
FT                   FCTPGLIMATTAMLAKPREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK"
FT   gene            complement(460091..460969)
FT                   /locus_tag="UM146_02185"
FT   CDS_pept        complement(460091..460969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02185"
FT                   /product="xanthine dehydrogenase subunit XdhB"
FT                   /EC_number="1.17.1.4"
FT                   /note="COG1319 Aerobic-type carbon monoxide dehydrogenase,
FT                   middle subunit CoxM/CutM homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69864"
FT                   /protein_id="ADN69864.1"
FT                   /translation="MFDFASYHRATTLADAITLLADNPQAKLLAGGTDVLIQLHHHNDR
FT                   YRHIVDIHNLAELRGITQAEDGALRIGSATTFTQLIEDPVIQRNLPALCAAAASIAGPQ
FT                   IRNVATYGGNICNGATSADSATPTLIYDAKLELHSPRGVRFVPINGFHTGPGKVSLEHD
FT                   EILVAFHFPPQPKEHAGSAHFKYAMRDAMDISTIGCAAHCRLDNGNFSELRLAFGVAAP
FT                   TPIRCQHAEQTAQNAPLNLQTLEAISESVLQDVAPRSSWRASKEFRLHLIQTMTQKVIS
FT                   EAVAAAGGKLQ"
FT   gene            complement(460980..463277)
FT                   /locus_tag="UM146_02190"
FT   CDS_pept        complement(460980..463277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02190"
FT                   /product="xanthine dehydrogenase subunit XdhA"
FT                   /note="COG1529 Aerobic-type carbon monoxide dehydrogenase,
FT                   large subunit CoxL/CutL homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69865"
FT                   /protein_id="ADN69865.1"
FT                   /translation="MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRS
FT                   PIAHGYAVSINDEQARSLPGVLAIFTWEDVPEIPFATAGHAWTLDENKRDTADRALLTR
FT                   HVRHHGDVVAIVVARDELTAEKAAQLVSIEWQELPVITSPEAALAEDAAPIHNGGNLLK
FT                   QSTMSTGNVQQTIDAADYQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPH
FT                   IVRRVVGQALDIPWSCVRVIKPFIGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSRE
FT                   ECFLATRTRHAFTIDGQMGVNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLY
FT                   PRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAR
FT                   EGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNT
FT                   WPVGVEIAGARLLMNQDGTINVQSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQD
FT                   TDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLV
FT                   ERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVT
FT                   INRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMP
FT                   TMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAIRNAVKMATGVAINTLPLTPK
FT                   RLYEEFHLAGLI"
FT   gene            463691..464446
FT                   /locus_tag="UM146_02195"
FT   CDS_pept        463691..464446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02195"
FT                   /product="Tetratricopeptide repeat transcriptional
FT                   regulator"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69866"
FT                   /protein_id="ADN69866.1"
FT                   /translation="MSAGRLNKKSLGIVMLLSVGLLLAGCSGSKSSDTGTYSGSVYTVK
FT                   RGDTLYRISRTTGTSVKELARLNGISPPYTIEVGQKLKLGGAKSSSSTRKSTAKSTTKT
FT                   ASVTPSSAVPKSSWPPVGQRCWLWPTTGKVIMPYSTADGGNKGIDISAPRGTPIYAAGA
FT                   GKVVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMGSTDAAS
FT                   VRLHFQIRYRATAIDPLRYLPPQGSKPKC"
FT   gene            464525..464598
FT                   /locus_tag="UM146_t23827"
FT   tRNA            464525..464598
FT                   /locus_tag="UM146_t23827"
FT                   /product="tRNA-Gly"
FT   gene            complement(464915..466144)
FT                   /locus_tag="UM146_02200"
FT   CDS_pept        complement(464915..466144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02200"
FT                   /product="putative transporter protein"
FT                   /note="COG0814 Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69867"
FT                   /protein_id="ADN69867.1"
FT                   /translation="MSNIWSKEETLWSFALYGTAVGAGTLFLPIQLGSAGAVVLFITAL
FT                   VAWPLTYWPHKALCQFILSSKTSAGEGITGAVTHYYGKKIGNLITTLYFIAFFVVVLIY
FT                   AVAITNSLTEQLAKHMVIDLRIRMLVSLGVVLILNLIFLMGRHATIRVMGFLVFPLIAY
FT                   FLFLSIYLVGSWQPDLLTTQVEFNQNTLHQIWISIPVMVFAFSHTPIISTFAIDRREKY
FT                   GEHAMDKCKKIMKVAYLIICISVLFFVFSCLLSIPPSYIEAAKEEGVTILSALSMLPNA
FT                   PAWLSISGIIVAVVAMSKSFLGTYFGVIEGATEVVKTTLQQVGVKKSRAFNRALSIMLV
FT                   SLITFIVCCINPNAISMIYAISGPLIAMILFIMPTLSTYLIPALKPWRSIGNLITLIVG
FT                   ILCVSVMFFS"
FT   gene            466399..467580
FT                   /locus_tag="UM146_02205"
FT   CDS_pept        466399..467580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02205"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69868"
FT                   /protein_id="ADN69868.1"
FT                   /translation="MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPA
FT                   YAVDEVILGQVLTAGAGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQC
FT                   GEADIVIAGGQENMSRAPHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAEN
FT                   LAREYGISRQFQDAYALSSQQKARAAIDAGRFKDEIVPVITQSNGQTLVVDTDEQPRTD
FT                   TSAEGLARLNPSFDSLGSVTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASV
FT                   GVDPALMGIAPVYATRRCLERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVN
FT                   GGAIALGHPIGASGCRILVSLVHEMVKRNARKGLATLCIGGGQGVALTIERDE"
FT   gene            467867..468703
FT                   /locus_tag="UM146_02210"
FT   CDS_pept        467867..468703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02210"
FT                   /product="5-keto-4-deoxyuronate isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="COG3717 5-keto 4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69869"
FT                   /protein_id="ADN69869.1"
FT                   /translation="MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRI
FT                   IVGGIMPVTKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDAL
FT                   YVGKGAKEVVFASIDTATPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTI
FT                   NKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQ
FT                   PQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKDLR"
FT   gene            468733..469494
FT                   /locus_tag="UM146_02215"
FT   CDS_pept        468733..469494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02215"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69870"
FT                   /protein_id="ADN69870.1"
FT                   /translation="MILSAFSLEGKVAVVTGCDTGLGQGMALGLAQAGCDIVGINIVEP
FT                   TETIKQVTALGRRFLSLTADLRKIDGIPALLDRAVAEFGHIDILVNNAGLIRREDALEF
FT                   SEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGGKIINIASMLSFQGGIRVPSYTASKS
FT                   GVMGVTRLMANEWAKHNINVNAIAPGYMATNNTQQLRADEQRSAEILDRIPAGRWGLPS
FT                   DLMGPVVFLASSASDYVNGYTIAVDGGWLAR"
FT   gene            469809..471227
FT                   /locus_tag="UM146_02220"
FT   CDS_pept        469809..471227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02220"
FT                   /product="arabinose transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69871"
FT                   /protein_id="ADN69871.1"
FT                   /translation="MVTINTESALTPRPLRDTRRMNMFVSVAAAVAGLLFGLDIGVIAG
FT                   ALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSI
FT                   GSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVL
FT                   AFLSDTAFSYSGNWRAMLGVLALPAVLLIILVVFLPNSPRWLAEKGRHIEAEEVLRMLR
FT                   DTSEKAREELNEIRESLKLKQGGWALFKINRNVRRAVFLGMLLQAMQQFTGMNIIMYYA
FT                   PRIFKMAGFTTTEQQMIATLVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLV
FT                   LGYCLMQFDNGTASSGLSWLSVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITC
FT                   STTTNWVSNMIIGATFLTLLDSIGAAGTFWLYTALNIAFVGITFWLIPETKNVTLEHIE
FT                   RKLMAGEKLRNIGV"
FT   gene            471356..472048
FT                   /locus_tag="UM146_02225"
FT   CDS_pept        471356..472048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02225"
FT                   /product="putative racemase"
FT                   /note="COG1794 Aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69872"
FT                   /protein_id="ADN69872.1"
FT                   /translation="MKTIGLLGGMSWESTIPYYRLINEGIKQRLGGLHSAQVLLHSVDF
FT                   HEIEECQRRGEWDKTGDILAEAALGLQRAGAEGIVLCTNTMHKVADAIESRCSLPFLHI
FT                   ADATGRAITGAGMTRVALLGTRYTMEQDFYRGRLTEQFSINCLIPEADERAKINQIIFE
FT                   ELCLGQFTEASRAYYAQVIARLAEQGAQGVIFGCTEIGLLVPEERSVLPVFDTAAIHAE
FT                   DAVAFMLS"
FT   gene            complement(472035..472970)
FT                   /locus_tag="UM146_02230"
FT   CDS_pept        complement(472035..472970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02230"
FT                   /product="DNA-binding transcriptional regulator LysR"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69873"
FT                   /protein_id="ADN69873.1"
FT                   /translation="MAAVNLRHIEIFHAVMTAGSLTEAAHLLHTSQPTVSRELARFEKV
FT                   IGLKLFERIRGRLHPTVQGLRLFEEVQRSWYGLDRIVSAAESLREFRQGELSIACLPVF
FT                   SQSFLPQLLQPFLARYPDVSLNIVPQESPLLEEWLSAQRHDLGLTETLHTPAGTERTEL
FT                   LSLDEVCVLPPGHPLAVKKVLTPDDFHSENYISLSRTDSYRQLLDQLFTENQVKRRMIV
FT                   ETHSAASVCAMVRAGVGVSVVNPLTALDYAASGLVVRRFSIAVPFTVSLIRPLHRPSSA
FT                   LVQAFSEHLQAGLPKLVTSLDAILSSATTA"
FT   gene            473092..474354
FT                   /locus_tag="UM146_02235"
FT   CDS_pept        473092..474354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02235"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="COG0019 Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69874"
FT                   /protein_id="ADN69874.1"
FT                   /translation="MPHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQ
FT                   FDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVI
FT                   DQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSK
FT                   HGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVLEFGQDLQAI
FT                   SAGGGLSIPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQAGVLI
FT                   TQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGP
FT                   LCESGDVFTQQEGGNVETRALPEVKACDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDN
FT                   GQARLIRRRQTIEELLALELL"
FT   gene            complement(474361..475392)
FT                   /locus_tag="UM146_02240"
FT   CDS_pept        complement(474361..475392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02240"
FT                   /product="DNA-binding transcriptional regulator GalR"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69875"
FT                   /protein_id="ADN69875.1"
FT                   /translation="MATIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSY
FT                   HPNANARALAQQTTETIGLVVGDVSDPFFGAMVKAVEQVAYHTGNFLLIGNGYHNEQKE
FT                   RQAIEQLIRHRCAALVVHAKMIPDADLASLMKQMPGMVLINRILPGFENRCIALDDRYG
FT                   AWLATRHLIQQGHTRIGYLCSNHSISDAEDRLQGYYDALAESGIPANDRLVTFGEPDES
FT                   GGEQAMTELLGRGRNFTAVACYNDSMAAGAMGVLNDNGIDVPGEISLIGFDDVLVSRYV
FT                   RPRLTTVRYPIVTMATQAAELALALADNRPLPEITNVFSPTLVRRHSVSTPSLEASHHA
FT                   TSD"
FT   gene            475978..478137
FT                   /locus_tag="UM146_02245"
FT   CDS_pept        475978..478137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02245"
FT                   /product="bifunctional acyl-[acyl carrier protein]
FT                   synthetase/2-acylglycerophosphoethanolamine
FT                   acyltransferase"
FT                   /note="COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69876"
FT                   /protein_id="ADN69876.1"
FT                   /translation="MLFSFFRNLCRVLYRVRVTGDTKALKGERVLITPNHVSFIDGILL
FT                   ALFLPVRPVFAVYTSISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFP
FT                   EGRITTTGSLMKIYDGAGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLH
FT                   ILPPTQVEMPDAPRARDRRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKK
FT                   CVEDVNFTPDSYRKLLTKTLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRI
FT                   PAMMNYTAGVKGLTSAITAAEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADV
FT                   TTADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKT
FT                   IADFTTNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTV
FT                   LFGTSTFLGHYARFANPYDFYRLRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECA
FT                   PVVSINVPMAAKPGTVGRILPGMDARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVL
FT                   EVPTAENIRGEMERDWYDTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALG
FT                   VSPDKVHATAIKSDASKGEALVLFTTDNELTRDKLQQYAREHGVPELAVPRDIRYLKQM
FT                   PLLGSGKPDFVTLKSWVDEAEQHDE"
FT   gene            478130..479323
FT                   /locus_tag="UM146_02250"
FT   CDS_pept        478130..479323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02250"
FT                   /product="lysophospholipid transporter LplT"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69877"
FT                   /protein_id="ADN69877.1"
FT                   /translation="MSESVHTNTSLWSKGMKAVIVAQFLSAFGDNALLFATLALLKAQF
FT                   YPEWSQPILQMVFVGAYILFAPFVGQVADSFAKGRVMMFANGLKLLGAASICFGINPFL
FT                   GYTLVGVGAAAYSPAKYGILGELTTGSKLVKANGLMEASTIAAILLGSVAGGVLADWHI
FT                   LVALVACALAYGGAVVANIYIPKLAAARPGQSWNLISMTRSFLNACTSLWRNGETRFSL
FT                   VGTSLFWGAGVTLRFLLVLWVPVALGITDNATPTYLNAMVAIGIVVGAGAAAKLVTLET
FT                   VSRCMPAGILIGVVVLIFSLQHELLPAYALLMLIGVLGGFFVVPLNALLQERGKKSVGA
FT                   GNAIAVQNLGENSAMLLMLGIYSLAVMVGIPVVPIGIGFGALFALAITALWIWQRRH"
FT   gene            complement(479355..480395)
FT                   /gene="tas"
FT                   /locus_tag="UM146_02255"
FT   CDS_pept        complement(479355..480395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tas"
FT                   /locus_tag="UM146_02255"
FT                   /product="putative aldo-keto reductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69878"
FT                   /protein_id="ADN69878.1"
FT                   /translation="MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGIN
FT                   LIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQA
FT                   LDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDA
FT                   LAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEV
FT                   SQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIA
FT                   RRHGLDPAQMALAFVRRQPFVASTLLGATTMEQLKTNVESLHLELSEDVLAEIEAVHQV
FT                   YTYPAP"
FT   gene            complement(480503..480721)
FT                   /locus_tag="UM146_02260"
FT   CDS_pept        complement(480503..480721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02260"
FT                   /product="hypothetical protein"
FT                   /note="COG0243 Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69879"
FT                   /protein_id="ADN69879.1"
FT                   /translation="MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDD
FT                   TGLVSYHDQQGNAMQINRDDVSQIIER"
FT   gene            complement(480859..481572)
FT                   /locus_tag="UM146_02265"
FT   CDS_pept        complement(480859..481572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02265"
FT                   /product="hypothetical protein"
FT                   /note="COG0861 Membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69880"
FT                   /protein_id="ADN69880.1"
FT                   /translation="MLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQR
FT                   AHARRLGLAGAMVMRLALLASIAWVTRLTNPLFTIFSQEISARDLILLLGGLFLIWKAS
FT                   KEIHESIEGEEEGLKTRVSSFLGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAAVVI
FT                   AVGVMMFAARSIGDFVERHPSVKMLALSFLILVGFTLILESFDIHVPKGYIYFAMFFSI
FT                   AVESLNLIRNKKNPL"
FT   gene            complement(481641..482330)
FT                   /locus_tag="UM146_02270"
FT   CDS_pept        complement(481641..482330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02270"
FT                   /product="DNA mismatch repair protein"
FT                   /note="COG3066 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69881"
FT                   /protein_id="ADN69881.1"
FT                   /translation="MSQPRPLLSPPETEEQLLAQAQQLSGYTLGELAALAGLVTPENLK
FT                   RDKGWIGVLLEIWLGASAGSKPEQDFAALGVELKTIPVDSLGRPLETTFVCVAPLTGNS
FT                   GVTWETSHVRHKLKRVLWIPVEGERSIPLAKRRVGSPLLWSPNEEEDRQLREDWEELMD
FT                   MIVLGQIERITARHGEYLQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALL
FT                   ARHFLIQ"
FT   gene            483015..483545
FT                   /locus_tag="UM146_02275"
FT   CDS_pept        483015..483545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02275"
FT                   /product="dinucleoside polyphosphate hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69882"
FT                   /protein_id="ADN69882.1"
FT                   /translation="MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGES
FT                   AEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQL
FT                   VSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTP
FT                   KPQNASAYRRKRG"
FT   gene            483558..485804
FT                   /locus_tag="UM146_02280"
FT   CDS_pept        483558..485804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02280"
FT                   /product="fused phosphoenolpyruvate-protein
FT                   phosphotransferase PtsP/GAF domain protein"
FT                   /note="COG3605 Signal transduction protein containing GAF
FT                   and PtsI domains"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69883"
FT                   /protein_id="ADN69883.1"
FT                   /translation="MLTRLREIVEKVASAPRLNEALNILVTDICLAMDTEVCSVYLADH
FT                   DRRCYYLMATRGLKKPRGRTVTLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKE
FT                   ERFRAFLGVPIIQRRQLLGVLVVQQRELRQYDESEESFLVTLATQMAAILSQSQLTALF
FT                   GQYRQTRIRALPAAPGVAIAEGWQDATLPLMEQVYQASTLDPALERERLTGALEEAANE
FT                   FRRYSKRFAAGAQKETAAIFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAE
FT                   QFAALSDNYLKERAGDLRALGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQ
FT                   DRLVGVVVRDGAANSHAAIMVRALGIPTVMGADIQPSVLHRRTLIVDGYRGELLVDPEP
FT                   VLLQEYQRLISEEIELSRLAEDDVNLPAQLKSGERIKVMLNAGLSPEHEEKLGSRIDGI
FT                   GLYRTEIPFMLQSGFPSEEEQVAQYQGMLQMFNDKPVTLRTLDVGADKQLPYMPISEEN
FT                   PCLGWRGIRITLDQPEIFLIQVRAMLRANAATGNLNILLPMVTSLDEVDEARRLIERAG
FT                   REVEEMIGYEIPKPRIGIMLEVPSMVFMLPHLAKRVDFISVGTNDLTQYILAVDRNNTR
FT                   VANIYDSLHPAMLRALAMIAREAEIHGIDLRLCGEMAGDPMCVAILIGLGYRHLSMNGR
FT                   SVARVKYLLRRIDFAEAENLAQRSLEAQLATEVRHQVAAFMERRGMGGLIRGGL"
FT   gene            485955..486830
FT                   /locus_tag="UM146_02285"
FT   CDS_pept        485955..486830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02285"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="COG0682 Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69884"
FT                   /protein_id="ADN69884.1"
FT                   /translation="MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRA
FT                   NRPGSGWTKNEVENLLYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHG
FT                   GLIGVIVVMIIFARRTKRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFA
FT                   MLFPGSRTEDILLLQTNPQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPR
FT                   PMGAVSGLFLIGYGAFRIIVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWA
FT                   YRRSPQQHVS"
FT   gene            486837..487631
FT                   /gene="thyA"
FT                   /locus_tag="UM146_02290"
FT   CDS_pept        486837..487631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="UM146_02290"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG0207 Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69885"
FT                   /protein_id="ADN69885.1"
FT                   /translation="MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLV
FT                   TTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTP
FT                   DGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQL
FT                   YQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSR
FT                   EPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI"
FT   gene            487816..488286
FT                   /locus_tag="UM146_02295"
FT   CDS_pept        487816..488286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02295"
FT                   /product="hypothetical protein"
FT                   /note="COG2165 Type II secretory pathway, pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69886"
FT                   /protein_id="ADN69886.1"
FT                   /translation="MKTQRGYTLIETLVAMLILVMLSASGLYGWQYWQQSQRLWQTASQ
FT                   ARDYLLYLREDANWHNRDHSISLIREGTLWCLVSSVAGANTCHGSSPLVFVPRWPEVEM
FT                   SDLTPSLAFFGLRNTAWAGHIRFKNSTGEWWLVVSPWGRLRLCQQGETEGCL"
FT   gene            488277..488840
FT                   /locus_tag="UM146_02300"
FT   CDS_pept        488277..488840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02300"
FT                   /product="hypothetical protein"
FT                   /note="COG4795 Type II secretory pathway, component PulJ"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69887"
FT                   /protein_id="ADN69887.1"
FT                   /translation="MPVKEQGFSLLEVLIAMAISSVLLLGAARFLPALQRESLTNTRKL
FT                   ALEDEIWLRVFTVAKHLQRAGYCHGSCTGEGLEIVGQGDCVIVQWDANSNGIWDREPVK
FT                   ESDQIGFRLKEHVLETLRGATSCEGKGWDKVTNPDAIIIDTFQVVRQDVSGFSPVLTVN
FT                   MHAASKADPQTVVDASYSVTGSNL"
FT   gene            488837..489244
FT                   /locus_tag="UM146_02305"
FT   CDS_pept        488837..489244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69888"
FT                   /protein_id="ADN69888.1"
FT                   /translation="MNREKGVSSLALVLMLLILGSLLLQGMSQQDRSFASRVSMESQSL
FT                   RRQAIVQSALEWGKMHSWQTQPAVQCLLYAATGARVCLRLLADNEALLIAGYEGVSLWR
FT                   TGEVIDGNIVFSPRGWSDFCPLKERALCQLP"
FT   gene            489229..489552
FT                   /locus_tag="UM146_02310"
FT   CDS_pept        489229..489552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69889"
FT                   /protein_id="ADN69889.1"
FT                   /translation="MSASLRNQQGFSLPEVMLAMVLMVMIVTALSGFQRTLMNSLASRN
FT                   QYQQLWRHGWQQTQLRAISPPANWQVNRMQTSQAGCVSISVTLVSPGGREGEMTRLHCP
FT                   NRQ"
FT   gene            489565..492933
FT                   /gene="recC"
FT                   /locus_tag="UM146_02315"
FT   CDS_pept        489565..492933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="UM146_02315"
FT                   /product="exonuclease V subunit gamma"
FT                   /EC_number="3.1.11.5"
FT                   /note="COG1330 Exonuclease V gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69890"
FT                   /protein_id="ADN69890.1"
FT                   /translation="MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQW
FT                   LQMTLSQKFGIAANIDFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLE
FT                   REDFTLLRHYLTDDSDKRKLFQLSSKAADLFDQYLVYRPDWLAQWETGHLVEGLGEAQA
FT                   WQAPLWKALVEYTDELGQPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISALPPV
FT                   YLQALQALGKHIEIHLLFTNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSE
FT                   NAGQLFNSDGEQDVGNPLLASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQS
FT                   DILELENRAVAGVNIEEFSRSDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEE
FT                   DPTLTPRDIIVMVADIDSYSPFIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLL
FT                   SLPDSRFVSEDVLALLDVPVLAARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELP
FT                   ATGQHTWRFGLTRMLLGYAMESAQGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRR
FT                   GLAQERPLEEWLPVCRDMLNAFFLPDAETEAAMTLIEQQWQAIISEGLGAQYGDAVPLS
FT                   LLRDELALRLDQERISQRFLAGPVNICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGF
FT                   DLMSQKPKRGDRSRRDDDRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQELID
FT                   YIGQSHYLPGDEALNCDESEARVKAHLTCHHTRMPFDPQNYQPGNLQSYAREWLPAASQ
FT                   AGKAHSEFVQPLPFTLPETVPLETLQRFWAHPVRAFFQMRLQVNFRTEDSEIPDTEPFI
FT                   LEGLSRYQINQQLLNVLVEQDDAERLFRRFRAAGDLPYGAFGEIFWETQCQEMQQLADR
FT                   VIACRQPGQSMEIDLACNGVQITGWLPQVQPDGLLRWRPSLLSVAQGMQLWLEHLVYCA
FT                   SGGNGESRLFLRKDGEWRFPPLAAEQALHYLSQLIEGYREGMSAPLLVLPESGGAWLKT
FT                   CYDAQNDAMLDDDSTLQKARTKFLQAYEGNMMVRGEGDDIWYQRLWRQLTPETMEAIVE
FT                   QSQRFLLPLFRFNQS"
FT   gene            493109..495997
FT                   /locus_tag="UM146_02320"
FT   CDS_pept        493109..495997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02320"
FT                   /product="protease III"
FT                   /note="COG1025 Secreted/periplasmic Zn-dependent
FT                   peptidases, insulinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69891"
FT                   /protein_id="ADN69891.1"
FT                   /translation="MPRSIWFKALLLFVALWAPLSQAETGWQPIQETIRKSDKDNRQYQ
FT                   AIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHYLEHMSLMGSKKYPQA
FT                   DSLAEYLKMHGGSHNASTAPYRTAFYLEVENDALPGAVDRLADAIAEPLLDKKYAERER
FT                   NAVNAELTMARTRDGMRMAQVSAETINPAHPGSKFSGGNLETLSDKPGNPVQQALKDFH
FT                   EKYYSANLMKAVIYSNKPLPELAKMAADTFGRVPNKESKKPEITVPVVTDAQKGIIIHY
FT                   VPALPRKVLRVEFRIDNNSAKFRSKTDELITYLIGNRSPGTLSDWLQKQGLVEGISANS
FT                   DPIVNGNSGVLAIFASLTDKGLANRDQVVAAIFSYLNLLREKGIDKQYFDELANVLDID
FT                   FRYPSITRDMDYVEWLADTMIRVPVEHTLDAVNIADRYDAKAVKERLAMMTPQNARIWY
FT                   ISPKEPHNKTAYFVDAPYQVDKISEQTFADWQKKAANIALSLPELNPYIPDDFSLIKSE
FT                   KKYDHPELIVDESNLRVVYAPSRYFASEPKADVSLILRNPKAMDSARNQVMFALNDYLA
FT                   GLALDQLSNQASVGGISFSTNANNGLMVNANGYTQRLPQLFQALLEGYFSYTATEDQLE
FT                   QAKSWYNQMMDSAEKGKAFEQAIMPAQMLSQVPYFSRDERRKILPSITLKEVLAYRDTL
FT                   KSGARPEFMVIGNMTEAQATTLARHVQKQLGADGSEWCRNKDVVVDKKQSVIFEKAGNS
FT                   TDSALAAVFVPTGYDEYTSSAYSSLLGQIVQPWFYNQLRTEEQLGYAVFAFPMSVGRQW
FT                   GMGFLLQSNDKQPSFLWERYKAFFPTAEAKLRAMKPEEFAQIQQAVITQMLQAPQTLGE
FT                   EASKLSKDFDRGNMRFDSRDKIVAQIKLLTPQKLADFFHQAVVEPQGMAILSQISGSQN
FT                   GKAEYVHPEGWKVWENVSALQQTMPLMSEKNE"
FT   gene            495990..499532
FT                   /gene="recB"
FT                   /locus_tag="UM146_02325"
FT   CDS_pept        495990..499532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="UM146_02325"
FT                   /product="exonuclease V subunit beta"
FT                   /EC_number="3.1.11.5"
FT                   /note="COG1074 ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69892"
FT                   /protein_id="ADN69892.1"
FT                   /translation="MSDVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLG
FT                   GSAAFPRPLTVEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYKRLLEEI
FT                   DYKAQAAQWLLLAERQMDEAAVFTIHGFCQRMLNLNAFESGMLFEQQLIEDESLLRYQA
FT                   CADFWRRHCYPLPREIAQVVFETWKGPQALLRDINRYLQGEAPVIKAPPPDDETLASRH
FT                   AQIVARIDAVKQQWRDAVGELDALIESSGIDRRKFNRSNQAKWIEKISAWAEEETNSYQ
FT                   LPESLEKFSQRFLEDRTKAGGETPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVA
FT                   REKRRRGELGFDDMLSRLDSALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRR
FT                   IWHHQPETALLLIGDPKQAIYAFRGADIFTYMKARSEVHAHYTLDTNWRSAPGMVNSVN
FT                   KLFSQTDDAFMFREIPFIPVKSAGKNQALRFVFKGETQPAMKMWLMEGESCGVGDYQST
FT                   MAQVCAAQICDWLQAGQRGEALLMNGDDARPVRASDISVLVRSRQEAAQVRDALTLLEI
FT                   PSVYLSNRDSVFETLEAQEMLWLLQAVMTPERENTLRSALATSMMGLNALDIETLNNDE
FT                   HAWDAVVEEFDGYRQIWRKRGVMPMLRALMSARNIAENLLATAGGERRLTDILHISELL
FT                   QEAGTQLESEHALVRWLSQHILEPDSNASSQQMRLESDKHLVQIVTIHKSKGLEYPLVW
FT                   LPFITNFRVQDQAFYHDRHSFEAVLDLNAAPESVDLAEAERLAEDLRLLYVALTRSVWH
FT                   CSLGVAPLVRRRGDKKGDTDVHQSALGRLLQKGEPQDAAGLRTCIEALCNDDIAWQTAQ
FT                   IGDNQPWQVNDALTAELNARTLQRLPGDNWRVTSYSGLQQRGHGIAQDLMPRLDVDAAG
FT                   VVSVVEEPTLTPHQFPRGASPGTFLHSLFEDLDFTQPIDPNWVQEKLELGGFEPQWELV
FT                   LTEWITAVLQAPLNETGVSLNQLSDRDKQVEMEFYLPISEPLIASQLDALIRQFDPLSA
FT                   GCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRY
FT                   DLQYQLYTLALHRYLRHRIADYDYERHFGGVIYLFLRGVDKEHPQQGIYATRPNAGLID
FT                   LMDEMFASMTLEEA"
FT   gene            499532..501358
FT                   /gene="recD"
FT                   /locus_tag="UM146_02330"
FT   CDS_pept        499532..501358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="UM146_02330"
FT                   /product="exonuclease V subunit alpha"
FT                   /EC_number="3.1.11.5"
FT                   /note="COG0507 ATP-dependent exoDNAse (exonuclease V),
FT                   alpha subunit - helicase superfamily I member"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69893"
FT                   /protein_id="ADN69893.1"
FT                   /translation="MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHD
FT                   AGEGHVCLPLSRLENNEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCG
FT                   DRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALT
FT                   RRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQ
FT                   LPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSR
FT                   LIDALPDHARVIFLGDRDQLASVEAGAVLGDICAYANAGFTAERAGQLSRLTGSHVPAG
FT                   TGTEAASLRDSLCLLQKSYRFGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQ
FT                   SGEDYIAMLEEALAGYGRYLDLLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERI
FT                   EQFMQQKRKIHRHPHSRWYEGRPVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDG
FT                   NIKSVQPSRLPEHETTWAMTVHKSQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRR
FT                   LSLYADERILSAAIATRTERRSGLAALFSSRG"
FT   gene            complement(501420..502751)
FT                   /locus_tag="UM146_02335"
FT   CDS_pept        complement(501420..502751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02335"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="COG0548 Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69894"
FT                   /protein_id="ADN69894.1"
FT                   /translation="MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSI
FT                   VNDIGLLHSLGIRLVVVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTL
FT                   QLDITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHR
FT                   QLDSGAIVLMGPVAVSVTGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIV
FT                   SELFPNEAQARVEAQEEKGDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELF
FT                   SRDGIGTQIVMESAEQIRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTII
FT                   QRDNTTIACAALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFV
FT                   LTTRSIHWFQERGFTPVDIDLLPESKKQLYNYQRKSKVLMADLG"
FT   gene            502983..504236
FT                   /locus_tag="UM146_02340"
FT   CDS_pept        502983..504236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02340"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="COG0860 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69895"
FT                   /protein_id="ADN69895.1"
FT                   /translation="MSGSNTAISRRRLLQGAGAMWLLSVSQVSLAAVSQVVAVRVWPAS
FT                   SYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVG
FT                   QFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPANAQDMQDPLLALLEDYNK
FT                   GDLEKQVPPAQSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRL
FT                   RSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFA
FT                   LSTKGATSTAAKYLAQTQNASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLKFGKAVL
FT                   NKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESI
FT                   LAGIKAYFADGATLARRG"
FT   misc_feature    504437..505305
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218690942|ref|YP_002399154.1| putative transcription
FT                   antiterminator"
FT   gene            505337..506917
FT                   /locus_tag="UM146_02355"
FT   CDS_pept        505337..506917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02355"
FT                   /product="Phosphotransferase system system, maltose and
FT                   glucose-specific IIABC component"
FT                   /note="COG1263 Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69896"
FT                   /protein_id="ADN69896.1"
FT                   /translation="MKQKKAWSFFQSLGKAFMYPIALLSVCGMMLGLGSGLASDDMAKL
FT                   IPFLAIPIIKTILDFIVSLGLFAFVNLPVLFAIAIPLGLLKDKEDKAYGAFSGLIGFMA
FT                   MHLGTNFYLKQHDLLVVADQMSTHGQTIILGIQSYNTSVLGGIVAGLLVASMYKKIVNL
FT                   RIPESLGFYSGPRLVPIITLIVMSGFGLIIPFIWPPFFNLFMLIGHWISTSGPVGYFFY
FT                   AVAERVTIPFGLNHLVTSVFRFTPIGGSAVIGGEEYYGTLNMFMAYVKENAVIPLDLAG
FT                   KMEQGKLMIQYGLAGAALAMYRTAHAQNRKAIKALLISGVLTVIIGGVSEPIEFLFLFV
FT                   SPLLFVFHAFMNGFANMVLPYMGVKMGFTGDLIQFISFGVLRGTRTGWPIAVCVEVAYF
FT                   FIYYFVFRWTILKFNLMTVGREESNPVTLNVHEDTAIADIPTPDKSELQAAEQMVKALG
FT                   GKENIKSLDNCVTRLRLTIADMGLIDEVAIKRAGGIAVVKLDQNTLQVIIGTKVIALRR
FT                   DMDNYMGIY"
FT   misc_feature    506917..508091
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218559826|ref|YP_002392739.1| putative aminotransferase"
FT   gene            508094..508690
FT                   /locus_tag="UM146_02370"
FT   CDS_pept        508094..508690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02370"
FT                   /product="putative phosphosugar isomerase"
FT                   /note="COG0794 Predicted sugar phosphate isomerase involved
FT                   in capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69897"
FT                   /protein_id="ADN69897.1"
FT                   /translation="MNNTDLIYLIKHFMHNELKAVEEVIYSPLSEFANLIKVLQSCQGK
FT                   VVFIGVGKSGIIARKLAATFASTGTPSFFVHGTEAVHGDLGMVAKDDVVILISNSGETA
FT                   EILATLPSLKKMGNYLISFTRSHHSSLAISCDLSVEIPVKSEADNLGLAPSCSSTVVLV
FT                   VGDAVALALSELKKFTRADFGLYHPGGALGIKANS"
FT   gene            508762..509709
FT                   /locus_tag="UM146_02375"
FT   CDS_pept        508762..509709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02375"
FT                   /product="2-hydroxyacid dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69898"
FT                   /protein_id="ADN69898.1"
FT                   /translation="MKNVLVTFPSFSARCVSASKLLRENNFNLIIKNNVEHLLKSESTA
FT                   LRESICAVIAGKDGYQADTLSLLPGVRIISRFGTGIDNIDLRAAQQSGIVVNNAVGINS
FT                   NAVAEFIIGLIFASMRNIPGSYHAMQNGYWGESHVCELQGKRIGLVGYGNIGKTLAKRL
FT                   SGFDVELLAFDKQPDYQVADKAGVQFVSIEDIFMQSHVIIVLLPFSSELENFISHKYLS
FT                   MMRNGALIINAARGKLLDEGALLQVIEERNVFAALDVFSSEPLAQFSPLLHAKNIITTP
FT                   HIAAATVESYQQTGIHVAQSIIDYFAGREIKNVL"
FT   gene            complement(510011..511387)
FT                   /locus_tag="UM146_02380"
FT   CDS_pept        complement(510011..511387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02380"
FT                   /product="hypothetical protein"
FT                   /note="COG3515 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69899"
FT                   /protein_id="ADN69899.1"
FT                   /translation="MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQ
FT                   VEKLSLALFRQNGVELQTLVCYVLAITRRQGLAGMADGLGSLDILLQRWADFWPVQVHS
FT                   RISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHLSTIETTLQQCELWHMTKLDVLSG
FT                   QFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFATRSVQQNDKDASP
FT                   PVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSLE
FT                   SGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQ
FT                   VRALNAQWRKQRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAV
FT                   YGIRQSLKEPPLEELLRQLEEQKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
FT                   "
FT   gene            complement(511387..511815)
FT                   /locus_tag="UM146_02385"
FT   CDS_pept        complement(511387..511815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02385"
FT                   /product="hypothetical protein"
FT                   /note="COG3518 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69900"
FT                   /protein_id="ADN69900.1"
FT                   /translation="MSTPSLYEMLTFSFSGELPLEQISERDQLILSVMDNMQRIINCRA
FT                   GTLAHLPDYGLPDLSLIHQGMAAGIHGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHL
FT                   NYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQERAY"
FT   gene            complement(511819..512355)
FT                   /locus_tag="UM146_02390"
FT   CDS_pept        complement(511819..512355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02390"
FT                   /product="hypothetical protein"
FT                   /note="COG3521 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69901"
FT                   /protein_id="ADN69901.1"
FT                   /translation="MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQ
FT                   IKILHLDFFSRSALNTDAEDTPLSTMVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVL
FT                   AKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSI
FT                   ELMRSDLRLLPLKDK"
FT   gene            complement(512336..513415)
FT                   /locus_tag="UM146_02395"
FT   CDS_pept        complement(512336..513415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02395"
FT                   /product="hypothetical protein"
FT                   /note="COG3520 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69902"
FT                   /protein_id="ADN69902.1"
FT                   /translation="MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQKAPLGSTD
FT                   NPAADAVRFRPHPGMGFPVSELKNVERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDY
FT                   ITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYPASFEAGAVDDISRCLLGLIGLGI
FT                   PGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVVPHDPQPVILPAP
FT                   AGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLRV
FT                   YLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGL
FT                   IPAFSIRNRESMTHVSYSF"
FT   gene            complement(513379..515139)
FT                   /locus_tag="UM146_02400"
FT   CDS_pept        complement(513379..515139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02400"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="COG3519 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69903"
FT                   /protein_id="ADN69903.1"
FT                   /translation="MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPY
FT                   VERLFEGFAFLMGRLREKLDDDLPELTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQ
FT                   SETLSDFQVLSRPVGERRTRCVYSATRDITLHPLALPDVSLQYEPDGRSVIRLRFACGP
FT                   LVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQDRRMLGAHFSPMGF
FT                   EDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVVLNEN
FT                   WPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNI
FT                   ISSRHTGSQAYVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDSD
FT                   RMLEDETLSLSLTGTNGQLPRKALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDR
FT                   FHWRVLSHLGSNFLSMMDNAEILRGTLALYDWTESEMNRRRLEAIVDVQHSLIQRFERG
FT                   FLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLFTQLTLILQPTGKCLQW
FT                   TEHHSQRVPG"
FT   gene            complement(515509..515952)
FT                   /locus_tag="UM146_02405"
FT   CDS_pept        complement(515509..515952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69904"
FT                   /protein_id="ADN69904.1"
FT                   /translation="MNIQAIKEMVNLICSFLFIFFLSSAFVSFGCYAIYELFLWNDIIV
FT                   YSWGYILIVFLPFTLYVMSFEILFFAISGRRLSKVTMVRLWLIIKIIIAFSICAVLIFS
FT                   SIYKKELLSRNYIACSGIPSGWMPGLATKYVKEKSLCEKNGNN"
FT   gene            complement(516003..516143)
FT                   /locus_tag="UM146_02410"
FT   CDS_pept        complement(516003..516143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69905"
FT                   /protein_id="ADN69905.1"
FT                   /translation="MAYIEAAQQEFVEKARETADDIWDLGTMWAKNVLIKGREVLEHEV
FT                   K"
FT   gene            complement(516209..516838)
FT                   /locus_tag="UM146_02415"
FT   CDS_pept        complement(516209..516838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69906"
FT                   /protein_id="ADN69906.1"
FT                   /translation="MFLKRKWYYAVTTSVVITLCGGGYYMYRQEYQMVVTVPTADANDP
FT                   NWPNKRIQFDTSEWLQQLQYIKIDDHYILNTQYTPIANLDDFGITLKLQNALNGSDKRL
FT                   PALYGLAEMDAQKFKDLMRGKIKCEYLRTTFDAETLKPVNDYFLISFTYKDKWYEFETE
FT                   RKISKTSDDGYFLWAFDNTVHEAGYWHNTDPAAYSYRDYQNGKAVK"
FT   gene            complement(516838..518421)
FT                   /locus_tag="UM146_02420"
FT   CDS_pept        complement(516838..518421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02420"
FT                   /product="hypothetical protein"
FT                   /note="COG4104 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69907"
FT                   /protein_id="ADN69907.1"
FT                   /translation="MAMGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCG
FT                   RYPGMFIIVGGVPETDIHGRLMAGSLDSQSSCPCKARFIASMMDDTYETDDGGSEPEQH
FT                   AQSARKNLTSGNPDKKYSHQIKLQHGENNVSVQDIPYVFILNNNMSLSGKTNQDGETER
FT                   IYTDTAQKVIALTGKLADSWLKRGKNFGSLKEIDNRKIELTTEENEPVKYVNWINGRDY
FT                   IVIVAARTAVTNWIGMEDSKGNQYRFINCGLEQLQQFPPASKQDSSSQRIMVVFSLGYT
FT                   QKDIDRINDYTKAHDGRIIYVKNKDELVSFLNQRKEKGRVIKELVILCHGVIKTASYHY
FT                   HHEDKDIEKNGMFKHEDIAAVHESVFDYDAHVTTYACRAGISDGDKDFSGKDDAGQKDS
FT                   PAQKMADNWDVMVKAFEMRSDYSLAYGTGKEIKEAQEYGSVVEKYKKDIDMYNKEKAKG
FT                   NTEVSPPVKPEGYDEKSKRHADVTTRDKNEKSGGGPIAPNGAWHMPRTGDSPKGLKSGL
FT                   QDYQPEEWVQ"
FT   gene            complement(518421..520058)
FT                   /locus_tag="UM146_02425"
FT   CDS_pept        complement(518421..520058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02425"
FT                   /product="hypothetical protein"
FT                   /note="COG3515 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69908"
FT                   /protein_id="ADN69908.1"
FT                   /translation="MRKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPV
FT                   TADTPVGEDPGYHDDFLRIRDEMNKLSGTDTGLICQLAESLLLTQAKDVRIATYYIWAR
FT                   LHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAK
FT                   EDFANIVAALNQLTVSFTAWPEDQHSPSLMPLINALESRLAQSGGMNAVVPQNSSSVTA
FT                   PSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDV
FT                   DGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKA
FT                   GVPWDRWTAVIRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLA
FT                   GKAAVPTDDATNDVLALEPEALAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARV
FT                   AEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFEVKARQLKLLRLRAHRYADKALLN
FT                   RKMEILLGTLVAIDPARAAVLCDTQHKD"
FT   gene            complement(520024..523377)
FT                   /locus_tag="UM146_02430"
FT   CDS_pept        complement(520024..523377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02430"
FT                   /product="hypothetical protein"
FT                   /note="COG3523 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69909"
FT                   /protein_id="ADN69909.1"
FT                   /translation="MHTQRYGFWGYLILIIGLAGICALLIIINQDVLIKSGVSARLIWG
FT                   IWAGLFSLFLLGVVCSPFWWIRKQRKAQFIYRPKNSAENDQPVSSPSEDILTDLSSNIR
FT                   LRYGPFWRRKVRLLLVTGEPEEAEAIAPGLTGQHWLEGDHTVLIYGGRPTAEPDVTLLT
FT                   ALKKLRRSRPLDGIIWPLTEEQSRQTAQLDKGWRELINGGKRLGFQAPLYLWQVCDDGD
FT                   YQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLADNRHDFLLRLAHTLA
FT                   ERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDNA
FT                   RGRTVGFPWLRTALMSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQ
FT                   LVALHTLQGELERLQYRIREGAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDH
FT                   LQQQLNAFVALPPNSPQRTATGEQRYKQLKALLMTSRPEKADAAFFSTTLMADGLRYEN
FT                   IPEGVRQSVLPSLLTFWTANLPEHPQWKTSPPPELTGAVRKILLRQIGVRNAENTLYQN
FT                   VLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARRE
FT                   EIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQ
FT                   LTLMADARQSPLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGNE
FT                   PVGPLDKTFAPLLRLLGDKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQ
FT                   QLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSL
FT                   NRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRINQFIAANLSGVLKRE
FT                   GRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVMKTHL
FT                   VIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQ
FT                   AQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKD
FT                   AEEYGEDADE"
FT   gene            complement(523387..524604)
FT                   /locus_tag="UM146_02435"
FT   CDS_pept        complement(523387..524604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69910"
FT                   /protein_id="ADN69910.1"
FT                   /translation="MSLLIIANVHVAVGLSVLNQKIVSSHNMGWPVPDIPERKMLPEPV
FT                   YRRWIILLISMLTVGTLFILSVWNSATYWDIFIYGVLPMLFLWLCLFGIALNKYEQSVA
FT                   ACISWESERQQVKQLWQHWSQKQLAIVGNVLFTPEEKGMSVLLGPQEEIPAYPKKARPL
FT                   FSASRYSLSSIFHDIHQQLTQQFPDYRHYLHTIYVLQPEKWRGETVRQAIFHQWDLVPE
FT                   RTNTLNQIQSLYDERFDGLILVVCLQNWPENKPEDTSELVSAQLISSSSFVRQHQIPVI
FT                   AGLGRVMPLEPEELEHNLDVLFEYNQLDNKQLQHVWVSGLDEGTIENLMQYAEQHQWSL
FT                   PKKRPLHMIDHSFGPTGEFIFPVSLAMLSEAAKETEQNHLIIYQSAQYAQKKSLCLITR
FT                   KLYLRT"
FT   gene            complement(524525..524785)
FT                   /locus_tag="UM146_02440"
FT   CDS_pept        complement(524525..524785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02440"
FT                   /product="hypothetical protein"
FT                   /note="COG4104 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69911"
FT                   /protein_id="ADN69911.1"
FT                   /translation="MPGIVCLGDATTHGGKVITATSTLFINGIQVALVGDLVSCPKHGV
FT                   NPIQEGDPTATEKGRNVVVNHCQCACGCRVISSQPENSIES"
FT   gene            complement(526319..528088)
FT                   /locus_tag="UM146_02455"
FT   CDS_pept        complement(526319..528088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69912"
FT                   /protein_id="ADN69912.1"
FT                   /translation="MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGK
FT                   SIWRYDDSMSLMGWSLPTSGPKERKRLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYP
FT                   EDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDRGWGEVANASYGSFLDVLQTALYR
FT                   DKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVHVVGYNWLGSNML
FT                   SAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGVL
FT                   PSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYG
FT                   EEWLNIVDRDGSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSL
FT                   NQKQIDTDWNIYENLITESVNPFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLW
FT                   KGSLSMGKKSDISLEPKFIDGRLDLNEVGNIRTIKDEFSPEEQAWEINTDDGDTYVKIG
FT                   QRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYRNPVSQAFALRSIIKIA
FT                   QEVKKDGKMSYSD"
FT   gene            complement(528108..530588)
FT                   /locus_tag="UM146_02460"
FT   CDS_pept        complement(528108..530588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02460"
FT                   /product="hypothetical protein"
FT                   /note="COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69913"
FT                   /protein_id="ADN69913.1"
FT                   /translation="MGIQNFDHSHHKLKIRGLKSPVDVLTFTGHEQLSSPFRYDIQFTS
FT                   SDKAIAPESVLMQDGAFSLTAPPVQGMPVQTALRTLHGVITGFKHLSSSQDEARYEVRL
FT                   EPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMRGQDFVFNLKSEYPAREQVMQYGE
FT                   DDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPLRHPSGLFDGETE
FT                   AVWGLNTAYSVVEKNVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQKG
FT                   DKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLIT
FT                   GVTASAARDRSYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDK
FT                   DGRYRVNLDFDRDAWKPGYESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRP
FT                   YIAGVKHDSAHTDHVTIQNYKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLG
FT                   HLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQVLDMTDALAQLREAQS
FT                   LVEALCSATEVAKAELADLQTQKVMMSEALEELKKSAMLLSAPEGIAQVTPKSLQLSAG
FT                   ENIISTSGKNSDFSVLKKFTVAAGETVSLFAQKLGIKIFAGKGKVEIQAQGDEMLLDAL
FT                   KDIRISSSEGRILISAKNEIILTSGGGYIRIGDGTVECAAPDKIIERGAVWQKFSGQSI
FT                   SQAMQQWDSADFAVTPEILWQQTGKPAKNQKVQVTRGDGSVVEMTTDEQGRLPIQSGLF
FT                   VESIKIDLPDSQEN"
FT   gene            complement(530600..533245)
FT                   /locus_tag="UM146_02465"
FT   CDS_pept        complement(530600..533245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02465"
FT                   /product="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69914"
FT                   /protein_id="ADN69914.1"
FT                   /translation="MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKL
FT                   LEQGEGDITVIARRYEWDIDTLWQSLLAHLDTLPRSVRERPQLSEPLTALIRQAWLIAS
FT                   LEGDDPQIRSQHLLMALTEKSMLPACNDLWVLLSLSRVQLERLRPLLDAQSDECPARQP
FT                   QVTEPLTSALPETATADAPAKTLTEKQDDALLAVLNRFTEDVTEKARSGRIDPVFGRDT
FT                   EIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRITEGNVPDSLKTVHIRTLDLGL
FT                   LQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPAL
FT                   ARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHG
FT                   VHMLDSAIQTAVRLSRRYLTGRQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLHARLAA
FT                   LDIEREAIEQDSVFYPEASPERLAELTDLRDELQAEAGHLEAQYQQEKALAQQIMTLRQ
FT                   EGTDSTELQQQLRTHQGFAPLLALDVDARAVATVVADWTGIPLSSLLRDEQSDLLSMEQ
FT                   SLENRVVGQRPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTGKTETALTLADTLF
FT                   GGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKA
FT                   HRDVMNLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLH
FT                   ELLYPLLRDHFQPALMARFQTVIYRPLGQEAMRTIVEMKLAQVVRRLHQHYGLETEIND
FT                   SLYDQLTAACLLPDTGARNIDSLLNQQILPVLSQQLLAQQAAHRKPAQLRLGWDEEDGI
FT                   VLEFATEEMQ"
FT   gene            complement(533437..533928)
FT                   /locus_tag="UM146_02470"
FT   CDS_pept        complement(533437..533928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02470"
FT                   /product="hypothetical protein"
FT                   /note="COG3157 Hemolysin-coregulated protein
FT                   (uncharacterized)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69915"
FT                   /protein_id="ADN69915.1"
FT                   /translation="MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDN
FT                   NTGKLTGTRTHKPFTFTKEIDASSPYLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNT
FT                   TLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYEKITWTYKDGNIIHSDSWNERPSA
FT                   "
FT   gene            complement(533986..535638)
FT                   /locus_tag="UM146_02475"
FT   CDS_pept        complement(533986..535638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02475"
FT                   /product="hypothetical protein"
FT                   /note="COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69916"
FT                   /protein_id="ADN69916.1"
FT                   /translation="MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAA
FT                   LLIYRRRQAWTEMTGDAGLSSLPPETYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHV
FT                   PDEEQLVAQVERLLTLRPAWASQLAVAYTIMPGIHRDVAVLAGRLRRFAHSMATVRRRA
FT                   GVNVPWLLWSGLSGSPLPERASSPWFICTGGEVQVATSTENAMPAQWIAQSGVQERSQR
FT                   LSYLLKAESLMQWLDLNVLAELNGPEAKCPPLAMAVGLVPSLPAVDNNLWQLWITARTG
FT                   LTPDIADTGTDDALPFPDALLRRLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATAN
FT                   RQLLRQVGDDLHRFYAVPVEEFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGE
FT                   RIRQPVLRAIRDWRPPEQKMEVTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALV
FT                   NIRAKPGWLILVAGYTDATGDEKSNQQLSLRRAEAVRNWMLQTSDIPATCFAVQGLGES
FT                   QPAATNDTPQGRAVNRRVEISLVPRSDACQDVK"
FT   gene            complement(535651..536316)
FT                   /locus_tag="UM146_02480"
FT   CDS_pept        complement(535651..536316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02480"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="COG3455 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69917"
FT                   /protein_id="ADN69917.1"
FT                   /translation="MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVEL
FT                   VRERLKDAGFSRENVEHITYAQCALLDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAG
FT                   ELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRYQDPAAPERDQLISTLNGQVAPFG
FT                   VLPETAVLNVPLSTRQHPLLHSPFFWLVTLALLLAGVWWGLHHWLNVLVDELLPQSLR"
FT   gene            complement(536313..537650)
FT                   /locus_tag="UM146_02485"
FT   CDS_pept        complement(536313..537650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02485"
FT                   /product="hypothetical protein"
FT                   /note="COG3522 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69918"
FT                   /protein_id="ADN69918.1"
FT                   /translation="MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDCIAQLCIRHPWGIA
FT                   NVLFDRDALTPGKLKTQAVRLRFADGTLIDSDVSDVLPLACDLRALKNDSAIVLLALPL
FT                   AHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSEDMAVERHALSLRFAHDNNQDYIT
FT                   CPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAKCQRLMAMRRESN
FT                   QRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLEH
FT                   NVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLR
FT                   EEADFYLSVRSSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVQLVPLTSVPAALPL
FT                   RLENQYFALDMHSDAAKSMLESGSCMIYAPGTMGDLKPELFAVLRT"
FT   gene            complement(537668..539206)
FT                   /locus_tag="UM146_02490"
FT   CDS_pept        complement(537668..539206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02490"
FT                   /product="hypothetical protein"
FT                   /note="COG3517 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69919"
FT                   /protein_id="ADN69919.1"
FT                   /translation="MSVQQEHSTSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLW
FT                   QNSETLADASPDERVTAAIHVLLSCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAV
FT                   MHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDISKEHLRQDFDDSPEIIQSGLYRH
FT                   TYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPFIGSVGPKFFLKN
FT                   SMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSFN
FT                   YVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLG
FT                   TGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATA
FT                   NSRINARLPYIFLLSRIAHYLKIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDE
FT                   LQASHPLRDGKVIVEDIEDNPGFFRVRLFAVPHFQIEGMDINLSLVSQMPKAKA"
FT   gene            complement(539265..539765)
FT                   /locus_tag="UM146_02495"
FT   CDS_pept        complement(539265..539765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02495"
FT                   /product="hypothetical protein"
FT                   /note="COG3516 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69920"
FT                   /protein_id="ADN69920.1"
FT                   /translation="MADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGK
FT                   EQRPLSERDKVDINKNNFNSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPE
FT                   QVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQ
FT                   ENV"
FT   gene            complement(540401..540477)
FT                   /locus_tag="UM146_t23829"
FT   tRNA            complement(540401..540477)
FT                   /locus_tag="UM146_t23829"
FT                   /product="tRNA-Met"
FT   gene            complement(540512..540588)
FT                   /locus_tag="UM146_t23831"
FT   tRNA            complement(540512..540588)
FT                   /locus_tag="UM146_t23831"
FT                   /product="tRNA-Met"
FT   gene            complement(540622..540698)
FT                   /locus_tag="UM146_t23833"
FT   tRNA            complement(540622..540698)
FT                   /locus_tag="UM146_t23833"
FT                   /product="tRNA-Met"
FT   gene            540907..542004
FT                   /gene="mltA"
FT                   /locus_tag="UM146_02500"
FT   CDS_pept        540907..542004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /locus_tag="UM146_02500"
FT                   /product="murein transglycosylase A"
FT                   /note="COG2821 Membrane-bound lytic murein
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69921"
FT                   /protein_id="ADN69921.1"
FT                   /translation="MKGRWVKYLLMGTVVAMLAACSSKPTDRGQQYKDGKFTQPFSLVN
FT                   QPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDA
FT                   WQMEGVDNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSD
FT                   KYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVK
FT                   KEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASD
FT                   RSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHR
FT                   AGWYNHYGRVWVLKTAPGAGNVFSG"
FT   gene            542081..542887
FT                   /locus_tag="UM146_02505"
FT   CDS_pept        542081..542887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02505"
FT                   /product="hypothetical protein"
FT                   /note="COG1179 Dinucleotide-utilizing enzymes involved in
FT                   molybdopterin and thiamine biosynthesis family 1"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69922"
FT                   /protein_id="ADN69922.1"
FT                   /translation="MSVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWA
FT                   AEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTV
FT                   VDDFVTPDNVAQYMNAGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQ
FT                   IQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSDGTVCAM
FT                   KATAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKMMAKAARQG"
FT   gene            complement(542938..543381)
FT                   /locus_tag="UM146_02510"
FT   CDS_pept        complement(542938..543381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02510"
FT                   /product="putative Fe-S metabolism protein (sufE-like)"
FT                   /note="COG2166 SufE protein probably involved in Fe-S
FT                   center assembly"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69923"
FT                   /protein_id="ADN69923.1"
FT                   /translation="MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLP
FT                   ALPEELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTA
FT                   AELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV"
FT   gene            complement(543381..544586)
FT                   /locus_tag="UM146_02515"
FT   CDS_pept        complement(543381..544586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02515"
FT                   /product="cysteine sulfinate desulfinase"
FT                   /note="COG0520 Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69924"
FT                   /protein_id="ADN69924.1"
FT                   /translation="MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATRQFYSL
FT                   SAGNVHRSQFAEAQRLTARYEAAREKVAQLLNASDDKNIVWTRGTTESINMVAQCYARP
FT                   RLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRI
FT                   LALGQMSNVTGGCPDLARAITFAHSAGIVVMVDGAQGAVHFPADVQQLDIDFYAFSGHK
FT                   LYGPTGIGVLYGKPELLEAMSPWLGGGKMVHEVSFDDFTTQSAPWKLEAGTPNVAGVIG
FT                   LSAALEWLTDYDINQAESWSRSLATLAEEALAKRPGFRSFRCLDSSLLAFDFAGVHHSD
FT                   MVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELL
FT                   VD"
FT   gene            544778..545005
FT                   /locus_tag="UM146_02520"
FT   CDS_pept        544778..545005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69925"
FT                   /protein_id="ADN69925.1"
FT                   /translation="MKKTAAIISACMLTFALSACSGSNYVMHTNDGRTIVSDGKPQTDN
FT                   DTGMISYKDANGNKQQINRTDVKEMVELDQ"
FT   gene            545356..546273
FT                   /locus_tag="UM146_02525"
FT   CDS_pept        545356..546273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02525"
FT                   /product="DNA-binding transcriptional activator GcvA"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69926"
FT                   /protein_id="ADN69926.1"
FT                   /translation="MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLE
FT                   DFLGLKLFRRRNRSLLLTEEGQSYFLDIKEIFSQLTEATRKLQARSAKGALTVSLLPSF
FT                   AIHWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAE
FT                   YLLPVCSPLLLTGEKPLKTPEDLAKHTLLHDASRRDWQTYTRQLGLNHINVQQGPIFSH
FT                   SAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKI
FT                   AAFRQWILAKAAAEQEKFRFRYEQ"
FT   gene            546292..546687
FT                   /locus_tag="UM146_02530"
FT   CDS_pept        546292..546687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02530"
FT                   /product="hypothetical protein"
FT                   /note="COG2363 Uncharacterized small membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69927"
FT                   /protein_id="ADN69927.1"
FT                   /translation="MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLE
FT                   YQAFHTLAILGLAVAMQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPV
FT                   GGVSFLAGWALMLIGAIRLKRKGVSHE"
FT   gene            546680..547780
FT                   /locus_tag="UM146_02535"
FT   CDS_pept        546680..547780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02535"
FT                   /product="putative RNA 2'-O-ribose methyltransferase"
FT                   /note="COG2933 Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69928"
FT                   /protein_id="ADN69928.1"
FT                   /translation="MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYE
FT                   CYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELR
FT                   VEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYS
FT                   YSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACP
FT                   GGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTCSNISWMVCDMVEK
FT                   PAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQ
FT                   LYHDREEVTVHVRRIWAAVGGRRDER"
FT   gene            complement(547824..548555)
FT                   /locus_tag="UM146_02540"
FT   CDS_pept        complement(547824..548555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02540"
FT                   /product="DNA-binding transcriptional activator FucR"
FT                   /note="COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69929"
FT                   /protein_id="ADN69929.1"
FT                   /translation="MKAARQQAIVDLLLNHTSLTTEALSEQLKVSKETIRRDLNELQTQ
FT                   GKILRNHGRAKYIHRQNQDSGDPFHIRLKSHYAHKADIAREALAWIEEGMVIALDASST
FT                   CWYLARQLPDINIQVFTNSHPICHELGKRERIKLISSGGTLERKYGCYVNPSLISQLKS
FT                   LEIDLFIFSCEGIDSSGALWDSNAINADYKSMLLKRAAQSLLLIDKSKFNRSGEARIGH
FT                   LDEVTHIISDERQVTTSLVTA"
FT   gene            complement(548613..549035)
FT                   /locus_tag="UM146_02545"
FT   CDS_pept        complement(548613..549035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02545"
FT                   /product="L-fucose mutarotase"
FT                   /note="COG4154 Fucose dissimilation pathway protein FucU"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69930"
FT                   /protein_id="ADN69930.1"
FT                   /translation="MLKTISPLISPELLKVLAEMGHGDEIIFSDAHFPAHSMGPQVIRA
FT                   DGLLVSDLLQAIIPLFELDSYAPPLVMMAAVEGDTLDPEVERRYRNALSLQAPCPDIIR
FT                   INRFAFYERAQKAFAIVITGERAKYGNILLKKGVTP"
FT   gene            complement(549037..550455)
FT                   /locus_tag="UM146_02550"
FT   CDS_pept        complement(549037..550455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02550"
FT                   /product="L-fuculokinase"
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69931"
FT                   /protein_id="ADN69931.1"
FT                   /translation="MKQEVILVLDCGATNVRAIAVNRQGKIVARASTPNASDIAMENNT
FT                   WHQWSLDAILQRFADCCRQINSELTDCHIRGIAVTTFGVDGALVDKQGNLLYPIISWKC
FT                   PRTAAVMDHIERLISAQQLQAISGVGAFSFNTLYKLVWLKENHPQLLERAHAWLFISSL
FT                   INHRLTGEFTTDITMAGTSQMLDIQQRDFSPQILQATGIPRRLFPRLVEAGEQIGTLQN
FT                   SAAAMLGLPVGIPVISAGHDTQFALFGAGAEQNEPVLSSGTWEILMVRSAQVDTSLLSQ
FT                   YAGSTCELDSQAGLYNPGMQWLASGVLEWVRKLFWTAETPWQILIEEARLIAPGADGVK
FT                   MQCDLLSCQNAGWQGVTLNTTRGHFYRAALEGLTTQLQRNLQMLEKIGHFKASELLLVG
FT                   GGSRNTLWNQIKANMLDIPVKVLDDAETTVAGAALFGWYGVGEFNSPEEARAQIHYQYR
FT                   YFYPQTEPEFIEEV"
FT   gene            complement(550564..552339)
FT                   /gene="fucI"
FT                   /locus_tag="UM146_02555"
FT   CDS_pept        complement(550564..552339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucI"
FT                   /locus_tag="UM146_02555"
FT                   /product="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /note="COG2407 L-fucose isomerase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69932"
FT                   /protein_id="ADN69932.1"
FT                   /translation="MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKL
FT                   RHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRP
FT                   KAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFA
FT                   RAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIY
FT                   DEAELEMALAWADKNFRYGEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLA
FT                   DIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVRKPFVVATENDS
FT                   LNGVAMLMGHQLTGTAQVFADVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALD
FT                   GSCKQRDSEGKPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPF
FT                   TMTRVNIIKGLGPVLQIAEGWSVELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDV
FT                   YSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEG
FT                   QDYRACQNYGPLYKR"
FT   gene            complement(552372..553688)
FT                   /locus_tag="UM146_02560"
FT   CDS_pept        complement(552372..553688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02560"
FT                   /product="L-fucose transporter"
FT                   /note="COG0738 Fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69933"
FT                   /protein_id="ADN69933.1"
FT                   /translation="MGNTSIQTQSYRAVDKDAGQSRSYIIPFALLCSLFFLWAVANNLN
FT                   DILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYAFG
FT                   AALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNS
FT                   FGAIIAVVFGQSLILSNVPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLV
FT                   ALLIMLTKFPALQSDNHSDAKQGSFSASLSRLARIRHWRWAVLAQFCYVGAQTACWSYL
FT                   IRYAVEEIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISRFAPHKVLAAYALIAMALCL
FT                   ISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNLGQDTKYGSSFIVMTIIGGGIVTP
FT                   VMGFVSDAAGNIPTAELLPALCFAVIFIFARFRSQTATN"
FT   gene            554235..554882
FT                   /locus_tag="UM146_02565"
FT   CDS_pept        554235..554882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02565"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /note="COG0235 Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69934"
FT                   /protein_id="ADN69934.1"
FT                   /translation="MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGI
FT                   PYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSIL
FT                   NRPIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEAN
FT                   LEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE"
FT   gene            554910..556058
FT                   /locus_tag="UM146_02570"
FT   CDS_pept        554910..556058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02570"
FT                   /product="L-1,2-propanediol oxidoreductase"
FT                   /note="COG1454 Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69935"
FT                   /protein_id="ADN69935.1"
FT                   /translation="MANRMILNETAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCG
FT                   VVAKVIDKMDAAGLAWAIYDGVVPNPTITVVKEGLDVFQNSGADYLIAIGGGSPQDTCK
FT                   AIGIISNNPEFADVRSLEGLSPTNKPSVPILAIPTTAGTAAEVTINYVITDEEKRRKFV
FT                   CVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIE
FT                   IIAGALRGTVAGDKDAGEEMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANA
FT                   ILLPHVMRYNADFTGEKYRDIARVMGVKVEGMSLEEARNAAVEAVFALNRDVGIPPHLR
FT                   DVGVRKEDIPALAQAALDDVCTGGNPREATLEDIVELYHTAW"
FT   gene            complement(556163..556918)
FT                   /gene="xni"
FT                   /locus_tag="UM146_02575"
FT   CDS_pept        complement(556163..556918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xni"
FT                   /locus_tag="UM146_02575"
FT                   /product="exonuclease IX"
FT                   /note="COG0258 5'-3' exonuclease (including N-terminal
FT                   domain of PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69936"
FT                   /protein_id="ADN69936.1"
FT                   /translation="MAVHLLIVDALNLIRRIHAVQGSPCVETCQHALDQLIMHSQPTHA
FT                   VAVFDDENRSSGWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEAD
FT                   DLAATLAVKVTQAGHQATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQ
FT                   QLPDYWGLAGISSSKVPGVAGIGPKSATQLLVEFQSLEGIYENLDAVAEKWRKKLETHK
FT                   EMAFLCRDIARLQTDLHIDGNLQQLRLVR"
FT   gene            complement(557030..558397)
FT                   /locus_tag="UM146_02580"
FT   CDS_pept        complement(557030..558397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02580"
FT                   /product="L-serine deaminase II"
FT                   /note="COG1760 L-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69937"
FT                   /protein_id="ADN69937.1"
FT                   /translation="MISVFDIFKIGIGPSSSHTVGPMKAGKQFTDDLIARNLLKDVTRV
FT                   VVDVYGSLSLTGKGHHTDIAIIMGLAGNLPDTVDIDSIPGFIQDVNTHGRLMLANGQHE
FT                   VEFPVDQCMNFHADNLSLHENGMRITALAGDKVVYSQTYYSIGGGFIVDEEHFGQQDSA
FT                   PVEVPYPYSSAADLQKHCQETGLSLSGLMMKNELALHSKEELEQHLANVWEVMRGGIER
FT                   GISTEGVLPGKLRVPRRAAALRRMLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGRV
FT                   VTAPTNGACGIIPAVLAYYDKFIREVNANSLARYLLVASAIGSLYKMNASISGAEVGCQ
FT                   GEVGVACSMAAAGLAELLGASPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIA
FT                   AVKAVNAARMALRRTSEPRVCLDKVIETMYETGKDMNAKYRETSRGGLAMKIVACD"
FT   gene            complement(558455..559744)
FT                   /locus_tag="UM146_02585"
FT   CDS_pept        complement(558455..559744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02585"
FT                   /product="serine transporter"
FT                   /note="COG0814 Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69938"
FT                   /protein_id="ADN69938.1"
FT                   /translation="METTQTSTIASKDSRSAWRKTDTMWMLGLYGTAIGAGVLFLPINA
FT                   GVGGMIPLIIMAILAFPMTFFAHRGLTRFVLSGKNPGEDITEVVEEHFGIGAGKLITLL
FT                   YFFAIYPILLVYSVAITNTVESFMSHQLGMTPPPRAILSLILIVGMMTIVRFGEQMIVK
FT                   AMSILVFPFVGVLMLLALYLIPQWNGAALETLSLDTASATGNGLWMTLWLAIPVMVFSF
FT                   NHSPIISSFAVAKREEYGDMAEQKCSKILAFAHIMMVLTVMFFVFSCVLSLTPADLAAA
FT                   KEQNISILSYLANHFNAPIIAWMAPIIAIIAITKSFLGHYLGAREGFNGMVIKSLRGKG
FT                   KSIEINKLNRITALFMLVTTWIVATLNPSILGMIETLGGPIIAMILFLMPMYAIQKVPA
FT                   MRKYSGHISNVFVVVMGLIAISAIFYSLFS"
FT   gene            complement(560301..561665)
FT                   /locus_tag="UM146_02590"
FT   CDS_pept        complement(560301..561665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02590"
FT                   /product="hypothetical protein"
FT                   /note="COG1611 Predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69939"
FT                   /protein_id="ADN69939.1"
FT                   /translation="MITHISPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSG
FT                   SLTDNSKELLSRFENFDINVLRRERGVKLELINPPEEAFVDGRIIRALQANLFAVLRDI
FT                   LFVYGQIHNTVRFPNLNLDNSVHITNLVFSILRNARALHVGEAPNMVVCWGGHSINENE
FT                   YLYARRVGNQLGLRELNICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAA
FT                   EPPNPLVNELIIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPANKDQV
FT                   LPLILTGPKESADYFRVLDEFVVHTLGENARRHYRIIIDDAAEVARQMKKSMPLVKENR
FT                   RDTGDAYSFNWSMRIAPDLQMPFEPSHENMANLKLYPDQPVEVLAADLRRAFSGIVAGN
FT                   VKEVGIRAIEEFGPYKINGDKEIMRRMDDLLQGFVAQHRMKLPGSAYIPCYEICT"
FT   gene            complement(561777..562625)
FT                   /gene="queF"
FT                   /locus_tag="UM146_02595"
FT   CDS_pept        complement(561777..562625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="UM146_02595"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="COG2904 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69940"
FT                   /protein_id="ADN69940.1"
FT                   /translation="MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLK
FT                   ADNLPFHGTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTR
FT                   FNNWDEVRQTLERDLSTCAQGKVSVALYRLDELEGQPIGHFNGTCIDDQDITIDNYEFT
FT                   TDYLENATSGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGRQIDREKLLRYLVSF
FT                   RHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLVR
FT                   Q"
FT   gene            562693..563238
FT                   /locus_tag="UM146_02600"
FT   CDS_pept        562693..563238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02600"
FT                   /product="SecY interacting protein Syd"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69941"
FT                   /protein_id="ADN69941.1"
FT                   /translation="MDDLTAQALKDFTARYCDAWHEEHKSWPLSEELYGVPSPCIISTT
FT                   EDAVYWQPQPFTGEQNVNAVERAFDIVIQPTIHTFYTTQFAGDMHAQFGDIKLTLLQTW
FT                   SEDDFRRVQENLIGHLVTQKRLKLPPTLFIATLEEELEVISVCNLSGEVCKETLGTRKR
FT                   THLASNLAEFLNQLKPLL"
FT   gene            563488..563613
FT                   /locus_tag="UM146_02605"
FT   CDS_pept        563488..563613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69942"
FT                   /protein_id="ADN69942.1"
FT                   /translation="MTLLKDTPGWCFRERLLDEAKRMTQDALKDTSRMENENRSG"
FT   gene            563860..564189
FT                   /locus_tag="UM146_02610"
FT   CDS_pept        563860..564189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02610"
FT                   /product="hypothetical protein"
FT                   /note="COG3098 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69943"
FT                   /protein_id="ADN69943.1"
FT                   /translation="MTTHDRVRLQLQALEALLREHQHWRNDEPLPHQFASTQPFFMDTM
FT                   EPLEWLQWVLIPRMHDLLDNNQPLPGAFAVAPYYEMALATDHPQRALILAELEKLDALF
FT                   ADDAS"
FT   gene            564189..564971
FT                   /locus_tag="UM146_02615"
FT   CDS_pept        564189..564971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02615"
FT                   /product="tRNA pseudouridine synthase C"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69944"
FT                   /protein_id="ADN69944.1"
FT                   /translation="MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDLIGQ
FT                   HVFTAHRLDRPTSGVLLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPL
FT                   VEELDKIADKFAREDKGPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQ
FT                   LRRHLAHLRHPIIGDSKHGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAG
FT                   LDDTWMQALSQFGWRGLLPENERVEFSAPSGQDGEISS"
FT   gene            564989..565438
FT                   /locus_tag="UM146_02620"
FT   CDS_pept        564989..565438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02620"
FT                   /product="flavodoxin"
FT                   /note="COG0716 Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69945"
FT                   /protein_id="ADN69945.1"
FT                   /translation="MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWL
FT                   PYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNFCNGG
FT                   KQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTMLS"
FT   gene            565872..567224
FT                   /locus_tag="UM146_02625"
FT   CDS_pept        565872..567224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02625"
FT                   /product="putative D-glucarate transporter GudP"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69946"
FT                   /protein_id="ADN69946.1"
FT                   /translation="MSSLSQAASSVEKRTNARYWIVVMLFIVTSFNYGDRATLSIAGSE
FT                   MAKDIGLDPVGMGYVFSAFSWAYVIGQIPGGWLLDRFGSKRVYFWSIFIWSMFTLLQGF
FT                   VDIFSGFGIIVALFTLRFLVGLAEAPSFPGNSRIVAAWFPAQERGTAVSIFNSAQYFAT
FT                   VIFAPIMGWLTHEVGWSHVFFFMGGLGIVISFIWLKVIHEPNQHPGVNQKELEYIAAGG
FT                   ALINMDQQNTKVKVPFSVKWGQIKQLLGSRMMIGVYIGQYCINALTYFFITWFPVYLVQ
FT                   ARGMSILKAGFVASVPAVCGFIGGVLGGIISDWLMRRTGSLNIARKTPIVMGMLLSMVM
FT                   VFCNYVNVEWMIIGFMALAFFGKGIGALGWAVMADTAPKEISGLSGGLFNMFGNISGIV
FT                   TPIAIGYIVGTTGSFNGALIYVGVHALIAVLSYLVLVGDIKRIELKPVAGQ"
FT   gene            567226..568566
FT                   /locus_tag="UM146_02630"
FT   CDS_pept        567226..568566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02630"
FT                   /product="glucarate dehydratase"
FT                   /note="COG4948 L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69947"
FT                   /protein_id="ADN69947.1"
FT                   /translation="MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDN
FT                   AGHTGIGEAPGGEVIYQTLVKAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWT
FT                   FELRVNAVAALEAALLDLLGQALNVPVCELLGPGKQRDAITVLGYLFYIGDRTKTDLPY
FT                   LENTPGNHEWYQLRHQKAMNSEAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRAL
FT                   KKRFPDARITVDPNGAWLLDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRAT
FT                   GLPVATNMIATNWREMGHAVMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSN
FT                   NHFDISLAMFTHVGAAAPGNPTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGV
FT                   ELDWEQVQKAHEAYKRLPGGARNDAGPMQYLIPGWTFDRKRPVFGRH"
FT   gene            568587..569927
FT                   /locus_tag="UM146_02635"
FT   CDS_pept        568587..569927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02635"
FT                   /product="(D)-glucarate dehydratase 1"
FT                   /note="COG4948 L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69948"
FT                   /protein_id="ADN69948.1"
FT                   /translation="MSSQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKD
FT                   NSGHTGVGEIPGGEKIRKTLEDAIPLVVGKTLGEYKNVLTLVRNTFADRDAGGRGLQTF
FT                   DLRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLP
FT                   YQSQPDDSCDWYRLRHEEAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVA
FT                   LAQRFPQARITLDPNGAWSLKEAIKIGTYLKGSLAYAEDPCGAEQGFSGREVMAEFRRA
FT                   TGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHS
FT                   NNHFDISLAMFTHVAAAAPGKITAIDTHWIWQEGNQRLTKEPLEIKGGLVQVPEKPGLG
FT                   VEIDMDQVMKAHELYQKHGLGARDDAMGMQYLIPGWTFDNKRPCMVR"
FT   gene            complement(570158..572914)
FT                   /locus_tag="UM146_02640"
FT   CDS_pept        complement(570158..572914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02640"
FT                   /product="hybrid sensory histidine kinase BarA"
FT                   /EC_number="2.7.13.3"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69949"
FT                   /protein_id="ADN69949.1"
FT                   /translation="MTNYSLRARMMILILAPTVLIGLLLSIFFVVHRYNDLQRQLEDAG
FT                   ASIIEPLAVSTEYGMSLQNRESIGQLISVLHRRHSDIVRAISVYDENNRLFVTSNFHLD
FT                   PSSMQLGSNVPFPRQLTVTRDGDIMILRTPIISESYSPDESPSSDAKNSQNMLGYIALE
FT                   LDLKSVRLQQYKEIFISSVMMLFCIGIALIFGWRLMRDVTGPIRNMVNTVDRIRRGQLD
FT                   SRVEGFMLGELDMLKNGINSMAMSLAAYHEEMQHNIDQATSDLRETLEQMEIQNVELDL
FT                   AKKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLKTELTPTQRDHLNTIERSANN
FT                   LLAIINDVLDFSKLEAGKLILESIPFPLRSTLDEVVTLLAHSSHDKGLELTLNIKSDVP
FT                   DNVIGDPLRLQQIITNLVGNAIKFTENGNIDILVEKRALSNTKVQIEVQIRDTGIGIPE
FT                   RDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSLPNRGSTFWFHIN
FT                   LDLNPNIIIEGPSTQCLAGKRLAYVEPNSAAAQCTLDILSETPLEVVYSPTFSALPPAH
FT                   YDMMLLGIAVTFREPLTMQHERLAKAVSMTDFLMLALPCHAQVNAEKLKQDGIGACLLK
FT                   PLTPTRLLPALTEFCHHKQNTLLPVTDESKLAMTVMAVDDNPANLKLIGALLEDMVQHV
FT                   ELCDSGHQAVERAKQMPFDLILMDIQMPDMDGIRACELIHQLPHQQQTPVIAVTAHAMA
FT                   GQKEKLLGAGMSDYLAKPIEEERLHNLLLRYKPGSGISSRVVTPEVNEIVVNPNATLDW
FT                   QLALRQAAGKTDLARDMLQMLLDFLPEVRNKVEEQLVGENPEGLVDLIHKLHGSCGYSG
FT                   VPRMKNLCQLIEQQLRSGTKEEDLEPELLELLDEMDNVAREASKILG"
FT   gene            572971..574272
FT                   /gene="rumA"
FT                   /locus_tag="UM146_02645"
FT   CDS_pept        572971..574272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="UM146_02645"
FT                   /product="23S rRNA 5-methyluridine methyltransferase"
FT                   /note="COG2265 SAM-dependent methyltransferases related to
FT                   tRNA (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69950"
FT                   /protein_id="ADN69950.1"
FT                   /translation="MAQFYSAKRRTTTRQIITVSVNDLDSFGQGVARHNGKTLFIPGLL
FT                   PQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRSK
FT                   SAALARLMKHEVSEVIADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCP
FT                   ILVPQLEALLPKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLECF
FT                   SHSEGLDLYLAPDSEILETVSGEMPWYDSNGLRLTFSPRDFIQVNAGVNQKMVARALEW
FT                   LDVEPEDCVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYH
FT                   ENLEEDVTKQPWAKNGFDKVLLDPARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSE
FT                   ALLKAGYTIARLAMLDMFPHTGHLESMVLFSRVK"
FT   gene            574320..576554
FT                   /gene="relA"
FT                   /locus_tag="UM146_02650"
FT   CDS_pept        574320..576554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="UM146_02650"
FT                   /product="GDP/GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69951"
FT                   /protein_id="ADN69951.1"
FT                   /translation="MVAVRSAHINKAGEFDPEKWIASLGITSQKSCECLAETWAYCLQQ
FT                   TQGHPDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVV
FT                   NLIHGVRDMAAIRQLKATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREV
FT                   KDAPEDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPTEYKRIAKLLHERR
FT                   LDREHYIEEFVGHLRAEMKAEGVKAEVYGRPKHIYSIWRKMQKKNLAFDELFDVRAVRI
FT                   VAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRT
FT                   KQMHEDAELGVAAHWKYKEGAAAGGARSGHEDRIAWLRKLIAWQEEMADSGEMLDEVRS
FT                   QVFDDRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMG
FT                   DQIEIITQKQPNPSRDWLNPNLGYVTTSRGRSKIHAWFRKQDRDKNILAGRQILDDELE
FT                   HLGISLKEAEKHLLPRYNFNDVDELLAAIGGGDIRLNQMVNFLQSQFNKPSAEEQDAAA
FT                   LKQLQQKSYTPQNRSKDNGRVVVEGVGNLMHHIARCCQPIPGDEIVGFITQGRGISVHR
FT                   ADCEQLAELRSHAPERIVDAVWGESYSAGYSLVVRVVANDRSGLLRDITTILANEKVNV
FT                   LGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIGARRLHGS"
FT   gene            576632..576880
FT                   /locus_tag="UM146_02655"
FT   CDS_pept        576632..576880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02655"
FT                   /product="antitoxin MazE"
FT                   /note="COG2336 Growth regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69952"
FT                   /protein_id="ADN69952.1"
FT                   /translation="MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIE
FT                   PVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW"
FT   gene            576880..577215
FT                   /locus_tag="UM146_02660"
FT   CDS_pept        576880..577215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02660"
FT                   /product="toxin ChpA"
FT                   /note="COG2337 Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69953"
FT                   /protein_id="ADN69953.1"
FT                   /translation="MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGM
FT                   CLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKA
FT                   KINVLIG"
FT   gene            577287..578078
FT                   /gene="mazG"
FT                   /locus_tag="UM146_02665"
FT   CDS_pept        577287..578078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazG"
FT                   /locus_tag="UM146_02665"
FT                   /product="nucleoside triphosphate pyrophosphohydrolase"
FT                   /EC_number="3.6.1.19"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69954"
FT                   /protein_id="ADN69954.1"
FT                   /translation="MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLD
FT                   AIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSS
FT                   AENSSEVLARWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLG
FT                   PVVDKVYEEIDEVMYEARQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEK
FT                   FERRFREVERIVAARGLEMTGVDLETMEEVWQQVKRQEIDL"
FT   gene            578306..579943
FT                   /gene="pyrG"
FT                   /locus_tag="UM146_02670"
FT   CDS_pept        578306..579943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="UM146_02670"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /note="COG0504 CTP synthase (UTP-ammonia lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69955"
FT                   /protein_id="ADN69955.1"
FT                   /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYI
FT                   NVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKER
FT                   RGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVE
FT                   IGREHTLFMHLTLVPYMAASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERA
FT                   KIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIF
FT                   EEANPVSEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEI
FT                   LKGLDAILVPGGFGYRGVEGMITTARFARENNIPYLGICLGMQVALIDYARHVANMENA
FT                   NSTEFVPDCKYPVVALITEWRDENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLY
FT                   NAPTIVERHRHRYEVNNMLLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPE
FT                   FTSTPRDGHPLFAGFVKAASEFQKRQAK"
FT   gene            580031..581329
FT                   /gene="eno"
FT                   /locus_tag="UM146_02675"
FT   CDS_pept        580031..581329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="UM146_02675"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COG0148 Enolase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69956"
FT                   /protein_id="ADN69956.1"
FT                   /translation="MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKS
FT                   KFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEA
FT                   LAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELT
FT                   KQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSIL
FT                   IKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSR
FT                   SDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA"
FT   gene            complement(581389..582294)
FT                   /locus_tag="UM146_02680"
FT   CDS_pept        complement(581389..582294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02680"
FT                   /product="hypothetical protein"
FT                   /note="COG1512 Beta-propeller domains of methanol
FT                   dehydrogenase type"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69957"
FT                   /protein_id="ADN69957.1"
FT                   /translation="MVIVMRLIFILFTLWCLPGLAQQIAVPELRQQVTDITGTLSTSEQ
FT                   QSLTQQLQDITHKTRAQVAVLVVPSTGDDSIEQYATRVFDSWKLGDKQRNDGILLLVAW
FT                   EDHAVRIEVGYGLEGVVTDLQAAKIIRDILIPAFKSDDLMGGLTLASENIGALLLNGEL
FT                   PEDRGDYYSINPPIPLSLAVIILLAVLSYFIVFTDPSNLPWITLTGAIYGMVFLYVAEP
FT                   GPWTNLIVACGMLTPFAIVPLVVFWLIVNKKLRAKYKKLSKERASRKGSSSSSSGGGSS
FT                   GGGFSGGGGSSGGGGASGRW"
FT   gene            complement(582288..583436)
FT                   /locus_tag="UM146_02685"
FT   CDS_pept        complement(582288..583436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02685"
FT                   /product="hypothetical protein"
FT                   /note="COG1512 Beta-propeller domains of methanol
FT                   dehydrogenase type"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69958"
FT                   /protein_id="ADN69958.1"
FT                   /translation="MRIFLLLLMLCGFQVFAERLPSVTDLTGTLTTEEQSALNQQLQTL
FT                   EQQNHFQVAVLVTPTTGGKNIKLAASQRYGVYHWKPVGEKRYGEGILILVVWPEGLASM
FT                   KIGHGLEQMLPPEQAAQIVRYHMQPEFEKNNLFAGLTGGIESIAQFTHIKANLSPLDAL
FT                   ANHLFANPQLSLPCLAWTVLMIVAIIVLWRFTSRPGPGIWMISMITPTVWFFCFQDDVI
FT                   IRRVSVVCFSLFFAAICWQRLTVVFNMCRVFPMMLAPKNKNAKVKKQKKTPQVRESGRN
FT                   SLFVVMLIIIVGWCLVFASNKDIAFISTIIGLIDHFIGPITIAGIVLLIIVAKFTGNLK
FT                   LGSGEKSNRKTGNRNAHSRSSSRNSFRGGGGSSGGGGSSGRW"
FT   gene            complement(583451..584260)
FT                   /locus_tag="UM146_02690"
FT   CDS_pept        complement(583451..584260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02690"
FT                   /product="hypothetical protein"
FT                   /note="COG1512 Beta-propeller domains of methanol
FT                   dehydrogenase type"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69959"
FT                   /protein_id="ADN69959.1"
FT                   /translation="MNDLTGTLTNSEVNTLTNQIKALTQKNHAQLVVLVVDTTGDETIE
FT                   QYATRVFDSWKPGDKDRDDGVLLLVAWQDHTVRIEIGYGLEGIITDAQSGKIIRNSIIP
FT                   AFKKGDLAGGLQKGINDIESRLTGNNSATITPTDHPLSFSGWWALLVWAIILTFISARG
FT                   YIKTLGVICFAAIVLAFVLPIAGFSGSWGVLTTLLCFATPFLAVAIAFTPFGKKVRDSM
FT                   RDANQPSRHTRSNSSSHYSSSSSSSFDNDNFSGGGGSSGGGGASGRW"
FT   gene            complement(584358..584972)
FT                   /locus_tag="UM146_02695"
FT   CDS_pept        complement(584358..584972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02695"
FT                   /product="hypothetical protein"
FT                   /note="COG1704 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69960"
FT                   /protein_id="ADN69960.1"
FT                   /translation="MFRIFIAFIFIFNLSGCGYNDIQTYDEQVNASWSEVLNQYQRRTD
FT                   LIPNLVASIKGYSSHEQEVLEAVTLARSQANRASSDLQKTPGDEQKLQAWQQAQAQAQA
FT                   QVTRTLGQLTIISERYPQLKAQELYQNLMVQLEGSENRIAVARGRYIKAIEQYNVTIRK
FT                   FPAVLTAKVMDYTPKKNYLPDDVTAVSKAPTIDFSQNANAH"
FT   gene            585145..585816
FT                   /locus_tag="UM146_02700"
FT   CDS_pept        585145..585816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02700"
FT                   /product="hypothetical protein"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69961"
FT                   /protein_id="ADN69961.1"
FT                   /translation="MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWE
FT                   KLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPL
FT                   TDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVG
FT                   RVRDIEALDELLATLTDDKPRVIALQPISQKEDATRLCIDTCIARNWRLSMQTHKYLNI
FT                   A"
FT   gene            complement(586290..587768)
FT                   /locus_tag="UM146_02705"
FT   CDS_pept        complement(586290..587768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02705"
FT                   /product="putative kinase"
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69962"
FT                   /protein_id="ADN69962.1"
FT                   /translation="MSKKYIIGIDGGSQSTKVVMYDLEGNVVCEGKGLLQPMHTPDADT
FT                   AEHPDDDLWASLCFAGHDLMSQFAGNKEDIVGIGLGSIRCCRALLKADGTPAAPLISWQ
FT                   DARVTRPYEHTNPDVAYVTSFSGYLTHRLTGEFKDNIANYFGQWPVDYKTWAWSEDAAV
FT                   MEKFNIPRQMLFDVQMPGTILGHITPQAALATHFPAGLPVVCTTSDKPVEALGAGLLDD
FT                   ETAVISLGTYIALMMNGKALPKDPVAYWPIMSSIPQTLLYEGYGIRKGMWTVSWLRDML
FT                   GESLIQDAKAQDLSPEDLLNKKASCVPPGCNGLMTVLDWLTNPWEPYKRGIMIGFDSSM
FT                   DYAWIYRSILESVALTLKNNYDNMCHEMNHFAKHVIITGGGSNSDLFMQIFADVFNLPA
FT                   RRNAINGCASLGAAINTAVGLGLYPDYATAVDKMVRVKDIFMPVENNAKRYDAMNKGIF
FT                   KELTKHTDVILKKSYEVMHGELGNADSIQSWSNA"
FT   misc_feature    complement(587795..589071)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218690894|ref|YP_002399106.1| putative transporter"
FT   gene            589390..590175
FT                   /locus_tag="UM146_02720"
FT   CDS_pept        589390..590175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02720"
FT                   /product="putative deoxygluconate dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69963"
FT                   /protein_id="ADN69963.1"
FT                   /translation="MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANV
FT                   FIPSFVKDNGETKEMIEKQGVEVDFMQVDITAEGAPQKIIAACCERFGTVDILVNNAGI
FT                   CKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWS
FT                   PAYSATKHALAGFTKAYCDELGQYNIQVNGISPGYYATDITLATRSNPETNQRVLDYIP
FT                   ANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGGYLVR"
FT   gene            590245..591699
FT                   /locus_tag="UM146_02725"
FT   CDS_pept        590245..591699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02725"
FT                   /product="putative FAD containing dehydrogenase"
FT                   /note="COG0277 FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69964"
FT                   /protein_id="ADN69964.1"
FT                   /translation="MSLSRAAIVDQLKEIVGADRVITDETVLKKNSIDRFRKFPDIHGI
FT                   YTLPIPAAVVKLGSTEQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSA
FT                   MNQIINIDIENMQATAQCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQ
FT                   FSTLYGAIEDMVVGLEAVLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVK
FT                   IFKFTPENNLFYGYVLEDMKTGFNILREIMVEGYRPSIARLYDAEDGTQHFTHFADGKC
FT                   VLIFMAEGNPRIAKATGEGIAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQI
FT                   LKTGNMGFTTEVSGCWSCIHEIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYF
FT                   VYDYNVVDCKPEEEIDKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAW
FT                   ALLEGLKKQFDPNGIMNTGTIYPIEK"
FT   gene            591793..593130
FT                   /locus_tag="UM146_02730"
FT   CDS_pept        591793..593130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02730"
FT                   /product="putative transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69965"
FT                   /protein_id="ADN69965.1"
FT                   /translation="MNTSPVRMDDLPLNRFHCRIAALTFGAHLTDGYVLGVIGYAIIQL
FT                   TPAMQLTPFMAGMIGGSALLGLFLGSLVLGWISDHIGRQKIFTFSFMLITLASFLQFFA
FT                   TTPEHLIGLRILIGIGLGGDYSVGHTLLAEFSPRRHRGVLLGAFSVVWTVGYVLASIAG
FT                   HHFISESPEAWRWLLASAALPALLITLLRWGTPESPRWLLRQGRFAEAHAIVHRYFGPH
FT                   VLLGDEVATATHKHIKTLFSSRYWRRTAFNSVFFVCLVIPWFVIYTWLPTIAQTIGLED
FT                   ALTASLMLNALLIVGALLGLVLTHLLAHRRFLLGSFLLLTATLVVMACLPSGSSLTLLL
FT                   FVLFSTTISAVSNLVGILPAESFPTDIRSLGVGFATAMSRLGAAVSTGLLPWVLAQWGM
FT                   QATLLLLAAVLLVGFVVTWLWAPETKALPLVAAGNAGGANEHTVSV"
FT   misc_feature    593108..593886
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|117624997|ref|YP_853985.1| putative electron transfer
FT                   flavoprotein subunit YgcR"
FT   gene            593883..594743
FT                   /locus_tag="UM146_02745"
FT   CDS_pept        593883..594743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02745"
FT                   /product="putative flavoprotein"
FT                   /note="COG2025 Electron transfer flavoprotein, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69966"
FT                   /protein_id="ADN69966.1"
FT                   /translation="MNIAIVTINQEHAAMAGWLAAQDFSGSTLTHWQIEPQPMVAEQVL
FT                   DALVEQWQRTPAEVVLFPPGAFGDELSTRLAWRLHGASICQVTSLDIPTVSVRKSHWGN
FT                   ALTATLQTEKRPLCLSLARQAGADKNATLPSGMQQLNIVPGALPDWLISVENLKNVTRD
FT                   PLAEARRVLVVGQGGEADNQEIAMLAEKMGAEVGYSRARVMNGGVDAEKVIGISGHLLA
FT                   PEVCIVVGASGAAALMAGVRNSKFVVAINHDASAAVFSQADVGVVDDWKVVLEALVTNI
FT                   HADCQ"
FT   gene            complement(594891..595466)
FT                   /locus_tag="UM146_02750"
FT   CDS_pept        complement(594891..595466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02750"
FT                   /product="putative anti-terminator regulatory protein"
FT                   /note="COG1954 Glycerol-3-phosphate responsive
FT                   antiterminator (mRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69967"
FT                   /protein_id="ADN69967.1"
FT                   /translation="MPLLHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISN
FT                   IVKKIKNAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFC
FT                   IHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEE
FT                   DARNAINAGVVALSTTNTGVWTLAKKLL"
FT   gene            complement(595483..595743)
FT                   /locus_tag="UM146_02755"
FT   CDS_pept        complement(595483..595743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02755"
FT                   /product="ferredoxin-like protein YgcO"
FT                   /note="COG2440 Ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69968"
FT                   /protein_id="ADN69968.1"
FT                   /translation="MSVARNLWRAADAPHIVPADSVERQTAQRLINACPAGLFSLTPEG
FT                   GLRVDYHGCLECGTCRLLCDESTLQQWRYPPSGFGITYRFG"
FT   gene            complement(595734..597005)
FT                   /locus_tag="UM146_02760"
FT   CDS_pept        complement(595734..597005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02760"
FT                   /product="putative oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /note="COG0644 Dehydrogenases (flavoproteins)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69969"
FT                   /protein_id="ADN69969.1"
FT                   /translation="MEDDCDIIIIGAGIAGTACALRCARAGLSVLLLERAEIPGSKNLS
FT                   GGRLYTHALAELLPQFHLTAPLERRITHESLSLLTPDGATTFSSLQPGGESWSVLRARF
FT                   DPWLVAEAEKEGVECIPGATVDALYEENGRVCGVICGDDILRARYVVLAEGANSVLAER
FT                   HGLVTRPAGEAMALGIKEVLTLEPSAIEERFHLENNEGAALLFSGGICDDLPGGAFLYT
FT                   NQQTLSLGIVCPLSSLTQSRVPASELLARFKTHPAVRPLIKNTESLEYGAHLVPEGGLR
FT                   SMPVQYAGNGWLLVGDALRSCVNTGISVRGMDMALTGAQAAAQTLISACQHREPQNLFP
FT                   LYHHNVERSLLWDVLQRYQHVPALLQRPGWYRVWSGLMQDISRDLWDQGNTPVPPLRQL
FT                   LWRHLRRHGLWHLTGDVIKSLRCL"
FT   gene            complement(597083..597445)
FT                   /locus_tag="UM146_02765"
FT   CDS_pept        complement(597083..597445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02765"
FT                   /product="putative 6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /note="COG0720 6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69970"
FT                   /protein_id="ADN69970.1"
FT                   /translation="MSTTLFKDFTFEAAHRLPHVPQGHKCGRLHGHSFMVRLEITGEVD
FT                   PHTGWIIDFAELKAAFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSA
FT                   VMVKETCTAGCIYRGE"
FT   gene            597764..599563
FT                   /gene="cysJ"
FT                   /locus_tag="UM146_02770"
FT   CDS_pept        597764..599563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="UM146_02770"
FT                   /product="sulfite reductase subunit alpha"
FT                   /note="COG0369 Sulfite reductase, alpha subunit
FT                   (flavoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69971"
FT                   /protein_id="ADN69971.1"
FT                   /translation="MTTQVPPSALLPLNPEQLARLQAATTDLTPTQLAWVSGYFWGVLN
FT                   QQPAALAATPAPAAEMPGITIISASQTGNARRVAEALRDDLLAAKLNVKLVNAGDYKFK
FT                   QIASEKLLIVVTSTQGEGEPPEEAVALHKFLFSKKAPKLENTAFAVFSLGDSSYEFFCQ
FT                   SGKDFDSKLAELGGERLLDRVDADVEYQAAASEWRARVVDALKSRAPVAAPSQSVATGT
FT                   VNEIHTSPYSKDAPLAASLSVNQKITGRNSEKDVRHIEIDLGDSGLRYQPGDALGVWYQ
FT                   NDPALVKELVELLWLKGDEPVTVEGKTLPLNEALQWHFELTVNTANIVENYATLTRSET
FT                   LLPLVGDKAKLQHYAATTPIVDMVRFSPAQLDAEALINLLRPLTPRLYSIASSQAEVEN
FT                   EVHVTVGVVRYDVEGRARAGGASSFLADRVEEEGEVRVFIEHNDNFRLPTNPETPVIMI
FT                   GPGTGIAPFRAFMQQRAADEAPGKNWLFFGNPHFTEDFLYQVEWQRYVKEGVLTRIDLA
FT                   WSRDQKEKIYVQDKLREQGAELWRWINDGAHIYVCGDANRMAKDVEQALLEVIAEFGGM
FT                   DTEAADEFLSELRVERRYQRDVY"
FT   gene            599563..601275
FT                   /locus_tag="UM146_02775"
FT   CDS_pept        599563..601275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02775"
FT                   /product="sulfite reductase subunit beta"
FT                   /note="COG0155 Sulfite reductase, beta subunit
FT                   (hemoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69972"
FT                   /protein_id="ADN69972.1"
FT                   /translation="MSEKHPGPLVVEGKLTDAERMKLESNYLRGTIAEDLNDGLTGGFK
FT                   GDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAG
FT                   ENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYE
FT                   SQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVI
FT                   PPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEH
FT                   TLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGVETFKAEVERRAGIKFEPIRPYEFT
FT                   GRGDRIGWVKGIDDNWHLTLFIENGRILDYPGRPLKTGLLEIAKIHKGDFRITANQNLI
FT                   IAGVPESEKAKIEKIAKESGLMNAVTPQRENSMACVSFPTCPLAMAEAERFLPSFIDNI
FT                   DNLMAKHGVSDEHIVMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLHLGGNRIGTRIPRM
FT                   YKENITEPEILASLDELIGRWAKEREVGEGFGDFTVRAGIIRPVLDPARDLWD"
FT   gene            601349..602083
FT                   /locus_tag="UM146_02780"
FT   CDS_pept        601349..602083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02780"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69973"
FT                   /protein_id="ADN69973.1"
FT                   /translation="MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLP
FT                   GEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVY
FT                   RATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNVQTWFAGLRREQSGS
FT                   RANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWE
FT                   PGMAEEETRFFGLKRECGLHEG"
FT   gene            602348..602500
FT                   /locus_tag="UM146_02785"
FT   CDS_pept        602348..602500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02785"
FT                   /product="Small toxic membrane polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69974"
FT                   /protein_id="ADN69974.1"
FT                   /translation="MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLA
FT                   YESKK"
FT   gene            complement(602625..603662)
FT                   /locus_tag="UM146_02790"
FT   CDS_pept        complement(602625..603662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02790"
FT                   /product="alkaline phosphatase isozyme conversion
FT                   aminopeptidase"
FT                   /note="COG2234 Predicted aminopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69975"
FT                   /protein_id="ADN69975.1"
FT                   /translation="MFSALRHRTAALALGVCFILPVHASSPKPGDFANTQARHIATFFP
FT                   GRMTGTPAEMLSADYIRQQFQQMGYRSDVRTFNSRYIYTARDNRKSWHNVTGSTVIAAH
FT                   EGKAPQQIIIMAHLDTYAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAEHLKNTPT
FT                   EYGIRFVATSGEEEGKLGAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVNTPE
FT                   AVRKLTRDRALAIARSHGIAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNW
FT                   NLGNKDGYQQRAKTAAFPAGNSWHDVRLDNQQHIDKALPGRIERRCRDVMRIMLPLVKE
FT                   LAKAS"
FT   gene            603914..604822
FT                   /locus_tag="UM146_02795"
FT   CDS_pept        603914..604822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02795"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69976"
FT                   /protein_id="ADN69976.1"
FT                   /translation="MDQKRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLH
FT                   LARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFV
FT                   HGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQ
FT                   RPELWHNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGM
FT                   LMMIDDNRINLQSGEVIKKRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQ
FT                   GRVIDRDQAGSMELKKRQGYF"
FT   gene            604824..606251
FT                   /gene="cysN"
FT                   /locus_tag="UM146_02800"
FT   CDS_pept        604824..606251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="UM146_02800"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /note="COG2895 GTPases - Sulfate adenylate transferase
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69977"
FT                   /protein_id="ADN69977.1"
FT                   /translation="MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIG
FT                   RLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFST
FT                   EKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHL
FT                   VVAINKMDLVDYSEETFTRIREDYLTFAGQLPGNLDIRFVPLSALEGDNVASQSESMPW
FT                   YSGPTLLEVLETVEIQRVVDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVL
FT                   PSGVESNVARIVTFDGDREEAFAGEAITLVLTDEIDISRGDLLLAADEALPAVQSASVD
FT                   VVWMAEQPLSPGQSYDIKIAGKKTRARVDGIHYQVDINNLTQREVENLPLNGIGLVDLT
FT                   FDEPLVLDRYQQNPVTGGLIFIDRLSNVTVGAGMVHEPVSQATAAPSEFSAFELELNAL
FT                   VRRHFPHWGARDLLGDK"
FT   gene            606251..606856
FT                   /locus_tag="UM146_02805"
FT   CDS_pept        606251..606856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02805"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="COG0529 Adenylylsulfate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69978"
FT                   /protein_id="ADN69978.1"
FT                   /translation="MALHDENVVWHSHPVTPQQREQHHGHRGVVLWFTGLSGSGKSTVA
FT                   GALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVL
FT                   TAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGID
FT                   SVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS"
FT   gene            606906..607229
FT                   /locus_tag="UM146_02810"
FT   CDS_pept        606906..607229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69979"
FT                   /protein_id="ADN69979.1"
FT                   /translation="MRNSHNITLTNNDSLTEVEDTTWSLPGAVVGFLSWLCALAIPMLI
FT                   YGSNTLLFFIYTWPFFLALMPVAVVVGIALHSLMDGKLRYSIVFTLATVGIMFGALFMW
FT                   LLG"
FT   gene            607422..607733
FT                   /gene="ftsB"
FT                   /locus_tag="UM146_02815"
FT   CDS_pept        607422..607733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsB"
FT                   /locus_tag="UM146_02815"
FT                   /product="cell division protein FtsB"
FT                   /note="COG2919 Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69980"
FT                   /protein_id="ADN69980.1"
FT                   /translation="MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNNDVAAQQATNAK
FT                   LKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR"
FT   gene            607752..608462
FT                   /gene="ispD"
FT                   /locus_tag="UM146_02820"
FT   CDS_pept        607752..608462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="UM146_02820"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69981"
FT                   /protein_id="ADN69981.1"
FT                   /translation="MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHAL
FT                   LAHPRVKRVVIAISPGDSRFAQLPLANHPRITVVDGGEERADSVLAGLKAAGDAQWVLV
FT                   HDAARPCLHQDDLARLLALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHA
FT                   LTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLAL
FT                   AEFYLTRTIHQENT"
FT   gene            608462..608941
FT                   /gene="ispF"
FT                   /locus_tag="UM146_02825"
FT   CDS_pept        608462..608941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="UM146_02825"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="COG0245 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69982"
FT                   /protein_id="ADN69982.1"
FT                   /translation="MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALT
FT                   DALLGAAALGDIGKLFPDTDPTFKGADSRELLREAWRRIQAKGYALGNVDVTIIAQAPR
FT                   MLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK"
FT   gene            608938..609987
FT                   /gene="truD"
FT                   /locus_tag="UM146_02830"
FT   CDS_pept        608938..609987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truD"
FT                   /locus_tag="UM146_02830"
FT                   /product="tRNA pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /note="COG0585 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69983"
FT                   /protein_id="ADN69983.1"
FT                   /translation="MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHIL
FT                   VRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAF
FT                   QLEGCQVLEYARHKRKLRLGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQ
FT                   RFGIGGSNLQGALRWAQTNTPVRDRNKRSFWLSAARSALFNQIVAERLKKADVNQVVDG
FT                   DALQLAGRGSWFVATTEELAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAE
FT                   ETELQTLLVREKVEAARRAMLLYPQQLSWNWWDDVTVEIHFWLPAGSFATSVVRELINT
FT                   TGDYAHIAE"
FT   gene            609968..610729
FT                   /gene="surE"
FT                   /locus_tag="UM146_02835"
FT   CDS_pept        609968..610729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="UM146_02835"
FT                   /product="stationary phase survival protein SurE"
FT                   /EC_number="3.1.3.5"
FT                   /note="COG0496 Predicted acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69984"
FT                   /protein_id="ADN69984.1"
FT                   /translation="MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSL
FT                   TLESSLRTFTFENGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYS
FT                   GTVAAAMEGRHLGFPALAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDL
FT                   PLDQIKGIRVTRCGTRHPADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYV
FT                   SITPLHVDLTAHSAQDVVSDWLNSVGVGTQW"
FT   gene            610723..611349
FT                   /gene="pcm"
FT                   /locus_tag="UM146_02840"
FT   CDS_pept        610723..611349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="UM146_02840"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="COG2518 Protein-L-isoaspartate
FT                   carboxylmethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69985"
FT                   /protein_id="ADN69985.1"
FT                   /translation="MVSRRVQALLDQLRAQGIQDELVLNALAAVPREKFVDEAFEQKAW
FT                   DNIALPIGQGQTISQPYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVE
FT                   RIKGLQWQARRRLKNLDLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLD
FT                   EGGILVLPVGEEHQYLKRVRRRGGEFIIDTVEAVRFVPLVKGELA"
FT   gene            611489..612628
FT                   /gene="nlpD"
FT                   /locus_tag="UM146_02845"
FT   CDS_pept        611489..612628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="UM146_02845"
FT                   /product="lipoprotein NlpD"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69986"
FT                   /protein_id="ADN69986.1"
FT                   /translation="MSAGSPKFTVRRIAALSLVSLWLAGCSDTSNPPAPVSSVNGNAPA
FT                   NTNSGMLITPPPKMGTTSTAQPPQIQPVQQPQIQATQQPQIQPVQPVAQQPVQMENGRI
FT                   VYNRQYGNIPKGSYSGSTYTVKKGDTLFYIAWITGNDFRDLAQRNNIQAPYALNVGQTL
FT                   QVGNASGTPITGGNAITQADAAEQGVVIKPAQNSTVAVASQPTITYSESSGEQSANKML
FT                   PNNKPTATTVTAPVTVPTASTTEPTVSSTSTSTPISTWRWPTEGKVIETFGASEGGNKG
FT                   IDIAGSKGQAIIATADGRVVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVQEQQEV
FT                   KAGQKIATMGSTGTSSTRLHFEIRYKGKSVNPLRYLPQR"
FT   gene            612691..613683
FT                   /locus_tag="UM146_02850"
FT   CDS_pept        612691..613683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02850"
FT                   /product="RNA polymerase sigma factor RpoS"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69987"
FT                   /protein_id="ADN69987.1"
FT                   /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEEEPSDNDLAEEEL
FT                   LSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVK
FT                   IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTR
FT                   TIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSV
FT                   DTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLL
FT                   GYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE"
FT   gene            complement(613861..614412)
FT                   /locus_tag="UM146_02855"
FT   CDS_pept        complement(613861..614412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02855"
FT                   /product="putative protein with flavodoxin fold"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69988"
FT                   /protein_id="ADN69988.1"
FT                   /translation="MQNIAVVYYSGYGHTKLVAEKVAQGAHADLISIDNEGNITEQEWE
FT                   KLDAADAIIFGAPTYMGGAPWQFKKFADASSKAWFTRKWQDKVFGGFTNSASLNGDKQV
FT                   TLIYLQTLASQHGGLWVSLGQAPANVLASTREDVNNLGGSVGLLVQSPADAGADQIPTG
FT                   DLDTAVKYGERVATITARLK"
FT   gene            614637..615680
FT                   /locus_tag="UM146_02860"
FT   CDS_pept        614637..615680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02860"
FT                   /product="putative exported Zn-dependent hydrolase"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69989"
FT                   /protein_id="ADN69989.1"
FT                   /translation="MQGIKIYTILASSLISGSVFAQTEISTANSSTVNASYVEPSAEKI
FT                   ISPSDKLNNLFERNMSQPYILQKIGERTYYVQRYFYSTTFYVGDKGVLLFDAPEGRGKY
FT                   LLQAIRDVTPLPVTALVYSHYHVDHIGDSPFWNDEAKKEGVNLRIIASKATAEKMQFMN
FT                   SRLPVATQVLSKKDDQFKFEKQTIELHRFVKAGHTDDHSVWLLKQEKVAHSPDLLNPDQ
FT                   LPMMGFAVSDTLVYHDSNLRQVEMLDWKYFIGGHGNIGSHDDFKFQRQFLNDLRDTTIK
FT                   VRKEESFGKFMNKTANNHADFARAQREAIIKKVTEVLRPKYGHMYGYDASMPANIEMAI
FT                   RLVGSYY"
FT   gene            complement(615823..617187)
FT                   /locus_tag="UM146_02865"
FT   CDS_pept        complement(615823..617187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02865"
FT                   /product="inner membrane permease YgbN"
FT                   /note="COG2610 H+/gluconate symporter and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69990"
FT                   /protein_id="ADN69990.1"
FT                   /translation="MSTITLLCIALAGVIMLLLLVIKAKVQPFVALLLVSLLVALAAGI
FT                   PAGEVGKVMIAGMGGVLGSVTIIIGLGAMLGRMIEHSGGAESLANYFSRKLGDKRTIAA
FT                   LTLAAFFLGIPVFFDVGFIILAPIIYGFAKVAKISPLKFGLPVAGIMLTVHVAVPPHPG
FT                   PVAAAGLLHADIGWLTIIGIAISIPVGVVGYFAAKIINKRQYAMSVEVLEQMQLAPASE
FT                   EGATKLSDKINPPGVALVTSLIVIPIAIIMAGTVSATLMPPSHPLLGTLQLIGSPMVAL
FT                   MIALVLAFWLLALRRGWSLQHTSDIMGSALPTAAVVILVTGAGGVFGKVLVESGVGKAL
FT                   ANMLQMIDLPLLPAAFIISLALRASQGSATVAILTTSGLLSEAVMGLNPIQCVLVTLAA
FT                   CFGGLGASHINDSGFWIVTKYLGLSVADGLKTWTVLTTILGFTGFLITWCVWLVI"
FT   gene            complement(617276..618052)
FT                   /locus_tag="UM146_02870"
FT   CDS_pept        complement(617276..618052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02870"
FT                   /product="hypothetical protein"
FT                   /note="COG3622 Hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69991"
FT                   /protein_id="ADN69991.1"
FT                   /translation="MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYDYSPLQI
FT                   QKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEARADIDLALEYALALNCEQVHV
FT                   MAGVVPAGEDAERYRAVFIDNLRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALA
FT                   IVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYP
FT                   WLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWR"
FT   gene            complement(618057..618695)
FT                   /locus_tag="UM146_02875"
FT   CDS_pept        complement(618057..618695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02875"
FT                   /product="putative aldolase"
FT                   /note="COG0235 Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69992"
FT                   /protein_id="ADN69992.1"
FT                   /translation="MSDFAKVEQSLREEMTRIASSFFQRGYATGSAGNLSLLLPDGNLL
FT                   ATPTGSCLGNLDPQRLSKVTADGEWLSGDKPSKEVLFHLALYRNNPRCKAVVHLHSTWS
FT                   TALSCQEGLDSNNVIRPFTPYVVMRMGNVPLVPYYRPGDKRIAQDLAELAADNQAFLLA
FT                   NHGPVVCGESLQEAANNMEELEETAKLIFILGDRPIRYLTAGEIAELRS"
FT   gene            complement(618692..619954)
FT                   /locus_tag="UM146_02880"
FT   CDS_pept        complement(618692..619954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02880"
FT                   /product="hypothetical protein"
FT                   /note="COG3395 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69993"
FT                   /protein_id="ADN69993.1"
FT                   /translation="MIKIGVIADDFTGATDIASFLVENGLPTVQINGVPTGKMPEAIDA
FT                   LVISLKTRSCPVVEATQQSLAALSWLQQQGCKQIYFKYCSTFDSTAKGNIGPVTDALMD
FT                   ALDTPFTVFSPALPVNGRTVYQGYLFVMNQLLAESGMRHHPVNPMTDSYLPRLVESQST
FT                   GRCGVVSAHVFEQGVKAVRQELARLQQEGYRYAVLDALTEHHLEIQGKALRDAPLVTGG
FT                   SGLAIGLARQWAQENGNQAREAGRPLAGRGVVLSGSCSQMTNRQVAHYRQIAPAREVDV
FT                   ARCLSTETLAAYAHELAEWVLGQESVLAPLVFATASTDALAAIQQQYGAQKASQAVETL
FT                   FSQLAARLAAEGVTRFIVAGGETSGVVTQSLGIKGFHIGPTISPGVPWVNALDKPVSLA
FT                   LKSGNFGDEAFFSRAQREFLS"
FT   gene            complement(619951..620859)
FT                   /locus_tag="UM146_02885"
FT   CDS_pept        complement(619951..620859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02885"
FT                   /product="putative dehydrogenase, with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /note="COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69994"
FT                   /protein_id="ADN69994.1"
FT                   /translation="MKTGSEFHVGIVGLGSMGMGAALSCVRAGLSTWGADLNSNACATL
FT                   KEAGACGVSDNAATFAEKLDALLVLVVNATQVKQVLFGEKGVAQHLKPGTAVMVSSTIA
FT                   SADAQEIATALAGFGLEMLDAPVSGGAVKAANGEMTVMASGSDIAFERLAPVLEAVAGK
FT                   VYRIGAEPGLGSTVKIIHQLLAGVHIAAGAEAMALAARAGIPLDVMYDVVTNAAGNSWM
FT                   FENRMRHVVDGDYTPHSAVDIFVKDLGLVADTAKALHFPLPLASTALNMFTSASNAGYG
FT                   KEDDSAVIKIFSGITLPGAKS"
FT   gene            621055..621822
FT                   /locus_tag="UM146_02890"
FT   CDS_pept        621055..621822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02890"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69995"
FT                   /protein_id="ADN69995.1"
FT                   /translation="MIPVERRQIILEMVAEKGIVSIAELTDRMNVSHMTIRRDLQKLEQ
FT                   QGAVVLVSGGVQSPGRVAHEPSHQVKTALAMTQKAAIGKLAASLVQPGRCIYLDAGTTT
FT                   LAIAQHLIHMEPLTVVTNDFVIADYLLDNSNCTIIHTGGAVCRENRSCVGEAAATMLRS
FT                   LMIDQAFISASSWSVRGISTPAEDKVTVKRAIASASRQRVLVCDATKYGQVATWLALPL
FT                   SEFDQIITDDGLPESASRALAKLDLSLLVAKNE"
FT   gene            complement(621873..622181)
FT                   /locus_tag="UM146_02895"
FT   CDS_pept        complement(621873..622181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02895"
FT                   /product="serine/threonine-specific protein phosphatase 2"
FT                   /note="COG0639 Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69996"
FT                   /protein_id="ADN69996.1"
FT                   /translation="MLKFHHLPHIIEITNDTIKYVIAHADYPGKEYQFGKEIAENELLW
FT                   PVDRVQKSLNSELQKINGADFFIFGHMMFDNIQTFANQIYIDTGSPKSGRLSFYKIK"
FT   gene            622252..622527
FT                   /locus_tag="UM146_02900"
FT   CDS_pept        622252..622527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02900"
FT                   /product="transposase"
FT                   /note="COG3677 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69997"
FT                   /protein_id="ADN69997.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTYQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR"
FT   gene            622446..622949
FT                   /locus_tag="UM146_02905"
FT   CDS_pept        622446..622949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02905"
FT                   /product="InsBcp5 protein"
FT                   /note="COG1662 Transposase and inactivated derivatives, IS1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69998"
FT                   /protein_id="ADN69998.1"
FT                   /translation="MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(623214..625775)
FT                   /locus_tag="UM146_02910"
FT   CDS_pept        complement(623214..625775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02910"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="COG0249 Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN69999"
FT                   /protein_id="ADN69999.1"
FT                   /translation="MSTIENFDAHTPMMQQYLKLKAQHPEILLFYRMGDFYELFYDDAK
FT                   RASQLLDISLTKRGASAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQIGDPATSKG
FT                   PVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEPADR
FT                   ETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDL
FT                   VGFGVENAPRGLCAAGCLLQYAKDTQRTTLPHIRSITMERQQDSIIMDAATRRNLEITQ
FT                   NLAGGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAELQP
FT                   VLRQVGDLERILARLALRTARPRDLARMRHAFQQLPELRAQLENVDSAPVQALREKMGE
FT                   FAELRDLLERAIIDTPPVLVRDGGVIATGYNEELDEWRALADGATDYLERLEVRERERT
FT                   GLDTLKVGFNAVHGYYIQISRGQSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSK
FT                   GKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKP
FT                   GIRITEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAY
FT                   IGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDE
FT                   IGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEGVANVHLDALEHG
FT                   DTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELESISPNAAATQVDGTQ
FT                   MSLLSVPEETSPAVEALENLDPDSLTPRQALEWIYRLKSLV"
FT   gene            626061..626405
FT                   /locus_tag="UM146_02915"
FT   CDS_pept        626061..626405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70000"
FT                   /protein_id="ADN70000.1"
FT                   /translation="MSGKRISREKLTIKKMIDLYQAKCPQASAEPEHYEALFAYAQKRL
FT                   DKCVFGEEKPACKQCPVHCYQPAKREEMKQIMRWVGPRMLWRHPILTVRHLIDDKRPVP
FT                   ELPEKYRPKK"
FT   gene            complement(626444..626872)
FT                   /locus_tag="UM146_02920"
FT   CDS_pept        complement(626444..626872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02920"
FT                   /product="Putative molybdenum-pterin-binding-protein"
FT                   /note="COG2005 N-terminal domain of molybdenum-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70001"
FT                   /protein_id="ADN70001.1"
FT                   /translation="MAVSARNQLTGTVSAVAMGAVNDEVELTLAGGAKLVAIVTHSSQQ
FT                   ALGLAKGKEAIALIKAPWVTLATEDCGLKFSARNQFAGSVSTITEGAVNATVHIKTDAG
FT                   FEIVAVVTNESQDEMKLTTGSRVIALIKASAILIATKA"
FT   gene            complement(626917..628995)
FT                   /locus_tag="UM146_02925"
FT   CDS_pept        complement(626917..628995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02925"
FT                   /product="DNA-binding transcriptional activator"
FT                   /note="COG3604 Transcriptional regulator containing GAF,
FT                   AAA-type ATPase, and DNA binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70002"
FT                   /protein_id="ADN70002.1"
FT                   /translation="MSYTPMSDLGQQGLFDITRTLLQQPDLASLCEALSQLVKRSALAD
FT                   NAAIVLWQAQTQRASYYASREKDTPIKYEDETVLAHGPVRSILSRPDTLHCSYEEFCET
FT                   WPQLATGGLYPKFGHYCLMPLAAEGHIFGGCEFIRYDDRPWSEKEFNRLQTFTQIVSVV
FT                   TEQIQSRVVNNVDYELLCRERDNFRILVAITNAVLSRLDMDELVSEVAKEIHYYFDIDD
FT                   ISIVLRSHRKNKLNIYSTHYLDKQHPAHEQSEVDEAGTLTERVFKSKEMLLINLHERDD
FT                   LAPYERMLFNTWGNQIQTLCLLPLMSGDTMLGVLKLAQCEEKVFTTTNLNLLRQIAERV
FT                   AIAVDNALAYQEIHRLKERLVDENLALTEQLNNVDSEFGEIIGRSEAMYSVLKQVEMVA
FT                   QSDSTVLILGETGTGKELIARAIHNLSGRNNRRMVKMNCAAMPAGLLESDLFGHERGAF
FT                   TGASAQRIGRFELADKSSLFLDEVGDMPLELQPKLLRVLQEQEFERLGSNKIIQTDVRL
FT                   IAATNRDLKKMVADREFRSDLYYRLNVFPIHLPPLRERPEDIPLLAKAFTFKIARRLGR
FT                   NIDSIPAETLRILSNMEWPGNVRELENVIERAVLLTRGNVLQLSLPDIALPEPETPPAA
FT                   TVVAQEGEDEYQLIVRVLKETNGVVAGPKGAAQRLGLKRTTLLSRMKRLGIDKSALI"
FT   gene            complement(629069..630079)
FT                   /locus_tag="UM146_02930"
FT   CDS_pept        complement(629069..630079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02930"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="COG0309 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70003"
FT                   /protein_id="ADN70003.1"
FT                   /translation="MNNIQLAHGSGGQAMQQLINSLFMEAFANPWLAEQEDQARLDLAQ
FT                   LVAEGDRLAFSTDSYVIDPLFFPGGNIGKLAICGTANDVAVSGAIPRYLSCGFILEEGL
FT                   PMETLKAVVTSMAETARAAGIAIVTGDTKVVQRGAADKLFINTAGMGAIPANIHWGAQT
FT                   LTAGDVLLVSGTLGDHGATILNLREQLGLDGELVSDCAVLTPLIQTLRDIPGVKALRDA
FT                   TRGGVNAVVHEFAAACGCGIELSEAALPVKPAVRGVCELLGLDALNFANEGKLVIAVER
FT                   NAAEQVLAALHSHPLGKDAALIGEVVERKGVRLAGLYGVKRTLDLPHAEPLPRIC"
FT   gene            complement(630076..631197)
FT                   /locus_tag="UM146_02935"
FT   CDS_pept        complement(630076..631197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02935"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="COG0409 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70004"
FT                   /protein_id="ADN70004.1"
FT                   /translation="MRFVDEYRAPEQVMQLIEHLRERASHLSYTAERPLRIMEVCGGHT
FT                   HAIFKFGLDQLLPENVEFIHGPGCPVCVLPMGRIDTCVEIASHPEVIFCTFGDAMRVPG
FT                   KQGSLLQAKARGADVRIVYSPMDALKLAQENPTRKVVFFGLGFETTMPTTAITLQQAKA
FT                   RDVQNFYFFCQHITLIPTLRSLLEEPDNGIDAFLAPGHVSMVIGTDAYNFIASDFHRPL
FT                   VVAGFEPLDLLQGVVMLVEQKIAAHSKVENQYRRVVPDAGNLLAQQAIADVFCVNGDSE
FT                   WRGLGVIESSGVHLTPDYQRFDAEAHFRPAPQQVCDDPRARCGEVLTGKCKPHQCPLFG
FT                   NTCNPQTAFGALMVSSEGACAAWYQYRQQESEA"
FT   gene            complement(631197..631469)
FT                   /locus_tag="UM146_02940"
FT   CDS_pept        complement(631197..631469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02940"
FT                   /product="hydrogenase assembly chaperone"
FT                   /note="COG0298 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70005"
FT                   /protein_id="ADN70005.1"
FT                   /translation="MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVG
FT                   QWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEEK"
FT   gene            complement(631460..632332)
FT                   /locus_tag="UM146_02945"
FT   CDS_pept        complement(631460..632332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02945"
FT                   /product="hydrogenase nickel incorporation protein HypB"
FT                   /note="COG0378 Ni2+-binding GTPase involved in regulation
FT                   of expression and maturation of urease and hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70006"
FT                   /protein_id="ADN70006.1"
FT                   /translation="MCTTCGCGEGNLYIEGDEHNPHSAFRSAPFAPAARPKMKITGIKA
FT                   PEFTPSQTEEGDLHYGHGEAGTHAPGMSQRRMLEVEIDVLDKNNRLAERNRAHFAARKQ
FT                   LVLNLVSSPGSGKTTLLTETLMRLKDSVPCAVIEGDQQTVNDAARIRATGTPAIQVNTG
FT                   KGCHLDAQMIADAAPRLPLDDNGILFIENVGNLVCPASFDLGEKHKVAVLSVTEGEDKP
FT                   LKYPHMFAAASLMLLNKVDLLPYLNFDVEKCIACAREVNPEIEIILISATSGEGMDQWL
FT                   NWLETQRCA"
FT   gene            complement(632336..632698)
FT                   /gene="hypA"
FT                   /locus_tag="UM146_02950"
FT   CDS_pept        complement(632336..632698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="UM146_02950"
FT                   /product="hydrogenase nickel incorporation protein"
FT                   /note="COG0375 Zn finger protein HypA/HybF (possibly
FT                   regulating hydrogenase expression)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70007"
FT                   /protein_id="ADN70007.1"
FT                   /translation="MGGDMHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVET
FT                   SSLAFCFDLVCRGSVAEGCKLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQI
FT                   VADDGLQIRRIEIDQE"
FT   gene            632898..633359
FT                   /locus_tag="UM146_02955"
FT   CDS_pept        632898..633359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02955"
FT                   /product="formate hydrogenlyase regulatory protein HycA"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70008"
FT                   /protein_id="ADN70008.1"
FT                   /translation="MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHA
FT                   MSCAPDKELCFVLFEHFRIYVTLADGFNSHTIEYYVETKEGEDKQRIAQAQLSIDGMID
FT                   GKVNIRDREQVLEHYLEKIAGVYDSLYTAIENNVPVNLSQLVKGQSPAA"
FT   gene            633484..634095
FT                   /locus_tag="UM146_02960"
FT   CDS_pept        633484..634095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02960"
FT                   /product="hydrogenase 3, Fe-S subunit"
FT                   /note="COG1142 Fe-S-cluster-containing hydrogenase
FT                   components 2"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70009"
FT                   /protein_id="ADN70009.1"
FT                   /translation="MNRFVIADSTLCIGCHTCEATCSETHRQHGLQSMPRLRVMLNEKE
FT                   SAPQLCHHCEDAPCATVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRP
FT                   LDIPANANTPKAPPAPPAPARVSTLLDWVPGIRAIAVKCDLCSFDEQGPACVRMCPTKA
FT                   LHLVDNTDIARVSKRKRELTFNTDFGDLTLFQQAQSGEAK"
FT   gene            634092..635918
FT                   /locus_tag="UM146_02965"
FT   CDS_pept        634092..635918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02965"
FT                   /product="formate hydrogenlyase subunit 3"
FT                   /note="COG0651 Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70010"
FT                   /protein_id="ADN70010.1"
FT                   /translation="MSAISLINSGVAWFVAVAVLAFLFSFQKALSGWIAGIGGAVGSLY
FT                   TAAAGFTVLTGTVGVSGALSLVSYDVQISPLNAIWLITLGLCGLFVSLYNIDWHRHAQV
FT                   KCNGLQINMLMAAAVCAVIASNLGMFVVMAEIMALCAVFLTSNSKEGKLWFALGRLGTL
FT                   LLAIACWLLWQRYGTLDLRLLDMRMQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAH
FT                   ANASAPAAALFSTVVMKIGLLGILTLSLLGGNAPLWWGIALLVLGMITAFVGGLYALME
FT                   HNIQRLLAYHTLENIGIILLGLGAGVTGIALEQPALIALGLVGGLYHLLNHSLFKSVLF
FT                   LGAGSVWFRTGHRDIEKLGGIGKKMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFF
FT                   KLSNSGAFVARLLGPLLAVGLAITGALAVMCMAKVYGVTFLGAPRTKEAENATCAPLLM
FT                   SVSVVALAICCVIGGVAAPWLLPMLSAAVPLPLEPANTTVSQPMITLLLIACPLLPFII
FT                   MAICKGDRLPSRSRGAAWVCGYDHEKSMVITAHGFAMPVKQAFAPVLKLRKWLNPVSLV
FT                   PGWQCEGSALLFRRMALVELAVLVVIIVSRGA"
FT   gene            635921..636844
FT                   /locus_tag="UM146_02970"
FT   CDS_pept        635921..636844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02970"
FT                   /product="hydrogenase 3, membrane subunit"
FT                   /note="COG0650 Formate hydrogenlyase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70011"
FT                   /protein_id="ADN70011.1"
FT                   /translation="MSVLYPLIQALVLFAVAPLLSGITRVARARLHNRRGPGVLQEYRD
FT                   IIKLLGRQSVGPDASGWVFRLTPYVMVGVMLTIATALPVVTVGSPLPPLGDLITLLYLF
FT                   AIARFFFAISGLDTGSPFTAIGASREAMLGVLVEPMLLLGLWVAAQAAGSTNISNITDT
FT                   VYHWPLSQSIPLVLALCACAFATFIEMGKLPFDLAEAEQELQEGPLSEYSGSGFGVMKW
FT                   GISLKQLVVLQMFVGVFIPWGQMETFTVGGLLLALVIAIVKLVVGVLVIALFENSMARL
FT                   RLDITPRITWAGFGFAFLAFVSLLAA"
FT   gene            636862..638571
FT                   /locus_tag="UM146_02975"
FT   CDS_pept        636862..638571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02975"
FT                   /product="Formate hydrogenlyase, subunit E"
FT                   /note="COG3262 Ni,Fe-hydrogenase III component G"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70012"
FT                   /protein_id="ADN70012.1"
FT                   /translation="MSEEKLGQHYLAALNEAFPGVVLDHAWQTKDQLTVTVKVNYLPEV
FT                   VEFLYYKQGGWLSVLFGNDERKLNGHYAVYYVLSMEKGTKCWVTVRVEVDANKPEYPSV
FT                   TPRVPAAVWGEREVRDMYGLIPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPAPTT
FT                   DAETYEFINELGDKKNNVVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEK
FT                   LAETRMGYNEVTFLSDRVCGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERL
FT                   HSHLLNLGLACHFTGFDSGFMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKD
FT                   DMIQTRQLAQQMRREVQELVDVLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGH
FT                   ARDTRADHPFVGYGLLPMEVHSEQGCDVISRLKVRINEVYTALNMIDYGLDNLPGGPLM
FT                   VEGFTYIPHRFALGFAEAPRGDDIHWSMTGDNQKLYRWRCRAATYANWPTLRYMLRGNT
FT                   VSDAPLIIGSLDPCYSCTDRMTVVDVRKKKSKVVPYKELERYSIERKNSPLK"
FT   gene            638581..639123
FT                   /locus_tag="UM146_02980"
FT   CDS_pept        638581..639123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02980"
FT                   /product="formate hydrogenlyase complex iron-sulfur
FT                   subunit"
FT                   /note="COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70013"
FT                   /protein_id="ADN70013.1"
FT                   /translation="MFTFIKKVIKTGTATSSYPLEPIAVDKNFRGKPEQNPQQCIGCAA
FT                   CVNACPSNALTVETDLATGELAWQFDLGRCIFCGRCEEVCPTAAIKLSQEYELAVWKKE
FT                   DFLQQSRFALCNCRVCNRPFAVQKEIDYAIALLKHNGDSRAENHRESFETCPECKRQKC
FT                   LVPSDRIELTRHMKEAI"
FT   gene            639123..639890
FT                   /locus_tag="UM146_02985"
FT   CDS_pept        639123..639890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02985"
FT                   /product="hydrogenase 3 and formate hydrogenase complex,
FT                   HycG subunit"
FT                   /note="COG3260 Ni,Fe-hydrogenase III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70014"
FT                   /protein_id="ADN70014.1"
FT                   /translation="MSNLLGPRDANGIPVPMTVDESIASMKASLLKKIKRSAYVYRVDC
FT                   GGCNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAP
FT                   DPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLL
FT                   EQKIHARGPGEQDEQPAEILHGDMVQPLRVKVDREARRLAGYRYGRQIADDFLTQLGQG
FT                   EEQVARWLEAENDPRLNEIVSHLNHVVEEARIR"
FT   gene            639887..640297
FT                   /locus_tag="UM146_02990"
FT   CDS_pept        639887..640297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_02990"
FT                   /product="protein required for maturation of hydrogenase 3"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70015"
FT                   /protein_id="ADN70015.1"
FT                   /translation="MSEKVVFSQLSRKFIDENDATPAEAQQVVYYSLAIGHHLGVIDCL
FT                   EAALTCPWDDYLAWIATLEAGSEARRKMEGVPKYGEIVIDINHVPMLANAFDKARAAQT
FT                   SQQKEWSTMLLSMLHDIHQENAIYLMVRRLRD"
FT   gene            640290..640760
FT                   /gene="hycI"
FT                   /locus_tag="UM146_02995"
FT   CDS_pept        640290..640760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycI"
FT                   /locus_tag="UM146_02995"
FT                   /product="hydrogenase 3 maturation protease"
FT                   /note="COG0680 Ni,Fe-hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70016"
FT                   /protein_id="ADN70016.1"
FT                   /translation="MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPEN
FT                   DIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPADIAEMFMMTTHNMPLNYLIDQLKED
FT                   IGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE"
FT   gene            640812..640979
FT                   /locus_tag="UM146_03000"
FT   CDS_pept        640812..640979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70017"
FT                   /protein_id="ADN70017.1"
FT                   /translation="MCAFLLSLVLPAQATSFTEYLPMSDGEYAQKRVLKPLLTMPYDAE
FT                   QTWHFRKVSV"
FT   gene            641005..641424
FT                   /locus_tag="UM146_03005"
FT   CDS_pept        641005..641424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03005"
FT                   /product="putative HTH-type transcriptional regulator ygjM"
FT                   /note="COG5499 Predicted transcription regulator containing
FT                   HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70018"
FT                   /protein_id="ADN70018.1"
FT                   /translation="MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEED
FT                   DTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPVGVALLRTLIDQHNLTYADLKNEIG
FT                   SKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL"
FT   gene            complement(641522..642946)
FT                   /locus_tag="UM146_03010"
FT   CDS_pept        complement(641522..642946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03010"
FT                   /product="cryptic 6-phospho-beta-glucosidase"
FT                   /note="COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70019"
FT                   /protein_id="ADN70019.1"
FT                   /translation="MSVFPQGFLWGGALAANQSEGAYREGGKGLTTVDMIPHGEHRMAV
FT                   KLGLEKRFQLRDDEFYPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDEL
FT                   TPNQQGIAFYRAVFEECKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVELFSRYART
FT                   CFEAFDGLVKYWLTFNEINIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATK
FT                   IAHEVNPQNQVGCMLAGGNFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARV
FT                   FREKGVTIDKAPSDDEILKNTVDFVSFSYYASRCASAEMNANNCSAANVVKSLRNPYLQ
FT                   VSDWGWGIDPLGLRITMNMMYDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREH
FT                   IRAMGEAIADGIPLMGYTTWGCIDLVSASTGEMSKRYGFVYVDRDDAGNGTLTRTRKKS
FT                   FWWYKKVIASNGEDLE"
FT   gene            complement(642955..644412)
FT                   /locus_tag="UM146_03015"
FT   CDS_pept        complement(642955..644412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03015"
FT                   /product="cellobiose/arbutin/salicin-specific PTS system
FT                   components IIBC"
FT                   /note="COG1264 Phosphotransferase system IIB components"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70020"
FT                   /protein_id="ADN70020.1"
FT                   /translation="MAKNYAALASSVITALGGVDNISAVTHCMTRLRFVIKDDQLIDSP
FT                   TLKTISGVLGVVRSDNQCQVIIGNTVSQAFQEVVSLLPGDLQPAPPVGKPKLTLRRIGA
FT                   GVLDALIGTMSPLIPAIIGGSMVKLLAMILEMSGVLTKGSPTLIILNVIGDGAFFFLPL
FT                   MVAASAAIKFKTNMSLAIAIAGVLVHPSFIELMAKAALGEHVEFALIPVTAVKYTYTVI
FT                   PALVMTWCLSYIERWVDSITPAVTKNFLKPMLIVLIAAPLAILLIGPIGIWIGSAISAL
FT                   VYTIHGYLGWLSVAIMGALWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANLS
FT                   LGGSSLAVAWKTKNPELRQTALAAAASAIMAGISEPALYGVAIRLKRPLIASLISGFIC
FT                   GAVAGMAGLASHSMAAPGLFTSVQFFDPANPMSIVWVFAVMALAVVLSFILTLLLGFED
FT                   IPVEEATAEARKHQSVQPTVAKEVSLN"
FT   gene            644630..645682
FT                   /locus_tag="UM146_03020"
FT   CDS_pept        644630..645682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03020"
FT                   /product="transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70021"
FT                   /protein_id="ADN70021.1"
FT                   /translation="MQYTALIACKGMKMMTTMLEVAKRAGVSKATVSRVLSGNGYVSQE
FT                   TKDRVFQAVEESGYRPNLLARNLSAKSTQTLGLVVTNTLYHGIYFSELLFHAARMAEEK
FT                   GRQLLLADGKHSAEEERQAIQYLLDLRCDAIMIYPRFLSVDEIDDIIDAHSQPIMVLNR
FT                   RLRKNSSHSVWCDHKQTSFNAVAELITAGHQEIAFLTGSMDSPTSIERLAGYKDALAQH
FT                   GIAFNEKLIANGKWTPASGAEGVETLLERGAKFSALVASNDDMAIGAIKALHERGVAVP
FT                   EQVSVIGFDDIAIAPYIVPALSSVKIPVTEMIQEIIGRLIFMLDGGDFSPPKTFSGKLI
FT                   RRGSLIALSR"
FT   gene            645831..646358
FT                   /locus_tag="UM146_03025"
FT   CDS_pept        645831..646358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03025"
FT                   /product="electron transport protein HydN"
FT                   /note="COG1142 Fe-S-cluster-containing hydrogenase
FT                   components 2"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70022"
FT                   /protein_id="ADN70022.1"
FT                   /translation="MNRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIH
FT                   VIKGVNISTATVCRQCEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAM
FT                   EVVVRPVIRNSGAGLNVRADKAEANKCDLCNHREDGPACMAACPTHALICVDRNKLEQL
FT                   SAEKRRRTALMF"
FT   gene            646511..648763
FT                   /locus_tag="UM146_03030"
FT   CDS_pept        646511..648763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03030"
FT                   /product="hydrogenase maturation protein"
FT                   /note="COG0068 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70023"
FT                   /protein_id="ADN70023.1"
FT                   /translation="MAKNTSCGVQLRIRGKVQGVGFRPFVWQLAQQLNLHGDVCNDGDG
FT                   VEVRLLEDPETFLVQLHQHCPPLARIDSVEREPFIWSQLPTEFTIRQSAGGVMNTQIVP
FT                   DAATCPACLAEMNTPGERRWRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACD
FT                   KEYCDPLDRRFHAQPVACPECGPHLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIG
FT                   GFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKK
FT                   YVPELCDDIAPDLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALAD
FT                   LQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGA
FT                   DLKNTFCLVRGEQAVLSQHLGDLSDDGIQMQWREALRLMQNIYDFTPQYVVHDAHPGYV
FT                   SSQWAREMNLPTQTVLHHHAHAAACLAEHLWPLDGGDVIALTLDGIGMGENGALWGGEC
FT                   LRVNYRECQHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYSETASVQQQNWS
FT                   VLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCHGVTHP
FT                   VTMPLVDNQLDLATFWQQWLSWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVF
FT                   SGGVIHNCLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIVAARWLAGEVQNG"
FT   gene            complement(648987..650120)
FT                   /locus_tag="UM146_03035"
FT   CDS_pept        complement(648987..650120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03035"
FT                   /product="nitric oxide reductase"
FT                   /note="COG0446 Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70024"
FT                   /protein_id="ADN70024.1"
FT                   /translation="MSNGIVIIGSGFAARQLVKNIRKQDASIPLTLIAADSMDEYNKPD
FT                   LSHVISQGQRADDLTRQTAGEFAEQFNLRLFPHTWVTDIDAEAHVVKSQNNQWQYDKLV
FT                   LATGASAFVPPVPGRELMLTLNSQQEYRACETQLRDARRVLIVGGGLIGSELAMDFCRA
FT                   GKAVTLIDNAASILASLMPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDR
FT                   QRCIEVDAVIAATGLRPETALARRAGLTINRGVCVDSYLQTSNADIYALGDCAEINGQV
FT                   LPFLQPIQLSAMVLAKNLLGNNTPLKLPAMLVKIKTPELPLHLAGETQRQDLRWQINTE
FT                   RQGMVARGVDDADQLRAFVVSEDRMKEAFGLLKTLSM"
FT   gene            complement(650117..651556)
FT                   /locus_tag="UM146_03040"
FT   CDS_pept        complement(650117..651556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03040"
FT                   /product="anaerobic nitric oxide reductase flavorubredoxin"
FT                   /note="COG0426 Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70025"
FT                   /protein_id="ADN70025.1"
FT                   /translation="MSIVVKNNIHWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEKN
FT                   VLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTA
FT                   NAIDSINGHHHHPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLF
FT                   SNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDM
FT                   IATSHGVVWRDNPTQIVELYLKWAADYQEDRITIVYDTMSNNTRMMADAIAQGIAETDP
FT                   RVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRA
FT                   SAFGSHGWSGGAVDRLSTRLQDAGFEMSLSLKAKWRPDQDALELCREHGREIARQWALA
FT                   PLPQSTVNTVVEEETSAATTADLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDN
FT                   FLCPECSLGKDVFDELASEAK"
FT   gene            651743..653257
FT                   /locus_tag="UM146_03045"
FT   CDS_pept        651743..653257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03045"
FT                   /product="anaerobic nitric oxide reductase transcription
FT                   regulator"
FT                   /note="COG3604 Transcriptional regulator containing GAF,
FT                   AAA-type ATPase, and DNA binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70026"
FT                   /protein_id="ADN70026.1"
FT                   /translation="MSFSVDVLANIAIELQRGIGHQDRFQRLITTLRQVLECDASALLR
FT                   YDSRQFIPLAIDGLAKDVLGRRFALEGHPRLEAIARAGDVVRFPADSELPDPYDGLIPG
FT                   QESLKVHACVGLPLFAGQNLIGALTLDGMQPDQFDVFSDEELRLIAALAAGALSNALLI
FT                   EQLESQNMLPGDAAPFEAVKQTQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKE
FT                   LVAKAIHEASPRAVNPLVYLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNG
FT                   TLFLDEIGELSLALQAKLLRVLQYGDIQRVGDDRSLRVDVRVLAATNRDLREEVLAGRF
FT                   RADLFHRLSVFPLSVPPLRERGDDVILLAGYFCEQCRLRLGLSRVVLSAGARNLLQHYN
FT                   FPGNVRELEHAIHRAVVLSRATRSGDEVILEAQHFAFPEVTLPPPEAAAVPVVKQNLRE
FT                   ATEAFQRETIRQALAQNHHNWAACARMLETDVANLHRLAKRLGLKD"
FT   gene            complement(653254..654219)
FT                   /gene="gutQ"
FT                   /locus_tag="UM146_03050"
FT   CDS_pept        complement(653254..654219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutQ"
FT                   /locus_tag="UM146_03050"
FT                   /product="D-arabinose 5-phosphate isomerase"
FT                   /note="COG0794 Predicted sugar phosphate isomerase involved
FT                   in capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70027"
FT                   /protein_id="ADN70027.1"
FT                   /translation="MSEALLNAGRQTLMLELQEASHLPERLGDDFVRAANIILHCEGKV
FT                   VVSGIGKSGHIGKKIAATLANTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKE
FT                   LDLIIPRLEDKSIALLAMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMM
FT                   GDALAMAVMQARGFNEEDFARSHPAGALGARLLNKVHHLMRRDDAIPQVALTASVMDAM
FT                   LELSRTGLGLVAVCDDQRLVKGVFTDGDLRRWLVGGGALTTPVNEAMTVGGTTLQSQSR
FT                   AIDAKEILMKRKITAAPVVDENGKLTGAINLQDFYQAGII"
FT   gene            complement(654212..654985)
FT                   /gene="srlR"
FT                   /locus_tag="UM146_03055"
FT   CDS_pept        complement(654212..654985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlR"
FT                   /locus_tag="UM146_03055"
FT                   /product="DNA-bindng transcriptional repressor SrlR"
FT                   /note="COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70028"
FT                   /protein_id="ADN70028.1"
FT                   /translation="MKPRQRQAAILEYLQKQGKCSVEELAQYFDTTGTTIRKDLVILEH
FT                   AGTVIRTYGGVVLNKEESDPPIDHKTLINTHKKELIAEAAVGFIHDGDSIILDAGSTVL
FT                   QMVPLLSRFNNITVMTNSLHIVNALSELDNEQTILMPGGTFRKKSASFHGQLAENAFEH
FT                   FTFDKLFMGTDGIDLNAGVTTFNEVYTVSKAMCNAAREVILMADSSKFGRKSPNVVCSL
FT                   ESVDKLITDAGIDPAFRQALEEKGIDVIITGESNE"
FT   gene            complement(655052..655411)
FT                   /locus_tag="UM146_03060"
FT   CDS_pept        complement(655052..655411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03060"
FT                   /product="DNA-binding transcriptional activator GutM"
FT                   /note="COG4578 Glucitol operon activator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70029"
FT                   /protein_id="ADN70029.1"
FT                   /translation="MVSALITVAVIAWCAQLALGGWQISRFNRAFDTLCQQGRVGVGRS
FT                   SGRFKPRVVVAIALDDQQRIVDTLFMKGLTVFARPQKIPAITGMHVGDLQPDVIFPHDP
FT                   LSQNALSLALKLKRG"
FT   gene            complement(655517..656296)
FT                   /locus_tag="UM146_03065"
FT   CDS_pept        complement(655517..656296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03065"
FT                   /product="sorbitol-6-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.140"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70030"
FT                   /protein_id="ADN70030.1"
FT                   /translation="MNQVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQE
FT                   INAEYGEGTAYGFGADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGD
FT                   FDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVG
FT                   LTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLK
FT                   RGCDYQDVLNMLLFYASPKASYCTGQSINVTGGQVMF"
FT   gene            complement(656300..656671)
FT                   /locus_tag="UM146_03070"
FT   CDS_pept        complement(656300..656671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03070"
FT                   /product="glucitol/sorbitol-specific PTS system component
FT                   IIA"
FT                   /note="COG3731 Phosphotransferase system sorbitol-specific
FT                   component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70031"
FT                   /protein_id="ADN70031.1"
FT                   /translation="MTVIYQTTITRIGASATDALSDQMLITFREGAPADLEEYCFIHCH
FT                   GELKGALHPGLQFSLGQHRYPVTAVGSVAEDNLRELGHVTLRFDGLSEAEFPGTVHVAG
FT                   PVPDDIAPGSVLKFESVKE"
FT   gene            complement(656682..657641)
FT                   /locus_tag="UM146_03075"
FT   CDS_pept        complement(656682..657641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03075"
FT                   /product="glucitol/sorbitol-specific enzyme IIB component
FT                   of PTS"
FT                   /note="COG3732 Phosphotransferase system sorbitol-specific
FT                   component IIBC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70032"
FT                   /protein_id="ADN70032.1"
FT                   /translation="MTRIRIEKGTGGWGGPLELEATPGKKIVYITAGTRPAIVDKLAQL
FT                   TGWQAIDGFKEGEPAEAEIGVAVIDCGGTLRCGIYPKRRIPTINIHSTGKSGPLAQYIV
FT                   EDIYVSGVKEENITVVGEATPQPSSVGRDYDTSKKITEQSDGLLAKVGMGMGSAVAVLF
FT                   QSGRDTIDTVLKTILPFMAFVSALIGIIMASGLGDWIAHGLAPLASHPLGLVMLALICS
FT                   FPLLSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLA
FT                   EARQDTVRVGVPSVLVSRFLTGAPTVLIAWFVSGFIYQ"
FT   gene            complement(657638..658201)
FT                   /locus_tag="UM146_03080"
FT   CDS_pept        complement(657638..658201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03080"
FT                   /product="glucitol/sorbitol-specific enzyme IIC component
FT                   of PTS"
FT                   /note="COG3730 Phosphotransferase system sorbitol-specific
FT                   component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70033"
FT                   /protein_id="ADN70033.1"
FT                   /translation="MIETITHGAEWFIGLFQKGGEVFTGMVTGILPLLISLLVIMNALI
FT                   NFIGQHRIERFAQRCAGNPVSRYLLLPCIGTFVFCNPMTLSLGRFMPEKYKPSYYAAAS
FT                   YSCHSMNGLFPHINPGELFVYLGIASGLTTLNLPLGPLAVSYLLVGLVTNFFRGWVTDL
FT                   TTAIFEKKMGIQLEQKVRLAGATS"
FT   gene            658458..659543
FT                   /locus_tag="UM146_03085"
FT   CDS_pept        658458..659543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03085"
FT                   /product="murein hydrolase B"
FT                   /note="COG2951 Membrane-bound lytic murein transglycosylase
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70034"
FT                   /protein_id="ADN70034.1"
FT                   /translation="MFKRRYVTLLPLFVLLAACSSKPKPTETETTTGTPSGGFLLEPQH
FT                   NVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSV
FT                   KPPSGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVET
FT                   RWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMG
FT                   YGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPG
FT                   LPNGFKTRYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNH
FT                   STHYAMAVWQLGQAVALARVQ"
FT   gene            659688..660185
FT                   /locus_tag="UM146_03090"
FT   CDS_pept        659688..660185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03090"
FT                   /product="competence damage-inducible protein A"
FT                   /note="COG1546 Uncharacterized protein (competence- and
FT                   mitomycin-induced)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70035"
FT                   /protein_id="ADN70035.1"
FT                   /translation="MTDSELMQLSEQVGQSLKARGATVTTAESCTGGWVAKVITDIAGS
FT                   SAWFERGFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADYAVSISG
FT                   IAGPDGGSEEKPVGTVWFAFATARGEGITRRECFSGDRDAVRRQATAYALQTLWQQFLQ
FT                   NT"
FT   gene            660265..661326
FT                   /gene="recA"
FT                   /locus_tag="UM146_03095"
FT   CDS_pept        660265..661326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="UM146_03095"
FT                   /product="recombinase A"
FT                   /note="COG0468 RecA/RadA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70036"
FT                   /protein_id="ADN70036.1"
FT                   /translation="MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGS
FT                   LSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY
FT                   ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDS
FT                   HMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASV
FT                   RLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
FT                   EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSV
FT                   DDSEGVAETNEDF"
FT   gene            661395..661895
FT                   /gene="recX"
FT                   /locus_tag="UM146_03100"
FT   CDS_pept        661395..661895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="UM146_03100"
FT                   /product="recombination regulator RecX"
FT                   /note="COG2137 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70037"
FT                   /protein_id="ADN70037.1"
FT                   /translation="MTESTSRRPAYARLLDRAVRILAVRDHSEQELRRKLAAPIMGKNG
FT                   PEEIDATAEDYERVIAWCHEHGYLDDSRFVARFIASRSRKGYGPARIRQELNQKGISRE
FT                   ATEKAMRECDIDWCALARDQATRKYGEPLPTVFSEKVKIQRFLLYRGYLMEDIQDIWRN
FT                   FAD"
FT   gene            complement(661936..662085)
FT                   /locus_tag="UM146_03105"
FT   CDS_pept        complement(661936..662085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70038"
FT                   /protein_id="ADN70038.1"
FT                   /translation="MSLTMEKVEKRLTDLSGALAHNYPEIKLTKYRHQLQRVLTAGLVT
FT                   EKWE"
FT   gene            662023..664653
FT                   /gene="alaS"
FT                   /locus_tag="UM146_03110"
FT   CDS_pept        662023..664653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="UM146_03110"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COG0013 Alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70039"
FT                   /protein_id="ADN70039.1"
FT                   /translation="MSKSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMN
FT                   QFKDVFLGLDKRNYSRATTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFK
FT                   HDAIQFAWELLTSEKWFALPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGA
FT                   PYASDNFWQMGDTGPCGPCTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQ
FT                   ADGTMEPLPKPSVDTGMGLERIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATDLSNKSL
FT                   RVIADHIRSCAFLIADGVMPSNESRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLID
FT                   VMGSAGEDLKRQQAQVEQVLKTEEEQFARTLERGLALLDEELAKLSGDTLDGETAFRLY
FT                   DTYGFPVDLTADVCRERNIKVDEAGFDAAMEEQRRRAREASGFGADYNAMIRVDSASEF
FT                   KGYDHLELNGKVTALFVDGKAVDAINAGQEAVVVLDQTPFYAESGGQVGDKGELKGANF
FT                   SFAVEDTQKYGQAIGHIGKLAAGSLKVGDAVQADVDEARRARIRLNHSATHLMHAALRQ
FT                   VLGTHVSQKGSLVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIETNIMDLEA
FT                   AKAKGAMALFGEKYDERVRVLSMGDFSTELCGGTHASRTGDIGLFRIISESGTAAGVRR
FT                   IEAVTGEGAIATVHADSDRLSEVAHLLKGDSNNLADKVRSVLERTRQLEKELQQLKEQA
FT                   AAQESANLSSKAIDVNGVKLLVSELSGVEPKMLRTMVDDLKNQLGSTIIVLATVAEGKV
FT                   SLIAGVSKDVTDRVKAGELIGMVAQQVGGKGGGRPDMAQAGGTDAAALPAALASVKGWV
FT                   SAKLQ"
FT   gene            664888..665073
FT                   /locus_tag="UM146_03115"
FT   CDS_pept        664888..665073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03115"
FT                   /product="carbon storage regulator"
FT                   /note="COG1551 Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70040"
FT                   /protein_id="ADN70040.1"
FT                   /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHRE
FT                   EIYQRIQAEKSQQSSY"
FT   gene            665389..665481
FT                   /locus_tag="UM146_t23835"
FT   tRNA            665389..665481
FT                   /locus_tag="UM146_t23835"
FT                   /product="tRNA-Ser"
FT   gene            665485..665561
FT                   /locus_tag="UM146_t23837"
FT   tRNA            665485..665561
FT                   /locus_tag="UM146_t23837"
FT                   /product="tRNA-Arg"
FT   gene            665626..665702
FT                   /locus_tag="UM146_t23839"
FT   tRNA            665626..665702
FT                   /locus_tag="UM146_t23839"
FT                   /product="tRNA-Arg"
FT   misc_feature    complement(665658..665999)
FT                   /note="potential protein location (hypothetical protein
FT                   UM146_03120 [Escherichia coli UM146]) that overlaps RNA
FT                   (tRNA-R)"
FT   gene            665766..665842
FT                   /locus_tag="UM146_t23841"
FT   tRNA            665766..665842
FT                   /locus_tag="UM146_t23841"
FT                   /product="tRNA-Arg"
FT   gene            666123..666689
FT                   /locus_tag="UM146_03125"
FT   CDS_pept        666123..666689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03125"
FT                   /product="fructose-1-phosphatase"
FT                   /note="COG0637 Predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70041"
FT                   /protein_id="ADN70041.1"
FT                   /translation="MYERYAGLIFDMDGTILDTEPTHRKAWREVLGHYGLQYDVQAMIA
FT                   LNGSPTWRIAQAIIELNQADLDPHALAREKTEAVRSMLLDSVEPLPLVEVVKSWHGRRP
FT                   MAVGTGSESAIAEALLAHLGLRRYFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCV
FT                   VFEDADFGIQAARAAGMDAVDVRLL"
FT   gene            666830..667099
FT                   /locus_tag="UM146_03130"
FT   CDS_pept        666830..667099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03130"
FT                   /product="putative inner membrane protein"
FT                   /note="COG1238 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70042"
FT                   /protein_id="ADN70042.1"
FT                   /translation="MGNSLGGLTNVILGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSW
FT                   MPVVGDLLCLLAGWMRISWGPVIFFCALVKRYAMLQLQQLPFRA"
FT   gene            667186..668742
FT                   /locus_tag="UM146_03135"
FT   CDS_pept        667186..668742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03135"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="COG2918 Gamma-glutamylcysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70043"
FT                   /protein_id="ADN70043.1"
FT                   /translation="MIPDVSQALAWLEKHPQALKGIQRGLERETLRVNADGTLATTGHP
FT                   EALGSALTHKWITTDFAEALLEFITPVDGDIEHMLTFMRDLHRYTARNMGDERMWPLSM
FT                   PCYIAEGQDIELAQYGTSNTGRFKTLYREGLKNRYGALMQTISGVHYNFSLPMAFWQAK
FT                   CGDISGADAKEKISAGYFRVIRNYYRFGWVIPYLFGASPAICSSFLQGKPTSLPFEKTE
FT                   CGMYYLPYATSLRLSDLGYTNKSQSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEK
FT                   DGKRLQINSNVLQIENELYAPIRPKRVTRSGESPSDALLRGGIEYIEVRSLDINPFSPI
FT                   GVDEQQVRFLDLFMVWCALADAPEMSSSELACTRVNWNRVILEGRKPGLTLGIGCETAQ
FT                   FPLPQVGKDLFRDLKRVAQTLDSINGGEAYQKVCDELVACFDNPDLTFSARILRSMIDT
FT                   GIGGTGKAFAEAYRNLLREEPLEILREEDFVAEREASERRQQEMEAADTEPFAVWLEKH
FT                   A"
FT   gene            668893..669408
FT                   /locus_tag="UM146_03140"
FT   CDS_pept        668893..669408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03140"
FT                   /product="S-ribosylhomocysteinase"
FT                   /EC_number="4.4.1.21"
FT                   /note="COG1854 LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70044"
FT                   /protein_id="ADN70044.1"
FT                   /translation="MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNK
FT                   EVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAW
FT                   KAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPK
FT                   EKLQELHI"
FT   gene            complement(669459..670571)
FT                   /locus_tag="UM146_03145"
FT   CDS_pept        complement(669459..670571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03145"
FT                   /product="hypothetical protein"
FT                   /note="COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70045"
FT                   /protein_id="ADN70045.1"
FT                   /translation="MIWQLTDDKRWSALRQRFSWVEEMHHTPQDPEHHGEGDVGVHTEM
FT                   VLNALITLPEFQQLPAQQQEVLWAAALLHDVEKRSTTVQENGRIQSPGHARRGELTARQ
FT                   ILWRDIPTPFVLREQIVALVRLHGLPLWLLERPEPERLLLTAAMRIDTRLLALLARADL
FT                   LGRQSPDQQSMLERIDLFELFCHEQQCWGKMRPFVSDSARWHYLTHEQSSPDFVPWEAE
FT                   PFEVILLCGLPGMGKDRYINEQCQGMDVISLDDMRRRINASPDDKTATGRIVQQAKEEA
FT                   RVFLRQKKPFIWNATNITRQLRSQLISLFTAYGARVKIVYLEVPWAQWKQQNARREYAV
FT                   PEAVMMRMASRLEVPQLDEAHSVEYRMTDR"
FT   gene            complement(670568..671275)
FT                   /locus_tag="UM146_03150"
FT   CDS_pept        complement(670568..671275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70046"
FT                   /protein_id="ADN70046.1"
FT                   /translation="MNTQRKYGRTWHYPFSPGTTSDDRINADYWQDLQAITQLVHTEKL
FT                   DGENNCLNRYGVFARSHAAPTQSAWTYKIRQRWQLLKNDLGDLELFGENLYAVHSIEYR
FT                   ALEQDFYLFAVRCQDMWLSWEEVQFYAALFDFPCVPEISGPQPGNDEKSWQRDFLALTN
FT                   ARGTFDPWDTQTCQPCTLEGIVSRNHDAFSVADFSHNVFKYVRKNHVKTTVHWKRHWQR
FT                   ARMAHEFVYGEQS"
FT   gene            complement(671533..673071)
FT                   /locus_tag="UM146_03155"
FT   CDS_pept        complement(671533..673071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03155"
FT                   /product="multidrug efflux system protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70047"
FT                   /protein_id="ADN70047.1"
FT                   /translation="MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLG
FT                   SSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNM
FT                   LIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISD
FT                   NYHWGWIFFINVPIGVAVVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDR
FT                   GKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNFTIGCLCISLAY
FT                   MLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFS
FT                   FIMYAVCFYWRAYTFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAAS
FT                   SLSNFTRTLAGSIGTSITTTMWTNRESLHHAQLTESVNPFNPNAQAMYSQLEGLGMTQQ
FT                   QASGWIAQQITNQGLIISANEIFWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH"
FT   gene            complement(673088..674260)
FT                   /locus_tag="UM146_03160"
FT   CDS_pept        complement(673088..674260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03160"
FT                   /product="multidrug efflux system protein EmrA"
FT                   /note="COG1566 Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70048"
FT                   /protein_id="ADN70048.1"
FT                   /translation="MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLV
FT                   LRHFEETDDAYVAGNQIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKA
FT                   KTALASSVRQTHQLMINSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHA
FT                   RDAVTSAQAQLDVAIQQYNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIVSPM
FT                   TGYVSRRAVQPGAQISPTTPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGD
FT                   DVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLS
FT                   TLVSVNTTNRDGQVLANKVRSTPVAVSTAREISLAPVNKLIDDIVKANAG"
FT   gene            complement(674387..674917)
FT                   /locus_tag="UM146_03165"
FT   CDS_pept        complement(674387..674917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03165"
FT                   /product="transcriptional repressor MprA"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70049"
FT                   /protein_id="ADN70049.1"
FT                   /translation="MDSSFTPIEQMLKFRASRHEDFPYQEILLTRLCMHMQSKLLENRN
FT                   KMLKAQGINETLFMALITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIERR
FT                   ESDNDRRCLHLQLTEKGHEFLREVLPPQHNCLHQLWSALSTTEKDQLEQITRKLLSRLD
FT                   QMEQDGVVLEAMS"
FT   gene            complement(675008..675343)
FT                   /locus_tag="UM146_03170"
FT   CDS_pept        complement(675008..675343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70050"
FT                   /protein_id="ADN70050.1"
FT                   /translation="MSYEVLLLGLLVGTANYCFRYLPLRLRVGNARPTKRGAIGILLDT
FT                   IGIASICALLVVSTAPEVMHDTRRFVPTLVGFAVLGASFYKTRSIIIPTLLSALAYGLA
FT                   WKVMAII"
FT   gene            complement(675333..676070)
FT                   /locus_tag="UM146_03175"
FT   CDS_pept        complement(675333..676070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03175"
FT                   /product="putative transporter"
FT                   /note="COG1296 Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70051"
FT                   /protein_id="ADN70051.1"
FT                   /translation="MESPTPQPAPGSATFMEGCKDSLPIVISYIPVAFAFGLNATRLGF
FT                   SPLESVFFSCIIYAGASQFVITAMLAAGSSLWIAALTVMAMDVRHVLYGPSLRSRIIQR
FT                   LQKSKTALWAFGLTDEVFAAATAKLVRNNRRWSENWMIGIAFSSWSSWVFGTVIGAFSG
FT                   SGLLQGYPAVEAALGFMLPALFMSFLLASFQRKQSLCVTAALVGALAGVTLFSIPVAIL
FT                   AGIVCGCLTALIQAFWQGAPDEL"
FT   gene            complement(676194..677378)
FT                   /locus_tag="UM146_03180"
FT   CDS_pept        complement(676194..677378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03180"
FT                   /product="putative transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70052"
FT                   /protein_id="ADN70052.1"
FT                   /translation="MTKPNHELSPALIVLMSIATGLAVASNYYAQPLLDTIARNFSLSA
FT                   SSAGFIVTAAQLGYAAGLLFLVPLGDMFERRRLIVSMTLLAAGGMLITASSQSLAMMIL
FT                   GTALTGLFSVVAQILVPLAATLASPDKRGKVVGTIMSGLLLGILLARTVAGLLANLGGW
FT                   RTVFWVASMLMALMALALWRGLPQMKSETHLNYPQLLGSVFSMFISNKILRTRALLGCL
FT                   TFANFSILWTSMAFLLAAPPFNYSDGVIGLFGLAGAAGALGARPAGGFADKGKSHHTTT
FT                   FGLLLLLLSWLAIWFGHTSVLALIIGILVLDLTVQGVHITNQTVIYRIHPDARNRLTAG
FT                   YMTSYFIGGAAGSLISASAWQHGGWAGVCLAGATIALVNLLVWWRGFHRQEAAN"
FT   gene            complement(677570..678562)
FT                   /gene="proX"
FT                   /locus_tag="UM146_03185"
FT   CDS_pept        complement(677570..678562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proX"
FT                   /locus_tag="UM146_03185"
FT                   /product="glycine betaine transporter periplasmic subunit"
FT                   /note="COG2113 ABC-type proline/glycine betaine transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70053"
FT                   /protein_id="ADN70053.1"
FT                   /translation="MRHSVLFATAFATLISTQTFAADLPGKGITVNPVQSTITEETFQT
FT                   LLVSRALEKLGYTVNKPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFY
FT                   REGVFVNGAAQGYLIDKKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGC
FT                   EGAINHQLAAYGLTNTVTHNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGK
FT                   DVVWLQVPFSALPGDKNADTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQL
FT                   PVADINAQNAIMHDGKASEDDIQGHVDGWIKAHQQQFDGWVNEALAAQK"
FT   gene            complement(678620..679684)
FT                   /locus_tag="UM146_03190"
FT   CDS_pept        complement(678620..679684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03190"
FT                   /product="glycine betaine transporter membrane protein"
FT                   /note="COG4176 ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70054"
FT                   /protein_id="ADN70054.1"
FT                   /translation="MADQNNPWDTTPAADSAAQSADAWGTPATAPTDGGGADWLTSTPA
FT                   PNVEHFNILDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGM
FT                   PAPVAIIVFALIAWQISGVGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIG
FT                   LPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPI
FT                   IRLTILGINQVPADLIEASRSFGASPSQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVI
FT                   ASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWY
FT                   TTGPVGLLTRPFIK"
FT   gene            complement(679677..680879)
FT                   /locus_tag="UM146_03195"
FT   CDS_pept        complement(679677..680879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03195"
FT                   /product="glycine betaine transporter ATP-binding subunit"
FT                   /note="COG4175 ABC-type proline/glycine betaine transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70055"
FT                   /protein_id="ADN70055.1"
FT                   /translation="MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVK
FT                   DASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVR
FT                   RKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPD
FT                   ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFIS
FT                   HDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIAR
FT                   RTPNGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGAVSIDSLKAALTQQQGLD
FT                   AALIDAPLAVDAQTPLSELLSHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNN
FT                   G"
FT   gene            complement(681235..682194)
FT                   /gene="nrdF"
FT                   /locus_tag="UM146_03200"
FT   CDS_pept        complement(681235..682194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="UM146_03200"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208 Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70056"
FT                   /protein_id="ADN70056.1"
FT                   /translation="MKLSRISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAW
FT                   QTLSVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARS
FT                   YSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFY
FT                   SGFWLPMYFASRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNQEKISQAQREELKSFA
FT                   FDLLLELYDNELQYTDELYAETPWSDDVKAFLCYNANKVLMNLGYEPLFPAEMAEVNPA
FT                   ILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF"
FT   gene            complement(682204..684348)
FT                   /locus_tag="UM146_03205"
FT   CDS_pept        complement(682204..684348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03205"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0209 Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70057"
FT                   /protein_id="ADN70057.1"
FT                   /translation="MATTTAERLTQETMDYHALNAMLNLYDSAGRIQFDKDSQAVDAFM
FT                   TTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLG
FT                   AWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPT
FT                   FLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIK
FT                   RIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKI
FT                   RIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISEHYDELVADERI
FT                   RKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANPIAGRINMSNLCSEILQVNSASE
FT                   YDENLDYARTGHDISCNLGSLNIAHTMDSPDFARTVETAVRGLTAVSDMSHIRSVPSIE
FT                   AGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERG
FT                   ETFAGFKQSRYASGEYFSQYLQGNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRY
FT                   GIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY
FT                   QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYI
FT                   RLRQMALEGTEIEGCVSCAL"
FT   gene            complement(684321..684731)
FT                   /gene="nrdI"
FT                   /locus_tag="UM146_03210"
FT   CDS_pept        complement(684321..684731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="UM146_03210"
FT                   /product="ribonucleotide reductase stimulatory protein"
FT                   /note="COG1780 Protein involved in ribonucleotide
FT                   reduction"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70058"
FT                   /protein_id="ADN70058.1"
FT                   /translation="MSQLVYFSSSSENTQRFIERLGLPAVRIPLNERERIQVDEPYILI
FT                   VPSYGGGGTAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCSVP
FT                   WLYRFELMGTQSDIENVRKGVTEFWQRQPQNA"
FT   gene            complement(684728..684973)
FT                   /locus_tag="UM146_03215"
FT   CDS_pept        complement(684728..684973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03215"
FT                   /product="glutaredoxin-like protein"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70059"
FT                   /protein_id="ADN70059.1"
FT                   /translation="MRITIYTRNDCVQCHATKRAMENRGFDFEMINVDRVPEAAEALRA
FT                   QGFRQLPVVIAGDLSWSGFRPDMINRLHPAPHAASA"
FT   gene            complement(685182..685613)
FT                   /locus_tag="UM146_03220"
FT   CDS_pept        complement(685182..685613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03220"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70060"
FT                   /protein_id="ADN70060.1"
FT                   /translation="MTTLRQPYYELSPAVYNALVQAKTALENSTLDTTLMELVYLRVSQ
FT                   INGCAFCLEMHSKALRKSGVPQHKLDALAGWRVSHHFDERERAALAWAESVTEIARTHA
FT                   EDEVYQPLLEHFSAAEISDLTFAIGLMNCFNRLAVSMRM"
FT   gene            685701..687035
FT                   /locus_tag="UM146_03225"
FT   CDS_pept        685701..687035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03225"
FT                   /product="putative fused protein:
FT                   aminotransaminase/transcriptional regulator, GntR family"
FT                   /note="COG1167 Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70061"
FT                   /protein_id="ADN70061.1"
FT                   /translation="MPRYQDIARQLKTAIEQGELKPGARLPSSRTWSQELGVSRSTVEN
FT                   AYAELVAQGWLIRRGQAGTFVSERIYPQQSTVQVVAFAGESQQPLPFQMGLPALDLFPR
FT                   ELWARVMGRRLRTQTRFDLALGDVCGEAALREAIVDYLRVSRGIDCQPEQVFITHGYAA
FT                   SIALILHALAKPGNGMWIEDPGFPLIRPIVTRHDVEILPVPVDDNGLDITSGIQNYPDA
FT                   RFALITPAHQSPLGVALSLARRHQILEWADRSQAWIIEDDYDSEFRYHGKPLPALKSLD
FT                   APQRVIYAGTFSKALFPALRCAWLVVPVKQIAQFRHQASLAPCAVPVLWQNTLADFLRE
FT                   GHFWRHLKKMRQHYAQRRQWIEQALTQQGFQVVPQKGGIQMVIRMIGDDIAHARKANAA
FT                   GLAVQALSDWRIRSSGEGGLLLSFTNIVNEGMARQVAQQLRKALS"
FT   gene            complement(687092..687421)
FT                   /locus_tag="UM146_03230"
FT   CDS_pept        complement(687092..687421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03230"
FT                   /product="hypothetical protein"
FT                   /note="COG4575 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70062"
FT                   /protein_id="ADN70062.1"
FT                   /translation="MFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEA
FT                   ARSKAQALLKETRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALL
FT                   SMRKS"
FT   gene            687573..687917
FT                   /locus_tag="UM146_03235"
FT   CDS_pept        687573..687917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70063"
FT                   /protein_id="ADN70063.1"
FT                   /translation="MYLRPDEVARVLEKVGFTVDVVTQKAYGYRRGENYVYVNREARMG
FT                   RTALVIHPTLKERSSTLAEPASDIKTCDHYQQFPLYLAGERHEHYGIPHGFSSRVALER
FT                   YLNGLFGEAS"
FT   gene            complement(687954..688403)
FT                   /locus_tag="UM146_03240"
FT   CDS_pept        complement(687954..688403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70064"
FT                   /protein_id="ADN70064.1"
FT                   /translation="MFSPQSRLRHAVADTFAMVVYCSVVNMCIEVFLSGMSFEQSFYSR
FT                   LVAIPVNILIAWPYGMYRDLFMRAARKVSPSGWIKNLADIMAYVTFQSPVYVAILLVVG
FT                   ADWHQIMAAVSSNIVVSMLMGAVYGYFLDYCRRLFKVSRYQQVKA"
FT   gene            689071..689475
FT                   /locus_tag="UM146_03245"
FT   CDS_pept        689071..689475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03245"
FT                   /product="DNA binding protein, nucleoid-associated"
FT                   /note="COG2916 DNA-binding protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70065"
FT                   /protein_id="ADN70065.1"
FT                   /translation="MSVMLQSLNNIRTLRAMAREFSIDVLEEMLEKFRVVTKERREEEE
FT                   QQQRELAERQEKISTWLELMKADGINPEELLGDSSAAAPRAGKKRQPRPAKYKFIDVNG
FT                   ETKTWTGQGRTPKPIAQALAEGKSLDDFLI"
FT   gene            complement(689903..690046)
FT                   /locus_tag="UM146_03250"
FT   CDS_pept        complement(689903..690046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03250"
FT                   /product="hypothetical protein"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70066"
FT                   /protein_id="ADN70066.1"
FT                   /translation="MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSV
FT                   LE"
FT   gene            complement(690056..690355)
FT                   /locus_tag="UM146_03255"
FT   CDS_pept        complement(690056..690355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03255"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70067"
FT                   /protein_id="ADN70067.1"
FT                   /translation="MTELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELT
FT                   RITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP"
FT   gene            690538..690696
FT                   /locus_tag="UM146_03260"
FT   CDS_pept        690538..690696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03260"
FT                   /product="hypothetical protein"
FT                   /note="COG0401 Uncharacterized homolog of Blt101"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70068"
FT                   /protein_id="ADN70068.1"
FT                   /translation="MGFWRIVITIILPPLGVLLGKGFGWAFIINILLTLLGYIPGLIHA
FT                   FWVQTRD"
FT   gene            690780..691229
FT                   /locus_tag="UM146_03265"
FT   CDS_pept        690780..691229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03265"
FT                   /product="LysM domain/BON superfamily protein"
FT                   /note="COG1652 Uncharacterized protein containing LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70069"
FT                   /protein_id="ADN70069.1"
FT                   /translation="MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADK
FT                   VNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYTVKSG
FT                   DTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE"
FT   gene            complement(691230..691892)
FT                   /locus_tag="UM146_03270"
FT   CDS_pept        complement(691230..691892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03270"
FT                   /product="DNA-binding transcriptional regulator CsiR"
FT                   /note="COG1802 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70070"
FT                   /protein_id="ADN70070.1"
FT                   /translation="MTITSLDGYRWLKNDIIRGNFQPDEKLRMSLLTSRYALGVGPLRE
FT                   ALSQLVAERLVTVVNQKGYRVASMSEQELLDIFDARANMEAMLVSLAIARGGDEWEADV
FT                   LAKAHLLSKLEACDASEKMLDEWDLRHQAFHTAIVAGCGSYYLLQMRERLFDLAARYRF
FT                   IWLRRTVLSVEMLEDKHDQHQTLTATVLARDTARASELMRQHLLTPIPIIQQAMAGN"
FT   gene            complement(691913..693313)
FT                   /locus_tag="UM146_03275"
FT   CDS_pept        complement(691913..693313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03275"
FT                   /product="gamma-aminobutyrate transporter"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70071"
FT                   /protein_id="ADN70071.1"
FT                   /translation="MGQSSQPHELGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGP
FT                   AVLLAYLFAGLLVVMIMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVL
FT                   VIPLEANIAAMILHSWVPGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAI
FT                   LAFIFLGAVAISGFYPYADVSGISRLWDSGGFMPNGFGAVLSAMLITMFSFMGAEIVTI
FT                   AAAESDTPEKHIVRATNSVIWRISIFYLCSIFVVVALIPWNMPGLKAVGSYRSVLELLN
FT                   IPHAKLIMDCVILLSVTSCLNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVLL
FT                   STGAAFLTVVVNYYAPAKVFKFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSEIRLR
FT                   MWLYPWLTWLVIGFITFVLVVMLFRPAQQLEVLSTGLLAIGIICTVPIMARWKKLIMWQ
FT                   KTPIHNTR"
FT   gene            complement(693551..694831)
FT                   /locus_tag="UM146_03280"
FT   CDS_pept        complement(693551..694831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03280"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70072"
FT                   /protein_id="ADN70072.1"
FT                   /translation="MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLD
FT                   FAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKK
FT                   TLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMP
FT                   GHVYRALYPCPLHGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFM
FT                   QRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTG
FT                   RAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAE
FT                   KHTEIGDVRGLGAMIAIELFEDGDHSKPDAKLTAEIVARARDKGLILLSCGPYNNVLRI
FT                   LVPLTIEDAQIRQGLEIISQCFAEAKQ"
FT   gene            complement(694845..696293)
FT                   /gene="gabD"
FT                   /locus_tag="UM146_03285"
FT   CDS_pept        complement(694845..696293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="UM146_03285"
FT                   /product="succinate-semialdehyde dehydrogenase I"
FT                   /EC_number="1.2.1.16"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70073"
FT                   /protein_id="ADN70073.1"
FT                   /translation="MKLNDSNLFRQQALINGEWLDANNGEVIDVTNPANGDKLGSVPKM
FT                   GADETRAAIDAANRALPVWRALTAKERANILRNWFNLMMEHQDDLARLMTLEQGKPLAE
FT                   AKGEISYAASFIEWFAEEGKRIYGDTIPGHQADKRLIVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSALALAELAIRAGVPAGVFNVVTGSAGAVGNELTS
FT                   NPLVRKLSFTGSTEIGRQLMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASK
FT                   FRNAGQTCVCANRLYVQNGVYDRFAEKLQQAVSKLHIGNGLEKGVTIGPLIDEKAVAKV
FT                   EEHIADALEKGARVVCGGKAHERGGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKD
FT                   EADVIAQANDTEFGLAAYFYARDLSRVFRVGEALEYGIIGINTGIISNEVAPFGGIKAS
FT                   GLGREGSKYGIEDYLEIKYMCIGL"
FT   gene            complement(696316..697584)
FT                   /locus_tag="UM146_03290"
FT   CDS_pept        complement(696316..697584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03290"
FT                   /product="hydroxyglutarate oxidase"
FT                   /note="COG0579 Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70074"
FT                   /protein_id="ADN70074.1"
FT                   /translation="MYDFLIIGGGIIGMSTAMQLIDVYPDARIALLEKEPGPACHQTGH
FT                   NSGVIHAGVYYTPGSLKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRA
FT                   LWERTAANGIDREWLNAEELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGG
FT                   EIIYNAEVSALSEHKNGVVICTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPF
FT                   RGEYFRLAPEHNQIVNHLIYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRK
FT                   RDFSFSDTLEILGSSGIRRVLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQP
FT                   WPAGVRAQAVSPDGKLIDDFLFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLAS
FT                   QSNPGRTLRAARSVDALHAAFNQ"
FT   gene            complement(697604..698581)
FT                   /locus_tag="UM146_03295"
FT   CDS_pept        complement(697604..698581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70075"
FT                   /protein_id="ADN70075.1"
FT                   /translation="MNALTAVQNNAVDSGQDYSGFTLIPSAQSPRLLELTFTEQTTNRF
FT                   LEQVAEWPVQALEYKSFLRFRVGKILDDLCANQLQPLLLKTLLNRAEGALLINAVGIDD
FT                   VAQADEMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDG
FT                   TYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDWEHLDHFFRHPLARRPMRFAAPPSKNV
FT                   SKDVFHPVFDVDQQGRPVMRYIDQFVQPKDFEEGVWLSELSDAIETSKGILSVPVPVGK
FT                   FLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYATHHYQTHQ"
FT   gene            complement(699213..699449)
FT                   /locus_tag="UM146_03300"
FT   CDS_pept        complement(699213..699449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70076"
FT                   /protein_id="ADN70076.1"
FT                   /translation="MVIAMSFLYDGFIDYLLFIVGYEDWDITVKDTCKIRKIVNVEKII
FT                   NYIKLVIFGLGFNSRQPIMIGRCKDYTNKNRKL"
FT   gene            699442..700353
FT                   /locus_tag="UM146_03305"
FT   CDS_pept        699442..700353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70077"
FT                   /protein_id="ADN70077.1"
FT                   /translation="MTILVPPSKFCIYSDDSRAGTLNFINSIESIGVKNKGRVIVDLSK
FT                   VKFASAAASVLFFAIVNRAQFLTRDPNFIRFKWPKKDDNPSGHRWIVGTGLARALLAGT
FT                   EEKLNALTREERYFQSAVEPYEHIVETVLMLQKSALLNNEQLGLLLTAISEALLNVSHH
FT                   AYEDEGFESDIQLLKGKRWWQCAWFNRDENKVVFIVCDLGLGIYRSFVPNGDGHSIQNE
FT                   VSSVERAMLVGESRFVGSGRGNGSEDIKRPIGAGCEDNETLLILTGRARYSYNSNDSSP
FT                   RCEKLAEYIPGTLLQWSLVPRR"
FT   gene            700358..700684
FT                   /locus_tag="UM146_03310"
FT   CDS_pept        700358..700684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03310"
FT                   /product="hypothetical protein"
FT                   /note="COG2759 Formyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70078"
FT                   /protein_id="ADN70078.1"
FT                   /translation="MRNIVIAKEFSRTPFGRYTTDSPHSAERFRREFLVPALKGTEQEI
FT                   VVDFRGIALGVGSSFLEEAFGGLIRKEGIPKANVKARLIIKSDVPFYKEQIDKFIDLAQ
FT                   PERV"
FT   gene            700713..701312
FT                   /locus_tag="UM146_03315"
FT   CDS_pept        700713..701312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70079"
FT                   /protein_id="ADN70079.1"
FT                   /translation="MSLVAQIGQYSWCITVVSVCLVFIGWRVAYNNSVKLATRSESKSI
FT                   IDAISKLVIEISDISSNYWLSQTTQPKIRASKHRLLRLQKDRTKASVSYLLTILAKAQQ
FT                   VSKLICILESRGLYIPDEVFSSVLEKATLDCEVAHKLSDADRPVKAQEVIDACMGVIEA
FT                   LHTSFQRYHPPKKDRTFMQRLKIWFQTVDDWHNDLK"
FT   gene            complement(701304..702476)
FT                   /locus_tag="UM146_03320"
FT   CDS_pept        complement(701304..702476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03320"
FT                   /product="hypothetical protein"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70080"
FT                   /protein_id="ADN70080.1"
FT                   /translation="MGQTKLLKLPRGVTIRKHHQGETINITFTYKGVRCREPLSNLEVT
FT                   PKNIKYAERTLGEIHNKIERGTFIYAEYFPRSARLKIFGNAAASKTVKMYLDEYLEICE
FT                   TRKLSPSTIGGYKKCRSALASLHICPASELTPATLKAWIQSQKTTLKTIRNQLSFLRSA
FT                   LDEAVTDGVLQINPVSLVTASRYQSDKSEAESSYVVDPLSPAEVDALLAAAGNKQWENL
FT                   FRFAIHTGLRSSELCALRWHDIDFVGKTAHVQSASVVGVIKGTKTKAGTRKVELTEEAM
FT                   LALINQKPFTFMKDATVFEDPKTNKPWASADAIRKKAWVPTLRKAGIRYRNPYQTRHTF
FT                   ATSHISRGANLFWLAAQMGHKGPEMLFRHYGQYLKEYDGRASIKDKKALF"
FT   gene            complement(702894..703004)
FT                   /locus_tag="UM146_03325"
FT   CDS_pept        complement(702894..703004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70081"
FT                   /protein_id="ADN70081.1"
FT                   /translation="MISSDWHIIMFMSFQNNIKQKFKTMLHYMVFAETYV"
FT   gene            complement(703659..704183)
FT                   /locus_tag="UM146_03330"
FT   CDS_pept        complement(703659..704183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03330"
FT                   /product="hypothetical protein"
FT                   /note="COG1896 Predicted hydrolases of HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70082"
FT                   /protein_id="ADN70082.1"
FT                   /translation="MSFIKTFSGKHFYYDRINKDDIVINDIAVSLSNICRFAGHLSHFY
FT                   SVAQHAVLCSQLVPQEFAFEALMHDATEAYCQDIPAPLKRLLPDYKRMEEKIDAVIREK
FT                   YGLPPVMSTPVKYADLIMLATERRDLGLDDGSFWPVLEGIPATEMFKVIPLSPGHTYGM
FT                   FMERFKELTES"
FT   gene            complement(704311..705135)
FT                   /locus_tag="UM146_03335"
FT   CDS_pept        complement(704311..705135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03335"
FT                   /product="hypothetical protein"
FT                   /note="COG5532 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70083"
FT                   /protein_id="ADN70083.1"
FT                   /translation="MSQNLDATAINQIHALISAQGVNEIISKIGADAVALPENFRIHDL
FT                   EKFNLNRFRFRGALSTASIDDFTRYSKDLADEGTRCFIDADNMRAVSVLNLGTIDEPGH
FT                   ADNTATLKLKKTAPFSALLSVNGERNSQKSLAEWIEDWADYLVGFDANGDAIQATKAAA
FT                   AVRKITIEANQTADFEDNDFSGKRSLMESVEAKTKDIMPVAFEFKCVPFEGLKERPFKL
FT                   RLSIITGDRPVLVLRIIQLEAVQEEMANEFRDLLVEKFKDSKVETFIGTFTA"
FT   gene            706032..706544
FT                   /locus_tag="UM146_03340"
FT   CDS_pept        706032..706544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70084"
FT                   /protein_id="ADN70084.1"
FT                   /translation="MGAIYVKRLILSVALIIPIASNASDALNQPSSSLNDGVETFFISC
FT                   FDMPQETTTDMDACQRVQLAQVSWVKNKYSVAALNRLKQDNKDDPQRLQELTASFNAES
FT                   EAWTELIEKASKSVQVDYAGGTIAGTAVASRQIGLLELQSHDIWEHWLRFEDSTPPLLP
FT                   EPKFKSE"
FT   gene            complement(706747..707421)
FT                   /locus_tag="UM146_03345"
FT   CDS_pept        complement(706747..707421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03345"
FT                   /product="repressor protein phage e14; e14 prophage"
FT                   /note="COG1974 SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70085"
FT                   /protein_id="ADN70085.1"
FT                   /translation="MKTIHDIRRSNARKLRDGVGGNSSFATMIDREPTQTSRFMGDGAT
FT                   KNIGDSMARHIEKCFDLPVGWLDQEHQTTNITKKPDVSITNKQITLVPVISWVQAGAWK
FT                   EVGYSEVDLSTAETYPCPVPCGEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDV
FT                   IALMHDTGETTFKRLIEDGTQRYLKALNPNWPEPYIKINGNCSIIGTVIFSGKPRRYKI
FT                   KA"
FT   gene            707512..707712
FT                   /locus_tag="UM146_03350"
FT   CDS_pept        707512..707712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03350"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70086"
FT                   /protein_id="ADN70086.1"
FT                   /translation="MKAYWDSLTKEQQGELAGKVGSTPGYLRLVFNGYKKASFVLAKKL
FT                   EQCTSGAITKSDLRPDIYPKD"
FT   gene            707756..708307
FT                   /locus_tag="UM146_03355"
FT   CDS_pept        707756..708307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03355"
FT                   /product="putative nucleic acid-binding protein; e14
FT                   prophage"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70087"
FT                   /protein_id="ADN70087.1"
FT                   /translation="MGKHHWKIEKQPEWYVKAVRKTIAALPGGYAEAADWLDVTENALF
FT                   NRLRADGDQIFPLGWAMVLQRAGGTHFIADAVAQSANGVFVSLPDVEDVDNADINQRLL
FT                   EVIEQIGSYSKQIRSAIEDGVVEPHEKTAINDELYLSISKLQEHAALVYKIFCVSESSD
FT                   ARECAAPGAVACRDCGETNA"
FT   gene            708304..708642
FT                   /locus_tag="UM146_03360"
FT   CDS_pept        708304..708642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70088"
FT                   /protein_id="ADN70088.1"
FT                   /translation="MNSLTTHYRRSQLIALPVPGGKAKVEYCYAVNVPGDREIVTHSFA
FT                   EWAVGDFNRQKETVLCDKLTAGSKITTECPSESFVGNRKHNGLSTSAKAMSMNASVRSN
FT                   SFVVNSGK"
FT   misc_feature    708652..709592
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218559632|ref|YP_002392545.1| putative phage replication
FT                   protein O"
FT   gene            709589..710083
FT                   /locus_tag="UM146_03375"
FT   CDS_pept        709589..710083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70089"
FT                   /protein_id="ADN70089.1"
FT                   /translation="MIMSLLNDVQKFIEAHPGCTSGDIADAFAGYSRQRVLQSASKLRQ
FT                   SGRVAHRCEGDTRRHFPRLTERAQEPEPQPVRETRPVRNFYVGTNDPRVILCLTRQAEE
FT                   LESRGLYRRAATVWMAAFRESHSQPERNNFLARRERCLRKSSKRAASGEEWYLSGNYVG
FT                   A"
FT   gene            710083..710736
FT                   /locus_tag="UM146_03380"
FT   CDS_pept        710083..710736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03380"
FT                   /product="putative AdoMet-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70090"
FT                   /protein_id="ADN70090.1"
FT                   /translation="MSNKYCQALVELRNKPAHELKEVGDQWRTPDNIFWGINTLFGPFV
FT                   LDLFTDGGNAKCAAYYTAEDNALAHDWSERLAELKGAAFGNPPYSRASQHEGQYITGMR
FT                   YIMKHASAMRDKGGRYVFLIKAATSEVWWPEDADHIAFIRGRIGFELPVWFIPKDEKQV
FT                   PTGAFFAGAIAVFDKTWKGPAISYIGRDELEACGEAFLAQVRQQAEKLLREMAA"
FT   gene            710733..711059
FT                   /locus_tag="UM146_03385"
FT   CDS_pept        710733..711059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03385"
FT                   /product="putative regulatory protein"
FT                   /note="COG1974 SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases); lexA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70091"
FT                   /protein_id="ADN70091.1"
FT                   /translation="MTTLTQCQQQVLDMLISYQKERGFPPTNQEVATMLGYRSVNAAVE
FT                   HLRALEKKGVITIKRGVARGITLHTAVKDDDSEAVGIIRSLLAGKENARLRAAHWLHER
FT                   GLKV"
FT   gene            711056..711445
FT                   /locus_tag="UM146_03390"
FT   CDS_pept        711056..711445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03390"
FT                   /product="Crossover junction endodeoxyribonuclease"
FT                   /note="COG4570 Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70092"
FT                   /protein_id="ADN70092.1"
FT                   /translation="MKLILPFPPSVNTYWRHPNKGAFAGKSLISAAGRKFQSAACAAIV
FT                   EQLRRLPKPTSAPASVEIVLFPPDNRIRDLDNYNKALFDALTHAGVWEDDSQVKRMLVE
FT                   WGPVIPEGKVEITISKYEKTAGAAA"
FT   gene            711465..712262
FT                   /locus_tag="UM146_03395"
FT   CDS_pept        711465..712262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03395"
FT                   /product="putative KilA protein"
FT                   /note="KilA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70093"
FT                   /protein_id="ADN70093.1"
FT                   /translation="MNNLMVIDGIEVRRDAYGRYSLNDLHRAAGSLDKHKPAFWLRNEQ
FT                   TERLISELQICNSVNIEPVNVIRGGNNQGTYVCKELVYAYAMWISPSFHLKVIRTFDMV
FT                   TSTPEKLSGQAADKMQAGVILLDFMRRELNLSNSSVLGACQKLQEAVGLPNLAPRYAID
FT                   APADAPDGSSRPTLSLSALLKQYGIRLTANQAYHQMAKLGIVEQRERYSRTAINNIKKF
FT                   WSLTAKGCMFGKNITSPANPRETQPHFFESRFPELLKLLDTVH"
FT   gene            712270..713259
FT                   /locus_tag="UM146_03400"
FT   CDS_pept        712270..713259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70094"
FT                   /protein_id="ADN70094.1"
FT                   /translation="MRALLTPEIAPRMGIVLFRPGSELMPLFMQGRVLLEPEPERYSSF
FT                   ASGAVPAASQPLADDPAIRAVFRNEAVIRRAGGVECLESWLLREKGCQWPHSGWHSENM
FT                   TTMRHAPGAIRLCWHCDNLLRDQFTERLESMATDNCARWVLSVVRRDLGFDDSHVVTMP
FT                   ELCWWLVRNDLADALPESAARKALRLPKPVVPSVTRESDLVPSVPATSIIQDKAKKVLA
FT                   LKVDPESPESFMLRPKRRRWVNEKYTRWVKTQSCACCGKPADDPHHLIGHGQGGMGTKA
FT                   HDLFVLPLCRKHHDELHADTVAFEEMYGSQLELIFRFIDRALAIGVLV"
FT   gene            713273..714025
FT                   /locus_tag="UM146_03405"
FT   CDS_pept        713273..714025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03405"
FT                   /product="putative antitermination protein Q; Qin prophage"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70095"
FT                   /protein_id="ADN70095.1"
FT                   /translation="MNLEALPKYYSPKSPKLSDDASATGSGGLTITDVMAAQGMVQSKA
FT                   PLGFALFLAKVGVQDPQFAIEGLLNYAMALDNPTLNKLSEETRLQIIPYLVNFAFADYS
FT                   RSAASKARCEHCTGTGFHNVLREVVKHSRSGESVIKEEWVKELCQHCHGKGEVSTACRG
FT                   CKGKGIVLDEKRTRLHGTPVYKTCGRCNGNRFSRLPTTLARRHVQKLVPDLTDYQWYKG
FT                   YADVIDKLVTKCWQEEAYAETQLRKVTR"
FT   gene            714211..714546
FT                   /locus_tag="UM146_03410"
FT   CDS_pept        714211..714546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70096"
FT                   /protein_id="ADN70096.1"
FT                   /translation="MINAVEYRLPLGNISPENLDALSELIVKHSDKFNNYVLSSISDDD
FT                   IRYSYDYYNFEITEIDEYGFHFIAPYSYYEGCVDNNFSGEVEGYAEYEIIDNELVFSLE
FT                   ELPWDVK"
FT   gene            714906..715004
FT                   /locus_tag="UM146_03415"
FT   CDS_pept        714906..715004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03415"
FT                   /product="gp13"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70097"
FT                   /protein_id="ADN70097.1"
FT                   /translation="MILATAGISGAMGSVALTYFWERLTGVKNAKS"
FT   gene            714991..715467
FT                   /locus_tag="UM146_03420"
FT   CDS_pept        714991..715467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03420"
FT                   /product="Lysozyme (Lysis protein) (Muramidase)
FT                   (Endolysin)"
FT                   /note="COG4678 Muramidase (phage lambda lysozyme)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70098"
FT                   /protein_id="ADN70098.1"
FT                   /translation="MQNLNPQRKAFLDMVAWSEGTDNGLQPTRNHGYDVIVGGEIFTDY
FT                   SDHPRRLVTLNPKLKSTAAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGA
FT                   LPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVKEIQV"
FT   gene            715464..715901
FT                   /locus_tag="UM146_03425"
FT   CDS_pept        715464..715901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03425"
FT                   /product="endopeptidase; bacteriophage lysis protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70099"
FT                   /protein_id="ADN70099.1"
FT                   /translation="MSRVTVIISALVICIIVCLSWAVDNYRDDAIVYKVQRDKATSIIA
FT                   DMQKRQRNVAELDARYTKELADANATIESLRADVSAGHKRLQVAATCTKSTTGASGMGD
FT                   GESPRLTADAELHYYRLRSGIDKITSQVNYLQEYIRTQCPN"
FT   gene            715999..716223
FT                   /locus_tag="UM146_03430"
FT   CDS_pept        715999..716223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70100"
FT                   /protein_id="ADN70100.1"
FT                   /translation="MRIKPQDFKFDVLTVAGYANPKAKTHFAPSASGFNFKWEWEGKIY
FT                   ELHIEQEKLQYPDFILERLFDAAIEMAKK"
FT   gene            complement(716602..716769)
FT                   /locus_tag="UM146_03435"
FT   CDS_pept        complement(716602..716769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70101"
FT                   /protein_id="ADN70101.1"
FT                   /translation="MSIPSLDVHKVVKCAEHKKALDAISLKLKNNIIDSSSEYDFLGDT
FT                   IIFNKDKKIG"
FT   gene            716872..717222
FT                   /locus_tag="UM146_03440"
FT   CDS_pept        716872..717222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03440"
FT                   /product="putative endonuclease"
FT                   /note="COG1403 Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70102"
FT                   /protein_id="ADN70102.1"
FT                   /translation="MPPRTPKACRVRGCRQTTTDPSGYCESHKSEGWKQYKPGQSRHQR
FT                   GYGSKWDVIRARVLKRDKGLCQLCLHVGVVREAKTVDHIIPKAHGGTDADCNLQSLCWP
FT                   CHKAKTARERLK"
FT   misc_feature    717347..717840
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218559617|ref|YP_002392530.1| putative phage terminase,
FT                   small subunit"
FT   gene            717837..719570
FT                   /locus_tag="UM146_03455"
FT   CDS_pept        717837..719570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03455"
FT                   /product="putative phage terminase"
FT                   /note="COG4626 Phage terminase-like protein, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70103"
FT                   /protein_id="ADN70103.1"
FT                   /translation="MSRKSYPNVNAANQYARDVVRGKIVACQFVIQACQRHLDDLMAEK
FT                   SKSFRYRFDKDLAERAAKFIQLLPHTKGEWAFKRMPITLEPWQLFVICCAFGWVNKGSR
FT                   LRRFREVYTEIPRKNGKSAISAGVALYCFACDNEFGAEVYSGATTEKQAWEVFRPARLM
FT                   CKRTPMLTEAFGIEVNASNMNRPEDGARFEPLIGNPGDGSSPHCAVVDEYHEHATDALY
FT                   TTMLTGMGARRQPLMWAITTAGYNIEGPCYDKRREVIEMLNGSVPNDELFGIIYTVDEG
FT                   DDWTDPQVLEKANPNIGVSVYREFLLSQQQRAKNNARLANVFKTKHLNIWVSARSAYFN
FT                   LVSWQSCEDKSLTLEQFEGQPCILAFDLARKLDMNSMARLYTREIDGKTHYYSVAPRFW
FT                   VPYDTVYSVEKNEDRRTAERFQKWVEMGVLTVTDGAEVDYRYILEEAKAANKISPVSES
FT                   PIDPFGATGLSHDLADEDLNPITIIQNYTNMSDPMKELEAAIESGRFHHDGNPIMTWCI
FT                   GNVVGKTIPGNDDVVKPVKEQAENKIDGAVALIMAVGRAMLYEKEDTLSDHIESYGIRS
FT                   L"
FT   gene            719582..719764
FT                   /locus_tag="UM146_03460"
FT   CDS_pept        719582..719764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70104"
FT                   /protein_id="ADN70104.1"
FT                   /translation="MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLV
FT                   ARYLDRTQLSVGGGK"
FT   gene            719764..721005
FT                   /locus_tag="UM146_03465"
FT   CDS_pept        719764..721005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03465"
FT                   /product="putative phage portal protein"
FT                   /note="COG4695 Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70105"
FT                   /protein_id="ADN70105.1"
FT                   /translation="MFFSGLFQRKSDAPVTTPAELAEAIGLSYDTYTGKQISSQRAMRL
FT                   TAVFSCVRVLAESVGMLPCNLYHLNGSLKQRATGERLHKLISTHPNGYMTPQEFWELVV
FT                   TCLCLRGNFYAYKVKAFGEVAELLPVDPGCVVPKLNSSWEPVYQVTFSDGSTDVLSQED
FT                   IWHVRTLTLDGLVGLNPIAYAREAISLAAATEEHGARLFSNGAVTSGVLRTEQTLSDQA
FT                   YERLKKDFEERHTGLGNAHRPMILEMGLDWKSMALNAEDSQFLETRKFQLEEICRLFRV
FT                   PLHMVQNTDRATFNNIEELGLGFINYSLVPYLTRIEQRINTGLVRKSKQGVYYAKFNAG
FT                   ALLRGDMKSRFEAYATGINWGIYSPNDCRDLEDMNPRPGGDVYLTPMNMTTKPSDGSKA
FT                   GKQKDNANADETTS"
FT   gene            720983..721633
FT                   /locus_tag="UM146_03470"
FT   CDS_pept        720983..721633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03470"
FT                   /product="putative phage pro-head protease"
FT                   /note="COG3740 Phage head maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70106"
FT                   /protein_id="ADN70106.1"
FT                   /translation="MQTKQRLDVPLSLKSVSDSGEFEGYGSVFGVKDSHDDVVMSGAFA
FT                   ASLRAWSDRKALPALLWQHRMDEPIGVYTEMKEDDVGLYVRGRLLIDDDPLAKRAHAHM
FT                   KAGSLTGLSIGYVLKDWEYDRSKEAFLLKEIDLWEVSLVTFPSNDEARISDVKNALARG
FT                   EIPEQKKIERVLRDVGLSRTQAKAFMAGGYGALSLRDAEDVGSALNALKNLNF"
FT   gene            721648..722853
FT                   /locus_tag="UM146_03475"
FT   CDS_pept        721648..722853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03475"
FT                   /product="putative major capsid protein"
FT                   /note="COG4653 Predicted phage phi-C31 gp36 major
FT                   capsid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70107"
FT                   /protein_id="ADN70107.1"
FT                   /translation="MAVDIKDVEQVAQELQQKFDDFKAKNDKRVDAIEQEKGKLAGQVE
FT                   TLNGKLSELENLKSDLEKELLELKRPAGGAQNKLATEHKEAFVGFLRKGREDGLRDLER
FT                   KALQVGTDEDGGYAVPEALDRNILTLLKDEVVMRQEATVITVGGSDYKKLVNLGGTASG
FT                   WVGETDARSQTATSKLGLIEPFMGEIYGNPQATQKMLDDAFFNVEAWINSELATEFAEQ
FT                   EEIAFTTGDGTKKPKGFLAYESTDETDKVRAFGKLQHIVSGEATAVTADAIIKLIYTLR
FT                   KAHRTGAKFMMNNNSLFAIRLLKDSEGNYLWRPGLELGQPSSLAGYGIAENEQMPDIAA
FT                   DAKAIAFGNFKRGYTIVDRIGTRILRDPYTNKPFVGFYTTKRTGGMLVDSQAIKLLKIA
FT                   AA"
FT   gene            722903..723103
FT                   /locus_tag="UM146_03480"
FT   CDS_pept        722903..723103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70108"
FT                   /protein_id="ADN70108.1"
FT                   /translation="MILKQDLKWSPDGMRVEVIRAGEYDDGALPARVQEIALQAGLAER
FT                   GISAKSSKAAKEKKATTSKEG"
FT   gene            723106..723429
FT                   /locus_tag="UM146_03485"
FT   CDS_pept        723106..723429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70109"
FT                   /protein_id="ADN70109.1"
FT                   /translation="MLLTMEEIKAQLRLDEDFDADDRHLQLLACAAQKRTETYLNRKLY
FT                   APDETIPDSDPDGLHLPDDIRLGMLMLISHFYENRSSVTEVEKLDMPQSFGWLVGPYRY
FT                   FPQ"
FT   gene            723426..723836
FT                   /locus_tag="UM146_03490"
FT   CDS_pept        723426..723836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03490"
FT                   /product="putative phage head-tail adaptor"
FT                   /note="COG5614 Bacteriophage head-tail adaptor"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70110"
FT                   /protein_id="ADN70110.1"
FT                   /translation="MKIRQAQTSATYILPDPGELNKRVLIRLRVDMPADNFGVEPQYLI
FT                   TFRTWAKVIQTSATTWQETAQTGDAITHYITIRYRRGITADYEVVCGDSVYRVKRQRDL
FT                   NGARRFLLLECTELGECRQSHGGNNDDFLFAR"
FT   gene            723811..724317
FT                   /locus_tag="UM146_03495"
FT   CDS_pept        723811..724317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70111"
FT                   /protein_id="ADN70111.1"
FT                   /translation="MTTSFLHVDFQQPAEMRFNRARVRRAFVTIGQRHMRDARRLVMRR
FT                   ARSAPGENPGYQTGRLARSIGYMVPRASKHRPGFMARIAPNQRNGEGNRRITGDFYPAF
FT                   LFYGVRRGAKRRRSHHRGASGGSGWRLAPRNNFMVETLEKNRSWTRYFLARELRKSLKP
FT                   ERRRR"
FT   gene            724314..724874
FT                   /locus_tag="UM146_03500"
FT   CDS_pept        724314..724874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70112"
FT                   /protein_id="ADN70112.1"
FT                   /translation="MKLTPVIAALRARCPYFENRVAGAAQFKNLPEVGKLRLPAAYVVP
FT                   GDDSPGENKSQTDYWQELKEGFSVVVILSNGRDERGQFASYDVVDDVRQMLFKALLGWN
FT                   PEACGNPITYDGGTLLDLNRHELIYQFDFSVIRELTEDDTRQQDDLNSLDELRTLAIDV
FT                   DYLDPGNGSDGDIEHHTEIPLPS"
FT   gene            724883..725053
FT                   /locus_tag="UM146_03505"
FT   CDS_pept        724883..725053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70113"
FT                   /protein_id="ADN70113.1"
FT                   /translation="MFVKPVKGRSVPDPARGDLLPAEGRNVDENNYWLRREAAGDIRRV
FT                   NKKVNTDDDKL"
FT   gene            725037..726533
FT                   /locus_tag="UM146_03510"
FT   CDS_pept        725037..726533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03510"
FT                   /product="Tail sheath protein"
FT                   /note="COG4386 Mu-like prophage tail sheath protein gpL"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70114"
FT                   /protein_id="ADN70114.1"
FT                   /translation="MTISFNTIPSNTLVPLFYAEMDNQAANTAQDSGASLLIGHANNGA
FT                   EIVANSLVLMPSADYARQICGAGSQLARMVEAYRQTDPFGELYVIAVPESTGAAATVTL
FT                   TVTGAATETGTVNVYVGRTRVQVPVTNGDNVTMIASSIQDAINAVPTLPFTASSSAGVV
FT                   TLTARHKGLCGNEIPVSLNYYGFGGGEVLPAGVQIAVVTGTAGTGAPVLTGAVAAMADE
FT                   PFDYIGLPFNDTASVNTLVTEMNDTSGRWSYARQLYGHVYTAKTGTLSELVTAGDQFNQ
FT                   QHITLAGYEKDTQTPADELAASRTARAAVFIRNDPARPTQTGELVGMLPAPKGKRFTMT
FT                   EQKTLLSHGVATAYVESGVLRIQRDVTTYRKNAYGVADNSYLDSETLHTSAYVLRKLKS
FT                   VITSKYGRHKLASDGTRFGPGQAIVTPAVIKGELLATYRQLERAGIVENYELFKQYLVV
FT                   ERDASDPNRLNTLFPPDYVNQLRVFAVVNQFRLQYSEESA"
FT   gene            726533..726889
FT                   /locus_tag="UM146_03515"
FT   CDS_pept        726533..726889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03515"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70115"
FT                   /protein_id="ADN70115.1"
FT                   /translation="MARIGGTCYFKIDGQQLSLTGGIEVPMNRTVNDDIIGLDGSVDRK
FT                   ETHRAPYVKGTFKVPKNFPVSKITSSDEMTITAELANGQVYVLSSAWLHGEANHNAEEG
FT                   TVDLEFHGEEGDYQ"
FT   gene            727300..729135
FT                   /locus_tag="UM146_03520"
FT   CDS_pept        727300..729135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03520"
FT                   /product="phage tail tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70116"
FT                   /protein_id="ADN70116.1"
FT                   /translation="MAEFELKALITGVDRLSPALSKMQKKIRGFKRQAEEASQGGLALG
FT                   GGLAAGLTLSLKSYADQENAATGLKVAMMDANGEVGKRFQDINKLAIGLGNQLPGTTAD
FT                   FQNMMQMLVRQGIPAENILGGVGKATAYLAVQLKKTPEAAAEFAAKMQDATGTASEDMM
FT                   GLFDTIQKAFYLGVDDTNMLSFFTKTSSVLKMVNKDGLQAAQSLAPISVMMDQMGMNGE
FT                   SAGNALRKVIQSGLSVKKIRDVNKVMARQKLGVQLDFTDGKGSFGGLDNMFRQLAKLRK
FT                   LTDVKRTGVLKAIFGDDAETLQVVNALIDKGKDGYDQIQQKMNKQASLNKRVQAQLGTL
FT                   SNLWEAMTGTATNGLAAIGGAFSGDAKNITQWLGELGEKFTKFADENPRVIRGVVGLAA
FT                   GLAILKLGLMGVGGAISIVSRIMSMTPIGMIATAIALAAGLIITNWDVVGPYFKKLWET
FT                   IGPYFEAGRELLKKVFAWSPLGMVINNWGPVVKWFQDMWDKLKPIIEWFTDSSGDTVDA
FT                   INSAQWGAGAYDAYGTGIPARGYTPYQAVDPAQSNNASGATGPNPFMINKASAPKVDGE
FT                   IKVSFVNSPPGMRVMETRSSGFDVSHDVGYTRFGR"
FT   gene            729196..730524
FT                   /locus_tag="UM146_03525"
FT   CDS_pept        729196..730524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03525"
FT                   /product="Tail/DNA circulation protein"
FT                   /note="COG4228 Mu-like prophage DNA circulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70117"
FT                   /protein_id="ADN70117.1"
FT                   /translation="MTWKDRLQDASFRGVPFKVEEESAGTGRRVETHEYPNRDKPYTED
FT                   LGKITFRPSITAYVVGDDCFDQRDRLIDALNKPGPGTLVHPTYGELKVCVDGEVRVSTS
FT                   KSEGRIVRFDLKFVEAGELSYPTSGAATAQTLMSSCSALDDCISDSFSGFSIDGVADFV
FT                   QNDVVGNASTMLGYVSDAMKVVDSAVSDAARLLQGDISVLLPPPSSGKNFVEQVQKMWR
FT                   TGKRLYGNASDLVTMIKTLSGVSLGSDLQPRGVWKTDSKTTATATQQRNVVASTLRTTA
FT                   ISEAAYAVTRLPAPTTSAVMQNATVGQSTTPAQSTGWPSVTHPALNNAPAVKNTVDLPT
FT                   WEELTDIRDTLNTAIDKELSRTTSDVLFLALRRVKADLNADINTRLEQSARIIQRTPDE
FT                   VLPALVLAATWFDNAARDADIIRRNAITHPGFVPVIPLKVPVQ"
FT   gene            730521..731600
FT                   /locus_tag="UM146_03530"
FT   CDS_pept        730521..731600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03530"
FT                   /product="Tail protein"
FT                   /note="COG4379 Mu-like prophage tail protein gpP"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70118"
FT                   /protein_id="ADN70118.1"
FT                   /translation="MNDNVTLRVNGREWNGWTSVRIGAGIERLARDFSVEITRQWPGDE
FT                   GITTLQPRIKNGSKVEVLIGDELVITGWVEATPVRYDARSVSTGIAGRSLTADLIDCAA
FT                   EPTQFNGRSLVQIAQALAAPFGIEVVNNGAPSGVIPDVQPDHGETVIEVINKILGQQQA
FT                   LAYDDPHGRLVIGGIGSTRAHTALVLGENILSCDTEKSIRERFSVYQVAGQRAGNDDDF
FT                   GEATTSALRARTEDAFIARYRPMYIRQTGQATGAGCIARADFEARQRAARTDETTYVVQ
FT                   GWRQGNGTLWQPNQRVIVFDPVCGFDNTELLVSEVTFTQDQNGTLTEIRVGPPDAYLPE
FT                   PEAPGARKKKKARVQEDPF"
FT   gene            731600..732148
FT                   /locus_tag="UM146_03535"
FT   CDS_pept        731600..732148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03535"
FT                   /product="putative baseplate assembly phage protein"
FT                   /note="COG4384 Mu-like prophage protein gp45"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70119"
FT                   /protein_id="ADN70119.1"
FT                   /translation="MSTIEAMQRQLLGLIGRAVVKSISAATKCQTVDVSLIAGEPKAGV
FT                   EHLEPYGFTARANSGAEAVVLFPDGDRSHAVVVTVSDRRYRLKGLQTGEVAVYDDQGQS
FT                   VTLTREGIVVDGAGKTITFRNAPEARFEMDLEVTGQVKDLCDSSGTTMSAMRLAYNGHR
FT                   HRENGQGSNTDKPDKAMEA"
FT   gene            732148..732573
FT                   /locus_tag="UM146_03540"
FT   CDS_pept        732148..732573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03540"
FT                   /product="putative tail protein"
FT                   /note="COG4381 Mu-like prophage protein gp46"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70120"
FT                   /protein_id="ADN70120.1"
FT                   /translation="MELWLTVNGKRTCASAPLDPLTRAVVISLFTWRRAEPDDNADVPM
FT                   GWWGDTWPAVQNDRYGSRLWLLQRSKLTNQLVQTVRGYIRECLQWMIDDGVVSRIDLDI
FT                   LRTGINELGNSITLWRRDGPVMISLDDLWSAITHGGQ"
FT   gene            732560..733618
FT                   /locus_tag="UM146_03545"
FT   CDS_pept        732560..733618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03545"
FT                   /product="putative baseplate J-like phage protein"
FT                   /note="COG3299 Uncharacterized homolog of phage Mu protein
FT                   gp47"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70121"
FT                   /protein_id="ADN70121.1"
FT                   /translation="MADSEFQRPTLAENISMLRNDLFARLDVSDTLRRMDEDVRAKVYA
FT                   AALHTVYGYIDYLAMNMLPDLCDESWLARHAAMKRCPRKGATTASGYMRWEGVSDGLKV
FT                   TAGSVIQRDDLIQYTATADATSAGGVLRVPIACSSAGAVGNADDGTSLILVTPVNGLPS
FT                   SGVADTLTGGFDTEELETWRARVIERYYWTPQGGADGDYVVWAKELPGITRAWAYRHWM
FT                   GTGTVGVMIASSDLINPIPEESTETAARQHIGPLAPVAGSDLYVFRPVAHTVDFHIRVT
FT                   PDTPEIRAAITAELRSFLLRDGYPQGELKVSRISEAISGANGEYSHQLLAPAENISIAK
FT                   NELAVLGTISWA"
FT   gene            733609..734193
FT                   /locus_tag="UM146_03550"
FT   CDS_pept        733609..734193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03550"
FT                   /product="hypothetical protein"
FT                   /note="COG3778 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70122"
FT                   /protein_id="ADN70122.1"
FT                   /translation="MGVTNDDYIRLLSALLPPGPAWSASDPAIAGAAQSLTRVHQRADA
FT                   LMRELDPRTTTELINRWERLCGLPDECIPAGTQTLRQRQQRLDAKVNLAGGINEDFYLA
FT                   QLAALGRPDATITRYDKSTFTCSSACTDAVNAPEWRYYWQVNMPAATNSTWMTCGDPCD
FT                   SALRIWGDTVVECVLNKLCPSHTYVIFKYPE"
FT   gene            734197..734595
FT                   /locus_tag="UM146_03555"
FT   CDS_pept        734197..734595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03555"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70123"
FT                   /protein_id="ADN70123.1"
FT                   /translation="MHRIDTKTAQKDKFGAGKNGFTRGNPQTGTPATDLDDDYFDMLQE
FT                   ELCSVVEASGASLEKARHDQLLTALRALLLSRKNPFSDIKSDGTVKTALVKPWFGRRLC
FT                   ITCWCACSMAFSHTANRLAEMQRCGFFC"
FT   gene            734861..734941
FT                   /locus_tag="UM146_03560"
FT   CDS_pept        734861..734941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03560"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70124"
FT                   /protein_id="ADN70124.1"
FT                   /translation="MSGTVAVNPVDTRPRNIAFNYIVRAA"
FT   gene            734941..735543
FT                   /locus_tag="UM146_03565"
FT   CDS_pept        734941..735543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03565"
FT                   /product="putative tail fiber chaperone (assembly protein);
FT                   e14 prophage"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70125"
FT                   /protein_id="ADN70125.1"
FT                   /translation="MDKAILNSGLVATKAGDITVYNYDGETREYISTSSEYLAVGVGIP
FT                   AYSCLDAPGIHKAGYAICRSVNLNSWEYVPDHRGEIVYNTETGESKQITAPGDYPENTT
FT                   TIAPLTPYDKWDGEKWVTDTEAQHSAAVDAAEAQRQSLIDAAMASIGLIQLKLQAGRKL
FT                   MQAETTRLNAVLDYIDAVTATNTSTAPDVIWPELPEA"
FT   gene            complement(735515..735958)
FT                   /locus_tag="UM146_03570"
FT   CDS_pept        complement(735515..735958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03570"
FT                   /product="putative tail fibre assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70126"
FT                   /protein_id="ADN70126.1"
FT                   /translation="MNSVFFSPGSKSFYLQELFPEYEDAGTLPDDVIEITRETYEQFLG
FT                   LHPEGKEIGADSSGRPVWINSPPPSKEDEVLTAEMKKISLVSEVNTYINTHQWPGKAAI
FT                   GRLKGEELAQYNSWLDYLDALELVDTSCAPDIEWPTPPAVQAR"
FT   gene            complement(735961..736446)
FT                   /locus_tag="UM146_03575"
FT   CDS_pept        complement(735961..736446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70127"
FT                   /protein_id="ADN70127.1"
FT                   /translation="MLVISAFSINXGLGEAAKRNVGNGENQIPDMSFWTVTGGNGNFVI
FT                   RQPDGLIIQMVTVSISGPVAMNGMTDNAYAITGSNKSYIATATLPFVFPNKVLGVIPLV
FT                   STTAYGGVSSNITGSYATAVCSFAAVRGNNTIVFKVDKPLNAAFPSDTSVSALIIGR"
FT   gene            736484..736612
FT                   /locus_tag="UM146_03580"
FT   CDS_pept        736484..736612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03580"
FT                   /product="DNA invertase"
FT                   /note="COG1961 Site-specific recombinases, DNA invertase
FT                   Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70128"
FT                   /protein_id="ADN70128.1"
FT                   /translation="MLIGYVRVSTNDQNTDLQRNALNCAGCELIFEDKISGTKSET"
FT   gene            complement(736691..738598)
FT                   /locus_tag="UM146_03585"
FT   CDS_pept        complement(736691..738598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03585"
FT                   /product="hypothetical protein"
FT                   /note="COG1479 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70129"
FT                   /protein_id="ADN70129.1"
FT                   /translation="MKSETLTVQQLFQDRRQYCVPFYQRAYVWTQQDQWSALLEDILEK
FT                   VQSRLSGTKPTPHFLGAVVLEPQSKKGLLGVDSIHIIDGQQRLTTLQYVLASIRLALRA
FT                   TDLSSLEALISPCLKNSNEDTMRNKEVERFKLWPTFRDQTHFIQSFNVENIDDLRDVFS
FT                   DSFTQHGTLRKHFNHPPSLEALCFFTEAFIKWIKIENHSPQENAVALIEAVLTDLKLVS
FT                   IFLEAEDDAQIIFETLNGRGAELHATDLIRNYIFMCAEHENINAIELYENEWKSFEDKY
FT                   WSEKQRRGRINKPRMEWLVHATLQSERQREIDLSRLYNEYRDYVSKDLSSQRADLQVKR
FT                   LKQYASQYKELVDGFGTTPISHFGYRIADYDVTTLYPLALFISIANIADDEKAAMYNDL
FT                   VSYVVRRAVCGLTPKNYNNVFMNVLRHLAKTEISSVELRNILNNLNGEASRWPGDSEFL
FT                   NACINAPLYPGRLDAPKMRSMLTELERELCRQVKTEKPDVPNLSNLDIDHLMPQSWYSC
FT                   WPLENGRMVTNSDATVLNQIVLSGTDLTPEQLLVRKRQQAISTLGNLTLLNLSVNRSVQ
FT                   NAVFLKKRDALIVHTNLRLNIPLIVKDKWDEDEILERGKKLGEIALKVWPKTRLMQLIK
FT                   "
FT   gene            complement(739023..739160)
FT                   /locus_tag="UM146_03590"
FT   CDS_pept        complement(739023..739160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03590"
FT                   /product="putative protein from DinI-like family"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70130"
FT                   /protein_id="ADN70130.1"
FT                   /translation="MPNGAVDALKEELTQHIGKRYDDVEMIVKATSNDSFSVRHTADKD
FT                   "
FT   gene            739650..740423
FT                   /locus_tag="UM146_03595"
FT   CDS_pept        739650..740423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03595"
FT                   /product="hypothetical protein"
FT                   /note="COG3680 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03595"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70131"
FT                   /protein_id="ADN70131.1"
FT                   /translation="MDINEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMR
FT                   GEVAAVDDDELLNNKLRQLREIRLAGLDVIHVIHRHGMAEEKTAYEVEAALIDAYPGLT
FT                   NIMNGAGSNEFGAAHIKELIATYQPETITFQHKALMISVNRSSKDIDLYDAVRFSWRVS
FT                   VDRARKAEIILATVRGIVRGVYIADEWLKSTRENFPEMTSWEADDEFEATQCSRFGFRG
FT                   RVASPEITQLYIGKKIPDDLRKKGAMSPVRYSPGF"
FT   gene            740634..740927
FT                   /locus_tag="UM146_03600"
FT   CDS_pept        740634..740927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70132"
FT                   /protein_id="ADN70132.1"
FT                   /translation="MTLPKFRNDLQVEANYSINQAREMVGKTVKSVQIGFQKTGVQVHQ
FT                   TEMLIITFTDDTQLAISTGSNVVNITSLIGRGGSCELKPADFHVDFDLTWQR"
FT   gene            complement(741015..741803)
FT                   /locus_tag="UM146_03605"
FT   CDS_pept        complement(741015..741803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03605"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70133"
FT                   /protein_id="ADN70133.1"
FT                   /translation="MTNLQLEERFRALEKDYDALISTKYTAQNVLTHTMETYVDSGKYK
FT                   NWIARVKKLIEDSYGKESDYYNDFNTVNSRWSSNYNTLIKSYKPLFDAARDDLAHSAVS
FT                   TNTPQEGSPLSLVLNILNRFPTFVRQLKRRYNGRAPLEVNDEYDVQDLIYALLTLHFND
FT                   IRAEEYTPSFAGAASRQDFLLKKEKIVIEVKKTRESLGAGKVGGELLIDMARYRAHQDC
FT                   DTLILFVYDPDCYINNPLGVKTDLESKDAEGKVKVVIAQF"
FT   gene            complement(741800..741997)
FT                   /locus_tag="UM146_03610"
FT   CDS_pept        complement(741800..741997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70134"
FT                   /protein_id="ADN70134.1"
FT                   /translation="MALDSYASPNIIPELRQPNAAAGKITLGGLDRMAVTPSVKKRRLS
FT                   MVEFPYAQTLLSDYTAWKAL"
FT   gene            complement(742960..743442)
FT                   /gene="smpB"
FT                   /locus_tag="UM146_03615"
FT   CDS_pept        complement(742960..743442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="UM146_03615"
FT                   /product="SsrA-binding protein"
FT                   /note="COG0691 tmRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03615"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70135"
FT                   /protein_id="ADN70135.1"
FT                   /translation="MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLR
FT                   AGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRV
FT                   NREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR"
FT   gene            743574..744050
FT                   /locus_tag="UM146_03620"
FT   CDS_pept        743574..744050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03620"
FT                   /product="hypothetical protein"
FT                   /note="COG2867 Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70136"
FT                   /protein_id="ADN70136.1"
FT                   /translation="MILFVGFLLMEIVMPQISRTALVPYSAEQMYQLVNDVQSYPQFLP
FT                   GCTGSRILESTPGQMTAAVDVSKAGISKTFTTRNQLTSNQSILMSLVDGPFKKLIGGWK
FT                   FTPLSQDACRIEFHLDFEFTNKLIELAFGRVFKELAANMVQAFTVRAKEVYSAR"
FT   gene            744040..744330
FT                   /locus_tag="UM146_03625"
FT   CDS_pept        744040..744330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03625"
FT                   /product="hypothetical protein"
FT                   /note="COG2914 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03625"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70137"
FT                   /protein_id="ADN70137.1"
FT                   /translation="MPGKIAVEVAYALPEKQYLQRVTLQEGATVEEAIRASGLLELRTD
FT                   IDLTKNKVGIYSRPAKLSDIVHDGDRVEIYRPLIADPKELRRQRAEKSANK"
FT   gene            complement(744392..744733)
FT                   /locus_tag="UM146_03630"
FT   CDS_pept        complement(744392..744733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03630"
FT                   /product="hypothetical protein"
FT                   /note="COG2913 Small protein A (tmRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70138"
FT                   /protein_id="ADN70138.1"
FT                   /translation="MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSK
FT                   IRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNI
FT                   DNKPALSGN"
FT   gene            complement(744882..746543)
FT                   /locus_tag="UM146_03635"
FT   CDS_pept        complement(744882..746543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03635"
FT                   /product="recombination and repair protein"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03635"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70139"
FT                   /protein_id="ADN70139.1"
FT                   /translation="MLAQLTISNFAIVRELEIDFHSGMTVITGETGAGKSIAIDALGLC
FT                   LGGRAEADMVRTGAARADLCARFSLKDTPAALRWLEENQLEDGHECLLRRVISSDGRSR
FT                   GFINGTAVPLSQLRELGQLLIQIHGQHAHQLLTKPEHQKFLLDGYANETSQLQEMTARY
FT                   QLWHQSCRDLAHHQQLSQERAARAELLQYQLKELNEFNPQPGEFEQIDEEYKRLANSGQ
FT                   LLTTSQNALALMADGEDANLQSQLYTAKQLVSELIGMDSKLSGVLDMLEEATIQIAEAS
FT                   DELRHYCDRLDLDPNRLFELEQRISKQISLARKHHVSPEALPQYYQSLLEEQQQLDDQA
FT                   DSQETLALAVTKHHQQALETARALHQQRQHYANELAQLITDSMHALSMPHGQFTIDVKF
FT                   DEHHLGADGADRIEFRVTTNPGQPMQPIAKVASGGELSRIALAIQVITARKMETPALIF
FT                   DEVDVGISGPTAAVVGKLLRQLGESTQVMCVTHLPQVAGCGHQHYFVSKETDGAMTETH
FT                   MQSLDKKARLQELARLLGGSEVTRNTLANAKELLAA"
FT   gene            complement(746629..747507)
FT                   /gene="ppnK"
FT                   /locus_tag="UM146_03640"
FT   CDS_pept        complement(746629..747507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="UM146_03640"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG0061 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70140"
FT                   /protein_id="ADN70140.1"
FT                   /translation="MNNHFKCIGIVGHPRHPTALTTHEMLYRWLCTKGYEVIVEQQIAH
FT                   ELQLKNVKTGTLAEIGQQADLAVVVGGDGNMLGAARTLARYDIKVIGINRGNLGFLTDL
FT                   DPDNAQQQLADVLEGHYISEKRFLLEAQVCQQDCQKRISTAINEVVLHPGKVAHMIEFE
FT                   VYIDEIFAFSQRSDGLIISTPTGSTAYSLSAGGPILTPSLDAITLVPMFPHTLSARPLV
FT                   INSSSTIRLRFSHRRNDLEISCDSQIALPIQEGEDVLIRRCDYHLNLIHPKDYSYFNTL
FT                   STKLGWSKKLF"
FT   gene            747630..748223
FT                   /locus_tag="UM146_03645"
FT   CDS_pept        747630..748223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03645"
FT                   /product="heat shock protein GrpE"
FT                   /note="COG0576 Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03645"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70141"
FT                   /protein_id="ADN70141.1"
FT                   /translation="MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIA
FT                   NLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDR
FT                   ALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESD
FT                   DVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKD"
FT   gene            complement(748278..749474)
FT                   /locus_tag="UM146_03650"
FT   CDS_pept        complement(748278..749474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03650"
FT                   /product="hypothetical protein"
FT                   /note="COG4536 Putative Mg2+ and Co2+ transporter CorB"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70142"
FT                   /protein_id="ADN70142.1"
FT                   /translation="MTLNRYRLRHMAKQGNRSAKRVEKLLRKPDRLISLVLIGNNLVNI
FT                   LASALGTIVGMRLYGDAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAT
FT                   LQILMMPLVWLLNAITRMLMRMMGIKTDIVVSGSLSKEELRTIVHESRSQISRRNQDML
FT                   LSVLDLEKMTVDDIMVPRSEIIGIDINDDWKSILRQLSHSPHGRIVLYRDSLDDAISML
FT                   RVREAWRLMSEKKEFTKETMLRAADEIYFVPEGTPLSTQLVKFQRNKKKVGLVVNEYGD
FT                   IQGLVTVEDILEEIVGDFTTSMSPTLAEEVTPQNDGSVIIDGTANVREINKAFNWHLPE
FT                   DDARTVNGVILEALEEIPVAGTRVRIGEYDIDILDVQDNMIKQVKVFPVKPLRESVAE"
FT   gene            complement(749585..750451)
FT                   /locus_tag="UM146_03655"
FT   CDS_pept        complement(749585..750451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03655"
FT                   /product="hypothetical protein"
FT                   /note="COG4137 ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03655"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70143"
FT                   /protein_id="ADN70143.1"
FT                   /translation="MQRLEQRSPDAILLLFLIAQTVDITMPVFALLALVAYSVSLALIV
FT                   PGLLQKNGGWRRMAIISAVIALVCHAIALEARILPDGDSGQNLSLLNVGSLVSLMICTV
FT                   MTIVASRNRGWLLLPIVYAFALINLALATFMPNEYITHLEATPGMLVHIGLSLFSYATL
FT                   IIAALYALQLAWIDYQLKNKKLAFNQEMPPLMSIERKMFHITQIGVVLLTLTLCTGLFY
FT                   MHNLFSMENIDKAVLSIVAWFVYIVLLWGHYHEGWRGRRVVWFNVAGAVILTLAYFGSR
FT                   IVQQLIS"
FT   gene            750543..751904
FT                   /locus_tag="UM146_03660"
FT   CDS_pept        750543..751904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03660"
FT                   /product="signal recognition particle protein"
FT                   /note="COG0541 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70144"
FT                   /protein_id="ADN70144.1"
FT                   /translation="MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVAL
FT                   PVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVL
FT                   MAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSD
FT                   VGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVD
FT                   AMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEA
FT                   LEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQ
FT                   MKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRK
FT                   RRIAAGCGMQVQDVNRLLKQFDDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR"
FT   gene            752041..752289
FT                   /gene="rpsP"
FT                   /locus_tag="UM146_03665"
FT   CDS_pept        752041..752289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="UM146_03665"
FT                   /product="30S ribosomal protein S16"
FT                   /note="COG0228 Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03665"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70145"
FT                   /protein_id="ADN70145.1"
FT                   /translation="MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASE
FT                   KEEGTRLDLDRIAHWVGQGATISDRVAALIKEVNKAA"
FT   gene            752308..752856
FT                   /gene="rimM"
FT                   /locus_tag="UM146_03670"
FT   CDS_pept        752308..752856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="UM146_03670"
FT                   /product="16S rRNA-processing protein RimM"
FT                   /note="COG0806 RimM protein, required for 16S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70146"
FT                   /protein_id="ADN70146.1"
FT                   /translation="MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQ
FT                   PWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEG
FT                   DYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQV
FT                   IKKVDLTTRSIEVDWDPGF"
FT   gene            752887..753654
FT                   /gene="trmD"
FT                   /locus_tag="UM146_03675"
FT   CDS_pept        752887..753654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="UM146_03675"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03675"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70147"
FT                   /protein_id="ADN70147.1"
FT                   /translation="MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDR
FT                   HRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELAT
FT                   NQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHE
FT                   ASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPE
FT                   LLENLALTEEQARLLAEFKTEHAQQQHKHDGMA"
FT   gene            753696..754043
FT                   /gene="rplS"
FT                   /locus_tag="UM146_03680"
FT   CDS_pept        753696..754043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="UM146_03680"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70148"
FT                   /protein_id="ADN70148.1"
FT                   /translation="MSNIIKQLEQEQMKQDVPSFRPGDTVEVKVWVVEGSKKRLQAFEG
FT                   VVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSISVKRRGAVRKAKLYYLRERT
FT                   GKAARIKERLN"
FT   gene            complement(754120..754602)
FT                   /locus_tag="UM146_03685"
FT   CDS_pept        complement(754120..754602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03685"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03685"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70149"
FT                   /protein_id="ADN70149.1"
FT                   /translation="MIKHLLAPLIFTSLILTGCQSPQGKFTPEQVAAMQSYGFTESAGD
FT                   WSLGLSDAILFAKNDYKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEVL
FT                   SLKRANVVADAWAMGGQIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVITTP"
FT   gene            complement(754618..755841)
FT                   /locus_tag="UM146_03690"
FT   CDS_pept        complement(754618..755841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03690"
FT                   /product="hypothetical protein"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70150"
FT                   /protein_id="ADN70150.1"
FT                   /translation="MDNDNSLNKRPTFKRALRNISMTSIFITMMLIWLLLSVTSVLTLK
FT                   QYAQKNLALTAATMTYSLEAAVVFADGPAATETLAALGQQGQFSTAEVRDKQQNILASW
FT                   HYTHKEPGDTFSNFISHWLFPAPIIQPIRHNGETIGEVRLTARDSSISHFIWFSLAVLT
FT                   GCILLASGIAITLTRHLHNGLVEALKNITDVVHDVRSNRNFSRRVSEERIAEFHRFALD
FT                   FNSLLDEMEEWQLRLQAKNAQLLRTALHDPLTGLANRAAFRSGINTLMNNSDARKTSAL
FT                   LFLDGDNFKYINDTWGHATGDRVLIEIAKRLAEFGGLRHKAYRLGGDEFAMVLYDVQSE
FT                   SEVQQICSALTQIFNLPFDLHNGHQTTMTLSIGYAMTIEHASAENLQELADHNMYQAKH
FT                   QRAEKLVR"
FT   gene            complement(755834..756352)
FT                   /locus_tag="UM146_03695"
FT   CDS_pept        complement(755834..756352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03695"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70151"
FT                   /protein_id="ADN70151.1"
FT                   /translation="MRFSHRLFLLLILLLTGAPILAQEPSDVAKNVRMMVSGIVSYTRW
FT                   PGLSGPPKLCIFSSSRFSTALQENAATSLPYLPVIIHTQQEAIISGCNGFYFGNESPTF
FT                   QMELTEQYPSKALLLIAEQNTECIIGSAFCLIIHNNDVRFAVNLDALSRSGVKVNPDVL
FT                   MLARKKNDG"
FT   gene            complement(756499..756864)
FT                   /locus_tag="UM146_03700"
FT   CDS_pept        complement(756499..756864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70152"
FT                   /protein_id="ADN70152.1"
FT                   /translation="MMKKFIAPLLALLVSGCQIDPYTHAPTLTSTDWYDVGMEDAISGS
FT                   AIKDDDAFSDSQADRGLYLKGYAEGQKKTCQTDFTYARGLSGKSFPASCNNVENASQLH
FT                   EVWRKGADENASTIRLN"
FT   gene            757074..758144
FT                   /locus_tag="UM146_03705"
FT   CDS_pept        757074..758144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03705"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COG0722 3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03705"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70153"
FT                   /protein_id="ADN70153.1"
FT                   /translation="MQKDALNNVHITAEQVLMTPEQLKAAFPLSLQQEAQIADSRKTIS
FT                   DIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVG
FT                   WKGLINDPHMDGSFDVEAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAI
FT                   GARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALL
FT                   QTQGNPDGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
FT                   VAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALL
FT                   REIHQDLNGQLTARVA"
FT   gene            758155..759276
FT                   /gene="tyrA"
FT                   /locus_tag="UM146_03710"
FT   CDS_pept        758155..759276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="UM146_03710"
FT                   /product="bifunctional chorismate mutase/prephenate
FT                   dehydrogenase"
FT                   /EC_number="5.4.99.5"
FT                   /note="COG1605 Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70154"
FT                   /protein_id="ADN70154.1"
FT                   /translation="MVAELTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIY
FT                   VPEREASMLASRRAEAEALGVPPDLIEDVLRRVMRESYSSENDKGFKTLCPSLRPVVIV
FT                   GGGGQMGRLFEKMLTLSGYQVRILEQHDWDRAADIVSDAGMVIVSVPIHVTEQVIGKLP
FT                   PLPKDCILVDLASVKNGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEA
FT                   YQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALS
FT                   SPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFI
FT                   DSFRKVEHWFGDYAQRFQSESRVLLRQANDNRQ"
FT   gene            complement(759319..760479)
FT                   /gene="pheA"
FT                   /locus_tag="UM146_03715"
FT   CDS_pept        complement(759319..760479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="UM146_03715"
FT                   /product="bifunctional chorismate mutase/prephenate
FT                   dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="COG1605 Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03715"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70155"
FT                   /protein_id="ADN70155.1"
FT                   /translation="MTSENPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRP
FT                   VRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNKINPHSA
FT                   RIAFLGPKGSYSHLAARQYAARHFEQFIESGCAKFADIFNQVETGQADYAVVPIENTSS
FT                   GAINDVYDLLQHTSLSIVGEMTLTIDHCLLVSGTTDLSAINTVYSHPQPFQQCSKFLNR
FT                   YPHWKIEYTESTSAAMEKVAQAKSPHVAALGSEAGGTLYGLQVLERIEANQRQNFTRFV
FT                   VLARKAINVSDQVPAKTTLLMATGQQAGALVEALLVLRNHSLIMTRLESRPIHGNPWEE
FT                   MFYLDIQANLESAEMQKALKELGEITRSMKVLGCYPSENVVPVDPT"
FT   gene            complement(760729..761070)
FT                   /locus_tag="UM146_03720"
FT   CDS_pept        complement(760729..761070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03720"
FT                   /product="translation inhibitor protein RaiA"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70156"
FT                   /protein_id="ADN70156.1"
FT                   /translation="MTMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEP
FT                   QGFVADATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAATSVKDA
FT                   NFVEEVEEE"
FT   gene            complement(761340..762077)
FT                   /locus_tag="UM146_03725"
FT   CDS_pept        complement(761340..762077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03725"
FT                   /product="outer membrane protein assembly complex subunit
FT                   YfiO"
FT                   /note="COG4105 DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03725"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70157"
FT                   /protein_id="ADN70157.1"
FT                   /translation="MTRMKYLVAAATLSLFLAGCSGSKEEVPDNPPNEIYATAQQKLQD
FT                   GNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPN
FT                   IDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDA
FT                   TKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAY
FT                   RQMQMNAQAEKVAKIIAANSSNT"
FT   gene            762212..763192
FT                   /gene="rluD"
FT                   /locus_tag="UM146_03730"
FT   CDS_pept        762212..763192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="UM146_03730"
FT                   /product="23S rRNA pseudouridine synthase D"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70158"
FT                   /protein_id="ADN70158.1"
FT                   /translation="MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRV
FT                   LVNGKVCDKPKEKVLGGEQVAINAEIEEEARFEPQDIPLDIVYEDEDIIVINKPRDLVV
FT                   HPGAGNPDGTVLNALLHYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQ
FT                   RREITREYEAVAIGHMTAGGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHFRVHT
FT                   RLRLRLETGRTHQIRVHMAHITHPLVGDPVYGGRPRPPKGASEAFISTLRKFDRQSLHA
FT                   TMLRLYHPISGIEMEWHAPIPQDMVELIEVMRADFEEHKDEVDWL"
FT   gene            763189..763920
FT                   /locus_tag="UM146_03735"
FT   CDS_pept        763189..763920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03735"
FT                   /product="hypothetical protein"
FT                   /note="COG1496 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03735"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70159"
FT                   /protein_id="ADN70159.1"
FT                   /translation="MSKLIVPQWPLPKGVAACSSTRIGGVSLPPYDSLNLGAHCGDNPD
FT                   HVEENRKRLFAAGNLPSKPVWLEQVHGKDVLKLIGEPYASKRADASYSNTPGTVCAVMT
FT                   ADCLPVLFCNRAGTEVAAAHAGWRGLCAGVLEETVSCFADNPENILAWLGPAIGPRAFE
FT                   VGAEVREAFMAVDAEASTAFIQHGDKYLADIYQLARQRLASVGVEQIFGGDRCTYTENE
FT                   TFFSYRRDKTTGRMASFIWLI"
FT   gene            764050..766623
FT                   /locus_tag="UM146_03740"
FT   CDS_pept        764050..766623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03740"
FT                   /product="protein disaggregation chaperone"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70160"
FT                   /protein_id="ADN70160.1"
FT                   /translation="MRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGS
FT                   VSPLLTSAGINAGQLRTDINQALNRLPQVEGTGGDVQPSQDLVRVLNLCDKLAQKRGDN
FT                   FISSELFVLAALESRGTLADILKAAGATTANITQAIEQMRGGESVNDQGAEDQRQALKK
FT                   YTIDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELH
FT                   TMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAE
FT                   PSVEDTIAILRGLKERYELHHHVQITDPAIVAAATLSHRYIADRQLPDKAIDLIDEAAS
FT                   SIRMQIDSKPEELDRLDRRIIQLKLEQQALMKESDEASKKRLDMLNEELSDKERQYSEL
FT                   EEEWKAEKASLSGTQTIKAELEQAKIAIEQARRVGDLARMSELQYGKIPELEKQLEAAT
FT                   QLEGKTMRLLRNKVTDAEIAEVLARWTGIPVSRMMESEREKLLRMEQELHHRVIGQNEA
FT                   VDAVSNAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYAHMKELVLGVVSHNFRPEF
FT                   INRIDEVVVFHPLGEQHIASIAQIQLKRLYKRLEERGYEIHISDEVLKLLSENGYDPVY
FT                   GARPLKRAIQQQIENPLAQQILSGELVPGKVIRLEVNEDRIVAVQ"
FT   gene            766852..767019
FT                   /locus_tag="UM146_03745"
FT   CDS_pept        766852..767019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03745"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70161"
FT                   /protein_id="ADN70161.1"
FT                   /translation="MLDSVAGKRIMHTPAPLRKSEAALLFNNLSDNLCGHSKIRILNVA
FT                   RRKMNTKSQE"
FT   gene            767066..768619
FT                   /locus_tag="UM146_r24005"
FT   rRNA            767066..768619
FT                   /locus_tag="UM146_r24005"
FT                   /product="16S ribosomal RNA"
FT   gene            768693..768768
FT                   /locus_tag="UM146_t23843"
FT   tRNA            768693..768768
FT                   /locus_tag="UM146_t23843"
FT                   /product="tRNA-Glu"
FT   gene            768962..771867
FT                   /locus_tag="UM146_r24019"
FT   rRNA            768962..771867
FT                   /locus_tag="UM146_r24019"
FT                   /product="23S ribosomal RNA"
FT   gene            771966..772081
FT                   /locus_tag="UM146_r23993"
FT   rRNA            771966..772081
FT                   /locus_tag="UM146_r23993"
FT                   /product="5S ribosomal RNA"
FT   gene            772212..772454
FT                   /locus_tag="UM146_03750"
FT   CDS_pept        772212..772454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03750"
FT                   /product="IS putative transposase"
FT                   /note="COG2963 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70162"
FT                   /protein_id="ADN70162.1"
FT                   /translation="MKHSFEIKLAAVNHYLAGHAGIISTAKLFQLSHTSLSHWINLFLL
FT                   HGPRHWIADTSVAILLKINFAWFFMLSGILSLYPG"
FT   gene            772559..772732
FT                   /locus_tag="UM146_03755"
FT   CDS_pept        772559..772732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03755"
FT                   /product="transposase ORF A, IS1397"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03755"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70163"
FT                   /protein_id="ADN70163.1"
FT                   /translation="MTRSDDTHENEANMTPEEMKNELRYLRAENAYLKAMQEHLLEKKR
FT                   QELEKKRKSSRA"
FT   gene            772837..773559
FT                   /locus_tag="UM146_03760"
FT   CDS_pept        772837..773559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03760"
FT                   /product="transposase ORF B, IS3 family, IS150 group"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70164"
FT                   /protein_id="ADN70164.1"
FT                   /translation="MKQLIASIFHEHRGCYGYRRIHCELQKRGLKFSGKTVRKLMQQLG
FT                   LKSPVRLKKYRSYRGNMGLAAENILQRQFKAEAPCEKWVTDITEFRAGGQKLYLSPILD
FT                   LFNGEIVAWETACRPTEELVKRMLNKGLESLAEGEKPLLHSDQGWHYRIKSYQSALADR
FT                   GLVQSMSRKGNCLDNAVMENFFGHLKEEMYYRRDYRNVEELENAVNEYITYWNQKRIKL
FT                   SLGGLSPVEYRTEYQKAG"
FT   gene            773803..774207
FT                   /locus_tag="UM146_03765"
FT   CDS_pept        773803..774207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03765"
FT                   /product="putative transposase"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03765"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70165"
FT                   /protein_id="ADN70165.1"
FT                   /translation="MEHELHYIGIDTAKEKLDVDVLRPDGRHRTKKFANTTKGHDELVS
FT                   WLKCHKIDHAHICIEATGTYMEPVAECLYDAGYIVSVINPALGKAFAQSEGLRNKTDTV
FT                   DAACWQSSVVRSALQPGKRITRLNARCMPW"
FT   gene            774231..774455
FT                   /locus_tag="UM146_03770"
FT   CDS_pept        774231..774455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03770"
FT                   /product="hypothetical protein"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70166"
FT                   /protein_id="ADN70166.1"
FT                   /translation="MHRQELNRTETAREVQRPSIDAHLLWLEAELKRLEKQIKDLTDDD
FT                   PDMKHRRKLLESIPGIGEKTSAVLLAYMV"
FT   gene            774593..774769
FT                   /locus_tag="UM146_03775"
FT   CDS_pept        774593..774769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03775"
FT                   /product="hypothetical protein"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03775"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70167"
FT                   /protein_id="ADN70167.1"
FT                   /translation="MPAMVATSKTEWGRALAANGKKGKVILGSIMRKLAQVAYGVLKSG
FT                   VPFDASRHNPVAA"
FT   gene            775112..776410
FT                   /locus_tag="UM146_03780"
FT   CDS_pept        775112..776410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03780"
FT                   /product="alpha-ketoglutarate transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70168"
FT                   /protein_id="ADN70168.1"
FT                   /translation="MAESTVTADSKLTSSDTRRRIWAIVGASSGNLIEWFDFYVYSFCS
FT                   LYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIADKHGRKKSMLLSVCMMC
FT                   FGSLVIACLPGYETIGTWAPALLLLARLFQGLSVGGEYGTSATYMSEVAVEGRKGFYAS
FT                   FQYVTLIGGQLLALLVVVVLQHTMEDAVLREWGWRIPFALGAVLAVVALWLRRQLDETS
FT                   QQETRALKEAGSLKGLWRNRRAFIMVLGFTAAASLCFYTFTTYMQKYLVNTAGMHANVA
FT                   SGIMTAALFVFMLIQPLIGALSDKIGRRTSMLCFGSLATIFTVPILSALQNVSSPYAAF
FT                   GLVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSI
FT                   GMETAFFWYVTLMAVVAFLVSLTLHRKGKGMRL"
FT   gene            complement(776407..776679)
FT                   /locus_tag="UM146_03785"
FT   CDS_pept        complement(776407..776679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03785"
FT                   /product="hypothetical protein"
FT                   /note="COG5544 Predicted periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03785"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70169"
FT                   /protein_id="ADN70169.1"
FT                   /translation="MANDSWSGQDKAQHFIASAMLSAAGNEYSQHQGMSRDRSAMFGLM
FT                   FSVSLGASKELWDSRPEGSGWSWKDFAWDIAGASTGYTVWQLTRH"
FT   gene            complement(776776..778131)
FT                   /gene="pssA"
FT                   /locus_tag="UM146_03790"
FT   CDS_pept        complement(776776..778131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="UM146_03790"
FT                   /product="phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /note="COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70170"
FT                   /protein_id="ADN70170.1"
FT                   /translation="MLSKFKRNKHQQHLAQLPKISQSVDDVDFFYAPADFRETLLEKIA
FT                   SAKQRICIVALYLEQDDGGKGILNALYEAKRQRPELDVRVLVDWHRAQRGRIGAAASNT
FT                   NADWYCRMAQENPGVDVPVYGVPINTREALGVLHFKGFIIDDSVLYSGASLNDVYLHQH
FT                   DKYRYDRYHLIRNRKMSDIMFEWVTQNIMNGRGVNRLDDVNRPKSPEIKNDIRLFRQEL
FT                   RDAAYHFQGDADNDQLSVTPLVGLGKSSLLNKTIFHLMPCAEQKLTICTPYFNLPAILV
FT                   RNIIQLLREGKKVEIIVGDKTANDFYIPEDEPFKIIGALPYLYEINLRRFLSRLQYYVN
FT                   TDQLVVRLWKDDDNTYHLKGMWVDDKWMLITGNNLNPRAWRLDLENAILIHDPQLELAP
FT                   QREKELELIREHTTIVKHYRDLQSIADYPVKVRKLIRRLRRIRIDRLISRIL"
FT   gene            complement(778245..780905)
FT                   /locus_tag="UM146_03795"
FT   CDS_pept        complement(778245..780905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03795"
FT                   /product="fused acyl-CoA synthetase: NAD(P)-binding subunit
FT                   ; ATP-binding subunit"
FT                   /note="COG1042 Acyl-CoA synthetase (NDP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03795"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70171"
FT                   /protein_id="ADN70171.1"
FT                   /translation="MSQRGLEALLRPKSIAVIGASMKPNRAGYLMMRNLLAGGFNGPVL
FT                   PVTPAWKAVLGVLAWPDIARLPFTPDLAVLCTNASRNLALLEELGEKGCKTCIILSAPA
FT                   SQHEDLRACALRHNMRLLGPNSLGLLAPWQGLNASFSPVPIKRGKLAFISQSAAVSNTI
FT                   LDWAQQREMGFSYFIALGDSLDIDVDELLDYLARDSKTSAILLYLEQLSDARRFVSAAR
FT                   SASRNKPILVIKSGRSPAAQRLLNTTAGMDPAWDAAIQRAGLLRVQDTHELFSAVETLS
FT                   HMRPLRGDRLMIISNGAAPAALALDALWSRNGKLATLSEETCQKLRDALPGHVAISNPL
FT                   DLRDDASSEHYVKTLDILLHSQDFDALMVIHSPSAAAPATESAQVLIEAVKHHPRSKYV
FT                   SLLTNWCGEHSSQEARRLFSEAGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPALPSN
FT                   LTSNTAEAHLLLQHAIAEGATSLDTHEVQPILQAYGMNTLPTWIASNSTEAVHIAKQIG
FT                   YPVALKLRSPDIPHKSEVQGVMLYLRTANEVQQAANAIFDRVKMAWPQARVHGLLVQSM
FT                   ANRAGAQELRVVVEHDPVFGPLIMLGEGGVEWRPEDQAVVALPPLNMNLARYLVIQGIK
FT                   SKKIRARSALRPLDVAGLSQLLVQVSNLIVDCPEIQRLDIHPLLASGSEFTALDVTLDI
FT                   APFEGDNESRLAVRPYPHQLEEWVELKNGERCLFRPILPEDEPQLQQFISRVTKEDLYY
FT                   RYFSEINEFTHEDLANMTQIDYDREMAFVAVRRIDQTEEILGVTRAISDPDNIDAEFAV
FT                   LVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNVDIQLEE
FT                   GIVGLTLNLAQREES"
FT   gene            complement(780937..781635)
FT                   /locus_tag="UM146_03800"
FT   CDS_pept        complement(780937..781635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03800"
FT                   /product="hypothetical protein"
FT                   /note="COG3148 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70172"
FT                   /protein_id="ADN70172.1"
FT                   /translation="MTENAVLQLRAERIARATRPFLARGNRVRRCQRCLLPEKLCLCST
FT                   ITPAQAKSRFCLLMFDTEPMKPSNTGRLIADILPDTVAFQWSRTEPSQDLLDLVQNPDY
FT                   QPMVVFPASYADEQREVIFTPPAGKPPLFIMLDGTWPEARKMFRKSPYLDNLPVISVDL
FT                   SRLSAYRLREAQAEGQYCTAEVAIALLDMAGDTRAATGLGEHFTRFKTRYLAGKTQHPG
FT                   SITAEQLESV"
FT   gene            complement(781704..782123)
FT                   /locus_tag="UM146_03805"
FT   CDS_pept        complement(781704..782123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03805"
FT                   /product="thioredoxin 2"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03805"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70173"
FT                   /protein_id="ADN70173.1"
FT                   /translation="MNTVCTHCQAINRIPDDRIEDAAKCGRCGHDLFDGEVINATGETL
FT                   DKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNTEAERELSSRFGI
FT                   RSIPTIMIFKNGQVVDMLNGAVPKAPFDSWLNESL"
FT   gene            782330..783367
FT                   /locus_tag="UM146_03810"
FT   CDS_pept        782330..783367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03810"
FT                   /product="putative methyltransferase"
FT                   /note="COG0566 rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70174"
FT                   /protein_id="ADN70174.1"
FT                   /translation="MNDEMKGKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPGKSRAD
FT                   GGRRPARDDKQSQHRDRKWEDSPWRTVSRAPGDETPEKADHGGISGKSFIDPEVLRRQR
FT                   AEETRVYGENACQALFQSRPEAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELT
FT                   KASGTEHHGGVCFLIKKRNGTTVQQWVSQAGAQDCVLALENESNPHNLGGMMRSCAHFG
FT                   VKGVVVQDAALLESGAAIRTAEGGAEYVQPITGDNIVNVLDDFRQAGYTVVTTSSEQGK
FT                   PLFKTSLPAKMVLVLGQEYEGLPDAARDPNDLRVKIDGTGNVAGLNISVATGVLLGEWW
FT                   RQNKA"
FT   gene            complement(783415..784104)
FT                   /locus_tag="UM146_03815"
FT   CDS_pept        complement(783415..784104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03815"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="COG0692 Uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03815"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70175"
FT                   /protein_id="ADN70175.1"
FT                   /translation="MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVF
FT                   NAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFT
FT                   RPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLL
FT                   WGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMP
FT                   VLPAESE"
FT   gene            784408..784791
FT                   /locus_tag="UM146_03820"
FT   CDS_pept        784408..784791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03820"
FT                   /product="autonomous glycyl radical cofactor GrcA"
FT                   /note="COG3445 Acid-induced glycyl radical enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70176"
FT                   /protein_id="ADN70176.1"
FT                   /translation="MITGIQITKAANDDLLNSFWLLDSEKGEARCIVAKAGFAEDEVVA
FT                   VSKLGDIEYREVPVEVKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVIARTFTESL"
FT   gene            complement(784847..785434)
FT                   /locus_tag="UM146_03825"
FT   CDS_pept        complement(784847..785434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03825"
FT                   /product="neutral amino-acid efflux protein"
FT                   /note="COG1280 Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03825"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70177"
FT                   /protein_id="ADN70177.1"
FT                   /translation="MTPTLLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAG
FT                   MSLGFLIVMLLCAGISFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKP
FT                   ISFWASFALQFVNVKIILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALA
FT                   GHLFQRLFRQYGRQLNIVLALLLVYCAVRIFY"
FT   gene            785492..786418
FT                   /locus_tag="UM146_03830"
FT   CDS_pept        785492..786418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03830"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70178"
FT                   /protein_id="ADN70178.1"
FT                   /translation="MFLHSKFDIFDRFGVMDLRRFITLKTVVEEGSFLRASQKLCCTQS
FT                   TVTFHIQQLEQEFSVQLFEKIGRRMCLTREGKKLLPHIYELTRVMDTLREAAKKESDPD
FT                   GELRVISGETLLSYRMPQVLQRFRQRAPKVRLSLQSLNCYVIRDALLNDEADVGVFYRV
FT                   GNDDALNRRELGEQPLALVASPQIADVDFTEPGRHNACSFIINEPQCVFRQIFESTLRQ
FT                   RRITVENTIELISIESIKRCVAANIGVSYLPRFAVVKELKCGELIELPFGEQSQTITAM
FT                   CAHHAGKAVSPAMHTFIQCVEECFLPG"
FT   gene            complement(786451..787785)
FT                   /locus_tag="UM146_03835"
FT   CDS_pept        complement(786451..787785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03835"
FT                   /product="ATP-dependent RNA helicase SrmB"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03835"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70179"
FT                   /protein_id="ADN70179.1"
FT                   /translation="MTVTTFSELELDESLLEALQDKGFTRPTAIQAAAIPPALDGRDVL
FT                   GSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAMQVADHARELAKHTH
FT                   LDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRML
FT                   DMGFAQDIEHIAGETRWRKQTLLFSATLEGDAIQDFAERLLEDPVEVSANPSTRERKKI
FT                   HQWYYRADDLEHKTALLVHLLKQPEATRSIVFVRKRERVHELANWLREAGINNCYLEGE
FT                   MVQGKRNEAIKRLTEGRVNVLVATDVAARGIDIPDVSHVFNFDMPRSGDTYLHRIGRTA
FT                   RAGRKGTAISLVEAHDHLLLGKVGRYIEEPIKARVIDELRPKTRAPSEKQTGKPSKKVL
FT                   AKRAEKKKAKEKEKPRVKKRHRDTKNIGKRRKPSGTGVPPQTTEE"
FT   gene            787917..788654
FT                   /locus_tag="UM146_03840"
FT   CDS_pept        787917..788654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03840"
FT                   /product="putative S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /note="COG4123 Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70180"
FT                   /protein_id="ADN70180.1"
FT                   /translation="MSQSTSVFRRNGFTFKQFFVAHDRCAMKVGTDGILLGAWAPVAGV
FT                   KRCLDIGAGSGLLALMLAQRTDDSVMIDAVELESEAAAQAQENINQSPWAERINVHTAD
FT                   ILQWITQQTVRFDLIISNPPYYQQGVECATPQREQARYTTTLDHPSLLTCAAECITEEG
FT                   FFCVVLPEQIGNGFTELALSMGWHLRLRTDVAENEARLPHRVLLAFSPQAGECFSDRLV
FT                   IRGPDQNYSEAYTALTQAFYLFM"
FT   gene            complement(788639..790261)
FT                   /locus_tag="UM146_03845"
FT   CDS_pept        complement(788639..790261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03845"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COG0029 Aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03845"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70181"
FT                   /protein_id="ADN70181.1"
FT                   /translation="MNTLPEHSCDVLIIGSGAAGLSLALRLVDQHQVIVLSKGPVTEGS
FT                   TFYAQGGIAAVFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLF
FT                   DTHIQPNGEESYHLTREGGHSHRRILHAADATGREVETTLVGKAQNHPNIRVLERSNAV
FT                   DLIVSDKIGLPGTRWVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSG
FT                   DGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDF
FT                   DERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLT
FT                   KEPVPIVPAAHYTCGGVMVDDHGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYG
FT                   WSAAEDISRRIPYAHGVSTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTK
FT                   RLARALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTL
FT                   DYPELLTHSGPSILSAGNHYINR"
FT   gene            790517..790672
FT                   /locus_tag="UM146_03850"
FT   CDS_pept        790517..790672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70182"
FT                   /protein_id="ADN70182.1"
FT                   /translation="MIRLQHDKQKQMRYGTLQKRDTLTLCLLKLQLMEWRFDSAWKFGL
FT                   GRLYLG"
FT   gene            790669..791244
FT                   /locus_tag="UM146_03855"
FT   CDS_pept        790669..791244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03855"
FT                   /product="RNA polymerase sigma factor RpoE"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03855"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70183"
FT                   /protein_id="ADN70183.1"
FT                   /translation="MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGD
FT                   VPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAE
FT                   NFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIM
FT                   DCPVGTVRSRIFRAREAIDNKVQPLIRR"
FT   gene            791277..791927
FT                   /locus_tag="UM146_03860"
FT   CDS_pept        791277..791927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03860"
FT                   /product="anti-RNA polymerase sigma factor SigE"
FT                   /note="COG3073 Negative regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70184"
FT                   /protein_id="ADN70184.1"
FT                   /translation="MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRG
FT                   DTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQM
FT                   GVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQ
FT                   QQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ"
FT   gene            791927..792883
FT                   /gene="rseB"
FT                   /locus_tag="UM146_03865"
FT   CDS_pept        791927..792883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseB"
FT                   /locus_tag="UM146_03865"
FT                   /product="periplasmic negative regulator of sigmaE"
FT                   /note="COG3026 Negative regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03865"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70185"
FT                   /protein_id="ADN70185.1"
FT                   /translation="MKQLWFAMSLVTGSLLFSANASATPASGALLQQMNLASQSLNYEL
FT                   SFISINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNG
FT                   DYIVDSLPSLIYTDFKRLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDTE
FT                   SKLPMRVDLLDRDGETLEQFRVIAFNVNQDISSSMQTLAKANLPPLLSVPVGEKAKFSW
FT                   TPTWLPQGFSEVSSSRRPLPTMDNMPIESRLYSDGLFSFSVNVNRATPSSSDQMLRTGR
FT                   RTVSTSVRDNAEITIVGELPPQTAKRIAENIKFGAAQ"
FT   gene            792880..793359
FT                   /locus_tag="UM146_03870"
FT   CDS_pept        792880..793359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03870"
FT                   /product="SoxR reducing system protein RseC"
FT                   /note="COG3086 Positive regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70186"
FT                   /protein_id="ADN70186.1"
FT                   /translation="MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGP
FT                   QTTHTIVVPCDEPLVPGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDV
FT                   AALCGAILGGFGGFLIARGYSRKFAARAEWQPIILSVALPPGLVRFETSSEDASQ"
FT   gene            793557..795356
FT                   /locus_tag="UM146_03875"
FT   CDS_pept        793557..795356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03875"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COG0481 Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03875"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70187"
FT                   /protein_id="ADN70187.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMD
FT                   LERERGITIKAQSVTLDYKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSA
FT                   KTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDK
FT                   VKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNPA
FT                   EKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPESSSALGFGFRC
FT                   GFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYEL
FT                   REPIAECHMLLPQAYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRL
FT                   KSTSRGYASLDYNFKRFQASDMVRVDVLINGERVDALALITHRGNSQNRGRELVEKMKD
FT                   LIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRKKKLLQKQKEGKKRMK
FT                   QIGNVELPQEAFLAILHVGKDNK"
FT   gene            795372..796346
FT                   /locus_tag="UM146_03880"
FT   CDS_pept        795372..796346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03880"
FT                   /product="signal peptidase I"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70188"
FT                   /protein_id="ADN70188.1"
FT                   /translation="MANMFALILVIATLVTGILWCVDKFFFAPKRRERQAAAQAAAGDS
FT                   LDKATLKKVAPKPGWLETGASVFPVLAIVLIVRSFIYEPFQIPSGSMMPTLLIGDFILV
FT                   EKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSK
FT                   ELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGI
FT                   RLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSAD
FT                   SRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGVRLSRIGGIH"
FT   gene            796613..797293
FT                   /gene="rnc"
FT                   /locus_tag="UM146_03885"
FT   CDS_pept        796613..797293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="UM146_03885"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0571 dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03885"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70189"
FT                   /protein_id="ADN70189.1"
FT                   /translation="MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGD
FT                   SILSYVIANALYHRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSG
FT                   GFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEY
FT                   LQGRHLPLPTYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK
FT                   LELE"
FT   gene            797290..798195
FT                   /gene="era"
FT                   /locus_tag="UM146_03890"
FT   CDS_pept        797290..798195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="UM146_03890"
FT                   /product="GTP-binding protein Era"
FT                   /note="COG1159 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70190"
FT                   /protein_id="ADN70190.1"
FT                   /translation="MSIDKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH
FT                   RIVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD
FT                   DEMVLNKLRDGKAPVILAVNKVDNVQEKADLLPHLQFLASQMNFLDIVPISAETGLNVD
FT                   TIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFV
FT                   SNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVKV
FT                   KSGWADDERALRSLGYVDDL"
FT   gene            798207..798935
FT                   /gene="recO"
FT                   /locus_tag="UM146_03895"
FT   CDS_pept        798207..798935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="UM146_03895"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03895"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70191"
FT                   /protein_id="ADN70191.1"
FT                   /translation="MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRST
FT                   LKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYET
FT                   RFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMT
FT                   YRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPL
FT                   KSRELFRQFMPKRTVKTHYE"
FT   gene            798947..799678
FT                   /locus_tag="UM146_03900"
FT   CDS_pept        798947..799678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03900"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /note="COG0854 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70192"
FT                   /protein_id="ADN70192.1"
FT                   /translation="MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVH
FT                   LREDRRHITDRDVCILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTE
FT                   GGLDVAGQREKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAK
FT                   TDAEQAQELARIAKAATFATSLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRA
FT                   VMTGLKDAVAEMKRLMLEARG"
FT   gene            799678..800058
FT                   /gene="acpS"
FT                   /locus_tag="UM146_03905"
FT   CDS_pept        799678..800058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="UM146_03905"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /EC_number="2.7.8.7"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03905"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70193"
FT                   /protein_id="ADN70193.1"
FT                   /translation="MAILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWEIWKTHHQ
FT                   PVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGV
FT                   VNMHVTLADERHYACATVIIES"
FT   gene            complement(800753..801013)
FT                   /locus_tag="UM146_03910"
FT   CDS_pept        complement(800753..801013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03910"
FT                   /product="ferredoxin (4Fe-4S cluster-containing protein)
FT                   (fdx-like)"
FT                   /note="COG1145 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70194"
FT                   /protein_id="ADN70194.1"
FT                   /translation="MALLITKKCINCDMCEPECPNEAISMGEHIYEINSDKCTECVGHY
FT                   ETPTCQKVCPIPNTIVKDPQHVETEEQLWDKFVLMHHADKI"
FT   gene            complement(801069..801917)
FT                   /locus_tag="UM146_03915"
FT   CDS_pept        complement(801069..801917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03915"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG1737 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03915"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70195"
FT                   /protein_id="ADN70195.1"
FT                   /translation="MNGLLRIRQRYQGLAQSDKKLADYLLLQPDTARHLSSQQLANEAG
FT                   VSQSSVVKFAQKLGYKGFPALKLALSEALASQPESPSVPIHNQIRGDDPLRLVGEKLIK
FT                   ENTAAMYATLNVNTEEKLHECVTMLRSARRIILTGIGASGLVAQNFAWKLMKIGFNAAA
FT                   VRDMHALLATVQASSPDDLLLAISYTGVRRELNLAADEMLRVGGKVLAITGFTPNALQQ
FT                   RASHCLYTIAEEQATNSASISACHAQGMLTDLLFIALIQQDLELAPERIRHSEALVKKL
FT                   V"
FT   gene            802126..802761
FT                   /locus_tag="UM146_03920"
FT   CDS_pept        802126..802761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03920"
FT                   /product="hypothetical protein"
FT                   /note="COG0560 Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70196"
FT                   /protein_id="ADN70196.1"
FT                   /translation="MATHERRVVFFDLDGTLHQQDMFGSFLRYLLRRQPLNALLVLPLL
FT                   PIIAIALLIKGRAARWPMSLLLWGCTFGHNEARLQALQADFVRWFRDNVTAFPLVQERL
FT                   TTYLLSSDADIWLITGSPQPLVEAVYFDTPWLPRVNLIASQIQRGYGGWVLTMRCLGHE
FT                   KVAQLERKIGTPLRLYSGYSDSNQDNPLLYFCQHRWRVTPRGELQQLE"
FT   gene            802786..803322
FT                   /locus_tag="UM146_03925"
FT   CDS_pept        802786..803322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03925"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /note="COG0590 Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03925"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70197"
FT                   /protein_id="ADN70197.1"
FT                   /translation="MRRAFITGVFFLSEVEFSHEYWMRHAMTLAKRAWDEREVPVGAVL
FT                   VHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGA
FT                   MIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLSDFFRMR
FT                   RQEIKAQKKAQSSTD"
FT   gene            complement(803319..804875)
FT                   /locus_tag="UM146_03930"
FT   CDS_pept        complement(803319..804875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03930"
FT                   /product="putative transglycosylase"
FT                   /note="COG4623 Predicted soluble lytic transglycosylase
FT                   fused to an ABC-type amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70198"
FT                   /protein_id="ADN70198.1"
FT                   /translation="MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGEL
FT                   RVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADL
FT                   LAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVND
FT                   LQTLKDTKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALD
FT                   ITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFL
FT                   RAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQS
FT                   LGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTA
FT                   KTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEK
FT                   EKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQ
FT                   N"
FT   gene            805134..809021
FT                   /locus_tag="UM146_03935"
FT   CDS_pept        805134..809021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03935"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="COG0046 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03935"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70199"
FT                   /protein_id="ADN70199.1"
FT                   /translation="MMEILRGSPALSAFRINKLLARFQAARLLVHTIYAEYVHFADLNA
FT                   PLNDDEHAQLERLLKYGPALASHAPQGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVN
FT                   RLERGVAYYIEAGTLTNEQWQQVTAELHDRMMETVFFALDDAEQLFAHHQPTPVTSVDL
FT                   LGQGRQALIDANLRLGLALAEDEIDYLQDAFTRLGRNPNDIELYMFAQANSEHCRHKIF
FT                   NADWVIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
FT                   FHQEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNL
FT                   RIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALNGYFRTYEEKVNSH
FT                   NGEELRGYHKPIMLAGGIGNIRADHVQKGEINVGAKLVVLGGPAMNIGLGGGAASSMAS
FT                   GQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVS
FT                   DGGRGGKFELRDILSDEPGMSPLEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAV
FT                   IGEATEELHLSLHDRHFDNQPIDLPLDVLLGKTPKMTRDVQTLKAKGDALAREGITIAD
FT                   AVKRVLHLPTVAEKTFLVTIGDRSVTGMVARDQMVGPWQVPVANCAVTTASLDSYYGEA
FT                   MAIGERAPVALLDFAASARLAVGEALTNIAATQIGDIKRIKLSANWMAAAGHPGEDAGL
FT                   YEAVKAVGEELCPALGLTIPVGKDSMSMKTRWQEGNEEREMTSPLSLVISAFARVEDVR
FT                   HTITPQLSTEDNALLLIDLGKGNNALGATALAQVYRQLGDKPADVRDVAQLKGFYDAIQ
FT                   ALVAQRKLLAYHDRSDGGLLVTLAEMAFAGHCGIDADIATLGDDRLAALFNEELGAVIQ
FT                   VRAADREAVEAVLAQHGLADCVHYVGQAVSGDRFVITANGQTVFSESRTTLRVWWAETT
FT                   WQMQRLRDNPECADQEHQAKSNDADPGLNVKLSFDINEDVAAPFIATGARPKVAVLREQ
FT                   GVNSHVEMAAAFHRAGFDAIDVHMSDLLAGRTGLEGFHVLVACGGFSYGDVLGAGEGWA
FT                   KSILFNDRVRDEFATFFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFVRNTSDRFE
FT                   ARFSLVEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDAAHLAALESKGLVALRYVDN
FT                   FGKVTETYPANPNGSPNGITAVTTESGRVTIMMPHPERVFRTVSNSWHPENWGEDGPWM
FT                   RIFRNARKQLG"
FT   gene            809597..811024
FT                   /locus_tag="UM146_03940"
FT   CDS_pept        809597..811024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03940"
FT                   /product="putative sensory kinase in two-component system"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70200"
FT                   /protein_id="ADN70200.1"
FT                   /translation="MNRWPVFPRSLRQLVMLAFLLILLPLLVLAWQAWQSLNALSDQAA
FT                   LVNRTTLIDARRSEAMTNAALEMERSYRQYCVLDDPTLAKVYQSQRKRYSEMLDAHAGV
FT                   LPDDKLYQALRQDLNNLAQLQCNNSGPDAAAAARLEAFASANTEMVQATRTVVFSRGQQ
FT                   LQREIAERGQYFGWQSLVLFLVSLVMVLLFTRMIIGPVKNIERMINRLGEGRSLGNSVS
FT                   FSGPSELRSVGQRILWLSERLSWLESQRHQFLRHLSHELKTPLASMREGTELLADQVVG
FT                   PLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSAVELENVELAPLVETVVSAHSL
FT                   PARAKMMHTDVDLKATACLAEPMLLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYI
FT                   DVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDES
FT                   GQDVCFRIELPSSKNTK"
FT   gene            811189..811902
FT                   /locus_tag="UM146_03945"
FT   CDS_pept        811189..811902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03945"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70201"
FT                   /protein_id="ADN70201.1"
FT                   /translation="MRHIFQRLLPRRLWLAGLPCLALLGCVQSHNKPAIDTPAEEKIPV
FT                   YQLADYLSTECSDIWALQGKSTETNPLYWLRAMDCADRLMPAQSRQQARQYDDGNWQNT
FT                   FKQGILLADAKITPYERRQLVARIDALSTEIPAQVRPLYQLWRDGQALQLQLAEERQRY
FT                   SKLQQSSDSELDTLRQQHHVLQQQLELTTRKLENLTDIERQLSTRKPAGNFSPDTPHES
FT                   EKPAPSTDEVTPDEP"
FT   gene            811892..813226
FT                   /locus_tag="UM146_03950"
FT   CDS_pept        811892..813226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03950"
FT                   /product="putative DNA-binding response regulator in
FT                   two-component system"
FT                   /note="COG2204 Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70202"
FT                   /protein_id="ADN70202.1"
FT                   /translation="MSHKPAHLLLVDDDPGLLKLLGLRLTSEGYSVVTAESGVEGLRVL
FT                   NREKVDLVISDLRMDEMDGMQLFAEIQKVQPGMPVIILTAHGSIPDAVAATQQGVFSFL
FT                   TKPVDKDALYQAIDDALEQSAPATDERWREAIVTRSPLMLRLLEQARLVAQSDVSVLIN
FT                   GQSGTGKEIFAQAIHNASPRNSKPFIAINCGALPEQLLESELFGHARGAFTGAVSNREG
FT                   LFQAAEGGTLFLDEIGDMPAPLQVKLLRVLQERKVRPLGSNRDIDIDVRIISATHRDLP
FT                   KAMTRGEFREDLYYRLNVVSLKIPALAERTEDIPLLANHLLRQAAERHKPFVRAFSTDA
FT                   MKRLMTASWPGNVRQLVNVIEQCVALTSSPVISDALVEQALEGENTALPTFVEARNQFE
FT                   LNYLRKLLQITKGNVTHAARMAGRNRTEFYKLLSRHELDANDFKE"
FT   gene            813287..813625
FT                   /locus_tag="UM146_03955"
FT   CDS_pept        813287..813625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03955"
FT                   /product="nitrogen regulatory protein P-II 1"
FT                   /note="COG0347 Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03955"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70203"
FT                   /protein_id="ADN70203.1"
FT                   /translation="MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRT
FT                   GEEDDAAI"
FT   gene            complement(813670..814860)
FT                   /locus_tag="UM146_03960"
FT   CDS_pept        complement(813670..814860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03960"
FT                   /product="nitric oxide dioxygenase"
FT                   /EC_number="1.14.12.17"
FT                   /note="COG1017 Hemoglobin-like flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70204"
FT                   /protein_id="ADN70204.1"
FT                   /translation="MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM
FT                   SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLA
FT                   TLDEMFSPGQEVLDAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPR
FT                   SALITSFELEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPDGKGYRIAVK
FT                   REEGGQVSNWLHNHANVGDVVKLVAPAGDFFMAVADDTPVTLISAGVGQTPMLAMLDTL
FT                   AKAGHTAQVNWFHAAENGDVHAFADEVKELGQSLPRFTAHTWYRQPNEADRAKGQFDSE
FT                   GLMDLSKLEGAFSDPTMQFYLCGPVGFMQFAAKQLVDLGVKQENIHYECFGPHKVL"
FT   gene            815188..816441
FT                   /gene="glyA"
FT                   /locus_tag="UM146_03965"
FT   CDS_pept        815188..816441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="UM146_03965"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG0112 Glycine/serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03965"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70205"
FT                   /protein_id="ADN70205.1"
FT                   /translation="MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQ
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFA
FT                   VYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAK
FT                   EHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHV
FT                   VTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAME
FT                   PEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRA
FT                   NITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVI
FT                   ERIKGKVLDICARYPVYA"
FT   gene            complement(816505..817698)
FT                   /locus_tag="UM146_03970"
FT   CDS_pept        complement(816505..817698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03970"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70206"
FT                   /protein_id="ADN70206.1"
FT                   /translation="MRACINNQQIRHHNKCVILELLYRQKRANKSTLARLAQISIPAVS
FT                   NILQELESEKRVVNIDDESQTRGHSSGTWLIAPEGDWTLCLNVTPTSIECQVANACLSP
FT                   KGEFEYLQIDAPTPQALLSEIEKCWHRHRKLWPDRTINLALAIHGQVDPVTGVSQTMPQ
FT                   APWATPIEVKYLLEEKLGIRVMVDNDCVMLALAEKWQNNSQVRDFCVINVDYGIGSSFV
FT                   INEQIYRGSLYGSGQIGHTIVNPDGVVCDCGRYGCLETVASLSALKKQARVWLKSQPVN
FT                   TQLDPEKLTTAQLIAAWQSGEPWITSWVDHSANAIGLSLYNFLNILNINQIWLYGRSCA
FT                   FGENWLNTIIRQTGFNPFDRDEGPSVKATQIGFGQLSRAQQVLGIGYLYVEAQLRQI"
FT   gene            817816..821097
FT                   /locus_tag="UM146_03975"
FT   CDS_pept        817816..821097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03975"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03975"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70207"
FT                   /protein_id="ADN70207.1"
FT                   /translation="MTPVKVWQERVEIPTYETGPQDIHPMFLENRVYQGSSGAVYPYGV
FT                   TDTLSEQKTLKSWQAVWLENDYIKVMILPELGGRVHRAWDKVKQRDFVYHNEVIKPALV
FT                   GLLGPWISGGIEFNWPQHHRPTTFMPVDFTLEAHDDGAQTVWVGETEPMHGLQVMTGFT
FT                   LRPDRAALEIASRVYNGNATPRHFLWWANPAVKGGEGHQSVFPPDVTAVFDHGKRAVSA
FT                   FPIATGTYYKVDYSAGVDISRYKNVPVPTSYMAEKSQYDFVGAWCHDEDGGLLHVANHH
FT                   IAPGKKQWSWGHSEFGQAWDKSLTDNNGPYIELMTGIFADNQPDFTWLDAYEEKRFEQY
FT                   FLPYHSLGMVQNASRDAVIKLQRSERGIEWGLYAISPLNGYRLAIREIGKCNALLDDAV
FT                   ALTPATAIQGVLHGINPERLTIELSDADGNIVLSYHEHQSQALPLPDVAKAPLAAQDIT
FT                   STDEAWFIGQHLEQYHHASRSPFDYYLRGVALDPLDYRCNLALAMLEYNRADFPQAVAY
FT                   ATQALKRAHALNKNPQCGQASLIRASAYERQGQYQQAEEDFWRAVWSGNSKAGGYYGLA
FT                   RLAARNGNFDAGLDFCQQSLRACPTNQEVLCLHNLLLVLSGRQDNARLQREKLLRDYPL
FT                   NATLWWLNWFDGRSESALVQWRGLCQGRDVNALMTAGQLINWGMPALAADMLNALDCQR
FT                   TLPLYLQASLLPKAERGELVVKAIDAFPQFVRFPNTLEEVAALESIEECWFARHLLACF
FT                   YYNKRSYGKAIALWQRCVEMSPEFADGWRGLAIHAWNKQHDYELAARYLDNAYQLAPQD
FT                   ARLLFERDLLDKLSGVTPEKRLARLENNLEIALKRDDMTAELLNLWHLTGQADKAADIL
FT                   ATRKFHPWEGGEGKVTSQFILNQLLRAWQHLDAREPQQASELLHVALHYPENLSEGRLP
FT                   GQTDNDIWFWQAVCANAQGDETEAMRCLRLAATGDRTINIHSYYNDQPVDYLFWQGMAL
FT                   RLLGEQHTAQQLFSEMKQWAKEMAKTSIEADFFAVSQPDLLSLYSDLQQQHKEKCLMVA
FT                   MLAAAGLGEVAHYESARAELMAINPAWPKAALFTTVMPFIFSYVH"
FT   gene            821194..822177
FT                   /locus_tag="UM146_03980"
FT   CDS_pept        821194..822177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03980"
FT                   /product="putative sugar transporter subunit:
FT                   periplasmic-binding component of ABC superfamily protein"
FT                   /note="COG1879 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70208"
FT                   /protein_id="ADN70208.1"
FT                   /translation="MPKKMTRTRNLLLMATLLGSALFARASDKEMTIGAIYLDTQGYYA
FT                   GVRQGVQDAAKDSSVQVQLIETNAQGDISKESTFVDTLVERNVDAIILSAVSENGSSRT
FT                   VRRASEAGIPVICYNTCINQKGVDKYVSAYLVGDPLEFGKKLGNAAADYFIANKIDQPK
FT                   IAVINCEAFEVCVQRRKGFEEVLKTRVPGAQIVANQEGTVLDKAISVGEKLIISTPDLN
FT                   AIMGESGGATLGAVKAVRNQNQAGKIAVFGSDMTTEIAQELENNQVLKAVVDISGKKMG
FT                   NAVFAQTLKVINKQADGEKVIQVPIDLYTKTEDGKQWLATHVDGLP"
FT   gene            822200..823711
FT                   /locus_tag="UM146_03985"
FT   CDS_pept        822200..823711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03985"
FT                   /product="fused putative sugar transporter subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /note="COG1129 ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03985"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70209"
FT                   /protein_id="ADN70209.1"
FT                   /translation="MFTATEAVPVAKVVAGNKRYPGVVALDNVNFTLNKGEVRALLGKN
FT                   GAGKSTLIRMLTGSERPDSGDIWIGETRLEGDEATLTRRAAELGVRAVYQELSLVEGLT
FT                   VAENLCLGQWPRRNGMIDYLQMAQDAQRCLQALGVDVSPEQLVSTLSPAQKQLVEIARV
FT                   MKGEPRVVILDEPTSSLASAEVELVISAVKKMSALGVAVIYVSHRMEEIRRIASCATVM
FT                   RDGQVAGDVMLENTSTHHIVSLMLGRDHVDIAPVAPQEIMDQAVLEVRALRHKPKLEDI
FT                   SFTLRCGEVLGIAGLLGAGRSELLKAIVGLETYEQGEIVINGEKITRPDYGDMLKRGIG
FT                   YTPENRKEAGIIPWLGVDENTVLTNRQKISANGVLQWSTIRRLTEEVMQRMTVKAASSE
FT                   TPIGTLSGGNQQKVVIGRWVYAASQILLLDEPTRGVDIEAKQQIYRIVRELAAEGKSVV
FT                   FISSEVEELPLVCDRILLLQHGTFSQEFHSPVNVDELMSAILSVH"
FT   gene            823736..824734
FT                   /locus_tag="UM146_03990"
FT   CDS_pept        823736..824734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03990"
FT                   /product="putative sugar transporter subunit: membrane
FT                   component of ABC superfamily protein"
FT                   /note="COG1172 Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70210"
FT                   /protein_id="ADN70210.1"
FT                   /translation="MSASSLPLPQGKSVSLKQFVSRHINEIGLLVVIAILYLVFSLNAP
FT                   GFISLNNQMNVLRDAATIGIAAWAMTLIIISGEIDVSVGPMVAFVSVCLAFLLQFDVPL
FT                   AIACLLVLLLGALMGTLAGVLRGVFNVPSFVATLGLWSALRGMGLFMTNALPVPINENE
FT                   VLDWLGGQFLGVPVSALIMMVLFALFVFISRKTAFGRSVFAVGGNATAAQLCGINVRRV
FT                   RILIFTLSGLLAAVTGILLAARLGSGNAGAANGLEFDVIAAVVVGGTALSGGRGSLFGT
FT                   LLGVLVITLIGNGLVLLGINSFFQQVVRGVIIVVAVLANILLTQRSSKAKR"
FT   gene            824767..825861
FT                   /locus_tag="UM146_03995"
FT   CDS_pept        824767..825861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_03995"
FT                   /product="hypothetical protein"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_03995"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70211"
FT                   /protein_id="ADN70211.1"
FT                   /translation="MKINRIVNEGFMKTMLAAYLPGNSTVDLREVAVPTPGINQVLIKM
FT                   KSSGICGSDVHYIYHQHRATAAAPDKPLYQGFINGHEPCGQIVAMGQGCRHFKEGDRVL
FT                   VYHISGCGFCPNCRRGFPISCTGEGKAAYGWQRDGGHAEYLLAEEKDLILLPDALSYED
FT                   GAFISCGVGTAYEGILRGEVSGSDNVLVVGLGPVGMMAMMLAKGRGAKRIIGVDMLPER
FT                   LAMAKQLGVMDHGYLATTEGLPQIIAELTHGGADVALDCSGNAAGRLLALQSTADWGRV
FT                   VYIGETGKVEFEVSADLMHHQRRIIGSWVTSLFHMEKCAHDLTDWKLWPRNAITHRFSL
FT                   EQAGDAYALMASGKCGKVVINFPD"
FT   gene            825873..826745
FT                   /locus_tag="UM146_04000"
FT   CDS_pept        825873..826745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_04000"
FT                   /product="aldose 1-epimerase"
FT                   /note="COG2017 Galactose mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70212"
FT                   /protein_id="ADN70212.1"
FT                   /translation="MTIYTLSHGPLKLDVSDQGGVIEGFWRDTTPLLRPGKKSGVATDA
FT                   SCFPLVPFANRVSGNRFVWQGREYQLQPNVEWDAHYLHGDAWLGQWQCVSRSEDSLCLV
FT                   YEHRSGVYHYRVSQAFHLTADTLTVTLSVTNKGAETLPFGTGWHPYFPLSPQTRIQAQA
FT                   SCYWREQEQWLAGEFCEQLPQELDFNQLAPLPRQWVNNGFAGWNGQARIEQPQEGYAII
FT                   METTPPAPCYFIFVSDPAFDKGYAFDFFCLEPMSHAPDDHHRPEGGDLIALAPGESTIS
FT                   EMSLRVALL"
FT   gene            complement(826905..827327)
FT                   /locus_tag="UM146_04005"
FT   CDS_pept        complement(826905..827327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_04005"
FT                   /product="hypothetical protein"
FT                   /note="COG2259 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_04005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70213"
FT                   /protein_id="ADN70213.1"
FT                   /translation="MNSLRYFDFGTARPVLLLIARIAVVLIFIIFGFPKMMGFGGTVQY
FT                   MASLGAPMPMLAAIIAVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGHHYWDMTG
FT                   DAVGPNMINFWKNVSIAGAFLLLAITGPGAISLDRR"
FT   gene            827696..828835
FT                   /locus_tag="UM146_04010"
FT   CDS_pept        827696..828835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_04010"
FT                   /product="putative 3-phenylpropionic acid transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70214"
FT                   /protein_id="ADN70214.1"
FT                   /translation="MVLQSTRWLALGYFTYFFSYGIFLPFWSVWLKGIGLTPETIGLLL
FT                   GAGLVARFLGSLLIAPRVSDPSRLISALRVLALLTLLFAVAFWAGAHVAWLMLVMIGFN
FT                   LFFSPLVPLTDALANTWQKQFPLDYGKVRLWGSVAFVIGSALTGKLVSMFDYRVILALL
FT                   TLGVASMLLGFLIRPTIQPQGASRQQESTGWSAWLALVRQNWRFLACVCLLQGAHAAYY
FT                   GFSAIYWQAAGYSASAVGYLWSLGVVAEVIIFALSNKLFRRCSARDMLLISAICGVVRW
FT                   GIMGATTALPWLIVVQILHCGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIA
FT                   IMTVFAGFLYQYLGHGVFWVMALVALPAMFLRPKVVPSC"
FT   misc_feature    complement(828827..829290)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|117624763|ref|YP_853676.1| stationary phase inducible
FT                   protein CsiE"
FT   misc_feature    complement(828943..830111)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|218690655|ref|YP_002398867.1| stationary phase inducible
FT                   protein CsiE"
FT   gene            complement(830302..831156)
FT                   /locus_tag="UM146_04030"
FT   CDS_pept        complement(830302..831156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_04030"
FT                   /product="putative peptidase"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:UM146_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN70215"
FT                   /protein_id="ADN70215.1"
FT                   /translation="MALPVNKRVLKILFILFVVAFCVYLVPRVAINFFYYPDDKIYGPD
FT                   PWSAESVEFTAKDGTRLQGWFIPSSTGPADNAIATIIHAHGNAGNMSAHWPLVSWLPER
FT                   NFNVFMFDYRGFGKSKGTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANIL
FT                   DVIGQGDREGIRAVILDSTFASYATIANQMIPGSGYLLDESYSGENYIASVSPIPLLLI
FT                   HGKADHVIPWQHSEKLYSLAKEPKRLILIPDGEHIDAFSDRHGDVYREQMVDFILSALN
FT                   PQN"
FT   gene            complement(831301..832104)
FT                   /locus_tag="UM146_04035"
FT   CDS_pept        complement(831301..832104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="UM146_04035"
FT                   /product="inositol monophosphatase"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase f