(data stored in ACNUC7421 zone)

EMBL: CP002176

ID   CP002176; SV 1; circular; genomic DNA; STD; PRO; 2240045 BP.
XX
AC   CP002176;
XX
PR   Project:PRJNA292;
XX
DT   10-SEP-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Streptococcus pneumoniae 670-6B, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae 670-6B
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2240045
RA   Neuendorf B., Radune D., Fedorova N.B., Khouri H.M., Dodson R.J.,
RA   Daugherty S.C., Hollingshead S., Tettelin H.;
RT   "Structure and dynamics of the pan-genome of Streptococcus pneumoniae and
RT   closely related species";
RL   Unpublished.
XX
RN   [2]
RP   1-2240045
RA   Neuendorf B., Radune D., Fedorova N.B., Khouri H.M., Dodson R.J.,
RA   Daugherty S.C., Hollingshead S., Tettelin H.;
RT   ;
RL   Submitted (13-AUG-2010) to the INSDC.
RL   Institute for Genome Sciences, University of Maryland School of Medicine,
RL   801 W. Baltimore St, Baltimore, MD 21201, USA
XX
DR   MD5; 7c286ca6c02aca97bf4d5fa78fcf8ae7.
DR   BioSample; SAMN02604004.
DR   EnsemblGenomes-Gn; EBG00001077320.
DR   EnsemblGenomes-Gn; EBG00001077321.
DR   EnsemblGenomes-Gn; EBG00001077322.
DR   EnsemblGenomes-Gn; EBG00001077323.
DR   EnsemblGenomes-Gn; EBG00001077325.
DR   EnsemblGenomes-Gn; EBG00001077326.
DR   EnsemblGenomes-Gn; EBG00001077327.
DR   EnsemblGenomes-Gn; EBG00001077328.
DR   EnsemblGenomes-Gn; EBG00001077329.
DR   EnsemblGenomes-Gn; EBG00001077330.
DR   EnsemblGenomes-Gn; EBG00001077331.
DR   EnsemblGenomes-Gn; EBG00001077332.
DR   EnsemblGenomes-Gn; EBG00001077333.
DR   EnsemblGenomes-Gn; EBG00001077334.
DR   EnsemblGenomes-Gn; EBG00001077335.
DR   EnsemblGenomes-Gn; EBG00001077336.
DR   EnsemblGenomes-Gn; EBG00001077337.
DR   EnsemblGenomes-Gn; EBG00001077338.
DR   EnsemblGenomes-Gn; EBG00001077339.
DR   EnsemblGenomes-Gn; EBG00001077340.
DR   EnsemblGenomes-Gn; EBG00001077341.
DR   EnsemblGenomes-Gn; EBG00001077342.
DR   EnsemblGenomes-Gn; EBG00001077343.
DR   EnsemblGenomes-Gn; EBG00001077344.
DR   EnsemblGenomes-Gn; EBG00001077345.
DR   EnsemblGenomes-Gn; EBG00001077346.
DR   EnsemblGenomes-Gn; EBG00001077347.
DR   EnsemblGenomes-Gn; EBG00001077348.
DR   EnsemblGenomes-Gn; EBG00001077349.
DR   EnsemblGenomes-Gn; EBG00001077350.
DR   EnsemblGenomes-Gn; EBG00001077351.
DR   EnsemblGenomes-Gn; EBG00001077352.
DR   EnsemblGenomes-Gn; EBG00001077353.
DR   EnsemblGenomes-Gn; EBG00001077354.
DR   EnsemblGenomes-Gn; EBG00001077355.
DR   EnsemblGenomes-Gn; EBG00001077356.
DR   EnsemblGenomes-Gn; EBG00001077357.
DR   EnsemblGenomes-Gn; EBG00001077358.
DR   EnsemblGenomes-Gn; EBG00001077359.
DR   EnsemblGenomes-Gn; EBG00001077360.
DR   EnsemblGenomes-Gn; EBG00001077361.
DR   EnsemblGenomes-Gn; EBG00001077362.
DR   EnsemblGenomes-Gn; EBG00001077363.
DR   EnsemblGenomes-Gn; EBG00001077364.
DR   EnsemblGenomes-Gn; EBG00001077365.
DR   EnsemblGenomes-Gn; EBG00001077366.
DR   EnsemblGenomes-Gn; EBG00001077367.
DR   EnsemblGenomes-Gn; EBG00001077368.
DR   EnsemblGenomes-Gn; EBG00001077369.
DR   EnsemblGenomes-Gn; EBG00001077370.
DR   EnsemblGenomes-Gn; EBG00001077371.
DR   EnsemblGenomes-Gn; EBG00001077372.
DR   EnsemblGenomes-Gn; EBG00001077373.
DR   EnsemblGenomes-Gn; EBG00001077374.
DR   EnsemblGenomes-Gn; EBG00001077375.
DR   EnsemblGenomes-Gn; EBG00001077376.
DR   EnsemblGenomes-Gn; EBG00001077377.
DR   EnsemblGenomes-Gn; EBG00001077378.
DR   EnsemblGenomes-Gn; EBG00001077379.
DR   EnsemblGenomes-Gn; EBG00001077380.
DR   EnsemblGenomes-Gn; EBG00001077381.
DR   EnsemblGenomes-Gn; EBG00001077382.
DR   EnsemblGenomes-Gn; EBG00001077383.
DR   EnsemblGenomes-Gn; EBG00001077384.
DR   EnsemblGenomes-Gn; EBG00001077385.
DR   EnsemblGenomes-Gn; EBG00001077386.
DR   EnsemblGenomes-Gn; EBG00001077387.
DR   EnsemblGenomes-Gn; EBG00001077388.
DR   EnsemblGenomes-Gn; EBG00001077389.
DR   EnsemblGenomes-Gn; EBG00001077390.
DR   EnsemblGenomes-Gn; EBG00001077391.
DR   EnsemblGenomes-Gn; EBG00001077392.
DR   EnsemblGenomes-Gn; EBG00001077393.
DR   EnsemblGenomes-Gn; EBG00001077394.
DR   EnsemblGenomes-Gn; EBG00001077395.
DR   EnsemblGenomes-Gn; EBG00001077396.
DR   EnsemblGenomes-Gn; EBG00001077397.
DR   EnsemblGenomes-Gn; EBG00001077398.
DR   EnsemblGenomes-Gn; EBG00001077399.
DR   EnsemblGenomes-Gn; EBG00001077400.
DR   EnsemblGenomes-Gn; EBG00001077401.
DR   EnsemblGenomes-Gn; EBG00001077402.
DR   EnsemblGenomes-Gn; EBG00001077403.
DR   EnsemblGenomes-Gn; EBG00001077404.
DR   EnsemblGenomes-Gn; EBG00001077405.
DR   EnsemblGenomes-Gn; EBG00001077406.
DR   EnsemblGenomes-Gn; EBG00001077407.
DR   EnsemblGenomes-Gn; EBG00001077408.
DR   EnsemblGenomes-Gn; EBG00001077409.
DR   EnsemblGenomes-Gn; EBG00001077410.
DR   EnsemblGenomes-Gn; EBG00001077411.
DR   EnsemblGenomes-Gn; EBG00001077412.
DR   EnsemblGenomes-Gn; EBG00001077413.
DR   EnsemblGenomes-Gn; EBG00001077414.
DR   EnsemblGenomes-Gn; EBG00001077415.
DR   EnsemblGenomes-Gn; EBG00001077416.
DR   EnsemblGenomes-Gn; EBG00001077417.
DR   EnsemblGenomes-Gn; EBG00001077418.
DR   EnsemblGenomes-Gn; EBG00001077419.
DR   EnsemblGenomes-Gn; EBG00001077420.
DR   EnsemblGenomes-Gn; EBG00001077421.
DR   EnsemblGenomes-Gn; EBG00001077422.
DR   EnsemblGenomes-Gn; EBG00001077423.
DR   EnsemblGenomes-Gn; EBG00001077424.
DR   EnsemblGenomes-Gn; EBG00001077425.
DR   EnsemblGenomes-Gn; EBG00001077426.
DR   EnsemblGenomes-Gn; EBG00001077427.
DR   EnsemblGenomes-Gn; EBG00001077428.
DR   EnsemblGenomes-Gn; EBG00001077429.
DR   EnsemblGenomes-Gn; EBG00001077430.
DR   EnsemblGenomes-Gn; EBG00001077431.
DR   EnsemblGenomes-Gn; EBG00001077432.
DR   EnsemblGenomes-Gn; SP670_0248.
DR   EnsemblGenomes-Gn; SP670_0265.
DR   EnsemblGenomes-Gn; SP670_0315.
DR   EnsemblGenomes-Gn; SP670_0461.
DR   EnsemblGenomes-Gn; SP670_0484.
DR   EnsemblGenomes-Gn; SP670_0710.
DR   EnsemblGenomes-Gn; SP670_0817.
DR   EnsemblGenomes-Gn; SP670_1041.
DR   EnsemblGenomes-Gn; SP670_1211.
DR   EnsemblGenomes-Gn; SP670_1369.
DR   EnsemblGenomes-Gn; SP670_1437.
DR   EnsemblGenomes-Gn; SP670_1741.
DR   EnsemblGenomes-Gn; SP670_1774.
DR   EnsemblGenomes-Gn; SP670_2237.
DR   EnsemblGenomes-Tr; EBT00001679697.
DR   EnsemblGenomes-Tr; EBT00001679698.
DR   EnsemblGenomes-Tr; EBT00001679699.
DR   EnsemblGenomes-Tr; EBT00001679700.
DR   EnsemblGenomes-Tr; EBT00001679701.
DR   EnsemblGenomes-Tr; EBT00001679702.
DR   EnsemblGenomes-Tr; EBT00001679703.
DR   EnsemblGenomes-Tr; EBT00001679704.
DR   EnsemblGenomes-Tr; EBT00001679705.
DR   EnsemblGenomes-Tr; EBT00001679706.
DR   EnsemblGenomes-Tr; EBT00001679707.
DR   EnsemblGenomes-Tr; EBT00001679708.
DR   EnsemblGenomes-Tr; EBT00001679709.
DR   EnsemblGenomes-Tr; EBT00001679710.
DR   EnsemblGenomes-Tr; EBT00001679711.
DR   EnsemblGenomes-Tr; EBT00001679712.
DR   EnsemblGenomes-Tr; EBT00001679713.
DR   EnsemblGenomes-Tr; EBT00001679714.
DR   EnsemblGenomes-Tr; EBT00001679715.
DR   EnsemblGenomes-Tr; EBT00001679716.
DR   EnsemblGenomes-Tr; EBT00001679717.
DR   EnsemblGenomes-Tr; EBT00001679718.
DR   EnsemblGenomes-Tr; EBT00001679719.
DR   EnsemblGenomes-Tr; EBT00001679720.
DR   EnsemblGenomes-Tr; EBT00001679721.
DR   EnsemblGenomes-Tr; EBT00001679722.
DR   EnsemblGenomes-Tr; EBT00001679723.
DR   EnsemblGenomes-Tr; EBT00001679724.
DR   EnsemblGenomes-Tr; EBT00001679725.
DR   EnsemblGenomes-Tr; EBT00001679726.
DR   EnsemblGenomes-Tr; EBT00001679727.
DR   EnsemblGenomes-Tr; EBT00001679728.
DR   EnsemblGenomes-Tr; EBT00001679729.
DR   EnsemblGenomes-Tr; EBT00001679730.
DR   EnsemblGenomes-Tr; EBT00001679731.
DR   EnsemblGenomes-Tr; EBT00001679732.
DR   EnsemblGenomes-Tr; EBT00001679733.
DR   EnsemblGenomes-Tr; EBT00001679734.
DR   EnsemblGenomes-Tr; EBT00001679735.
DR   EnsemblGenomes-Tr; EBT00001679736.
DR   EnsemblGenomes-Tr; EBT00001679737.
DR   EnsemblGenomes-Tr; EBT00001679738.
DR   EnsemblGenomes-Tr; EBT00001679739.
DR   EnsemblGenomes-Tr; EBT00001679740.
DR   EnsemblGenomes-Tr; EBT00001679741.
DR   EnsemblGenomes-Tr; EBT00001679742.
DR   EnsemblGenomes-Tr; EBT00001679743.
DR   EnsemblGenomes-Tr; EBT00001679744.
DR   EnsemblGenomes-Tr; EBT00001679745.
DR   EnsemblGenomes-Tr; EBT00001679746.
DR   EnsemblGenomes-Tr; EBT00001679747.
DR   EnsemblGenomes-Tr; EBT00001679748.
DR   EnsemblGenomes-Tr; EBT00001679749.
DR   EnsemblGenomes-Tr; EBT00001679750.
DR   EnsemblGenomes-Tr; EBT00001679751.
DR   EnsemblGenomes-Tr; EBT00001679752.
DR   EnsemblGenomes-Tr; EBT00001679753.
DR   EnsemblGenomes-Tr; EBT00001679754.
DR   EnsemblGenomes-Tr; EBT00001679755.
DR   EnsemblGenomes-Tr; EBT00001679756.
DR   EnsemblGenomes-Tr; EBT00001679757.
DR   EnsemblGenomes-Tr; EBT00001679758.
DR   EnsemblGenomes-Tr; EBT00001679759.
DR   EnsemblGenomes-Tr; EBT00001679760.
DR   EnsemblGenomes-Tr; EBT00001679761.
DR   EnsemblGenomes-Tr; EBT00001679762.
DR   EnsemblGenomes-Tr; EBT00001679763.
DR   EnsemblGenomes-Tr; EBT00001679764.
DR   EnsemblGenomes-Tr; EBT00001679765.
DR   EnsemblGenomes-Tr; EBT00001679766.
DR   EnsemblGenomes-Tr; EBT00001679767.
DR   EnsemblGenomes-Tr; EBT00001679768.
DR   EnsemblGenomes-Tr; EBT00001679769.
DR   EnsemblGenomes-Tr; EBT00001679770.
DR   EnsemblGenomes-Tr; EBT00001679771.
DR   EnsemblGenomes-Tr; EBT00001679772.
DR   EnsemblGenomes-Tr; EBT00001679773.
DR   EnsemblGenomes-Tr; EBT00001679774.
DR   EnsemblGenomes-Tr; EBT00001679775.
DR   EnsemblGenomes-Tr; EBT00001679776.
DR   EnsemblGenomes-Tr; EBT00001679777.
DR   EnsemblGenomes-Tr; EBT00001679778.
DR   EnsemblGenomes-Tr; EBT00001679779.
DR   EnsemblGenomes-Tr; EBT00001679780.
DR   EnsemblGenomes-Tr; EBT00001679781.
DR   EnsemblGenomes-Tr; EBT00001679782.
DR   EnsemblGenomes-Tr; EBT00001679783.
DR   EnsemblGenomes-Tr; EBT00001679784.
DR   EnsemblGenomes-Tr; EBT00001679785.
DR   EnsemblGenomes-Tr; EBT00001679786.
DR   EnsemblGenomes-Tr; EBT00001679787.
DR   EnsemblGenomes-Tr; EBT00001679788.
DR   EnsemblGenomes-Tr; EBT00001679789.
DR   EnsemblGenomes-Tr; EBT00001679790.
DR   EnsemblGenomes-Tr; EBT00001679791.
DR   EnsemblGenomes-Tr; EBT00001679792.
DR   EnsemblGenomes-Tr; EBT00001679793.
DR   EnsemblGenomes-Tr; EBT00001679794.
DR   EnsemblGenomes-Tr; EBT00001679795.
DR   EnsemblGenomes-Tr; EBT00001679796.
DR   EnsemblGenomes-Tr; EBT00001679797.
DR   EnsemblGenomes-Tr; EBT00001679798.
DR   EnsemblGenomes-Tr; EBT00001679799.
DR   EnsemblGenomes-Tr; EBT00001679800.
DR   EnsemblGenomes-Tr; EBT00001679801.
DR   EnsemblGenomes-Tr; EBT00001679802.
DR   EnsemblGenomes-Tr; EBT00001679803.
DR   EnsemblGenomes-Tr; EBT00001679804.
DR   EnsemblGenomes-Tr; EBT00001679805.
DR   EnsemblGenomes-Tr; EBT00001679806.
DR   EnsemblGenomes-Tr; EBT00001679807.
DR   EnsemblGenomes-Tr; EBT00001679808.
DR   EnsemblGenomes-Tr; SP670_0248.
DR   EnsemblGenomes-Tr; SP670_0265.
DR   EnsemblGenomes-Tr; SP670_0315.
DR   EnsemblGenomes-Tr; SP670_0461.
DR   EnsemblGenomes-Tr; SP670_0484.
DR   EnsemblGenomes-Tr; SP670_0710.
DR   EnsemblGenomes-Tr; SP670_0817.
DR   EnsemblGenomes-Tr; SP670_1041.
DR   EnsemblGenomes-Tr; SP670_1211.
DR   EnsemblGenomes-Tr; SP670_1369.
DR   EnsemblGenomes-Tr; SP670_1437.
DR   EnsemblGenomes-Tr; SP670_1741.
DR   EnsemblGenomes-Tr; SP670_1774.
DR   EnsemblGenomes-Tr; SP670_2237.
DR   EuropePMC; PMC3067147; 21263055.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC3625235; 23593373.
DR   EuropePMC; PMC4094930; 24957517.
DR   EuropePMC; PMC4202715; 25368607.
DR   EuropePMC; PMC4572546; 26269621.
DR   EuropePMC; PMC4964562; 27465908.
DR   EuropePMC; PMC6411942; 30858412.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP002176.
DR   SILVA-SSU; CP002176.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2240045
FT                   /organism="Streptococcus pneumoniae 670-6B"
FT                   /strain="670-6B"
FT                   /serotype="6B"
FT                   /mol_type="genomic DNA"
FT                   /country="Spain"
FT                   /collection_date="1988"
FT                   /db_xref="taxon:189423"
FT   gene            197..1558
FT                   /gene="dnaA"
FT                   /locus_tag="SP670_0001"
FT   CDS_pept        197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SP670_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90083"
FT                   /protein_id="ADM90083.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYNYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1717..2853
FT                   /gene="dnaN"
FT                   /locus_tag="SP670_0002"
FT   CDS_pept        1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SP670_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90084"
FT                   /protein_id="ADM90084.1"
FT                   /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2918..3112
FT                   /locus_tag="SP670_0003"
FT   CDS_pept        2918..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0003"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90085"
FT                   /protein_id="ADM90085.1"
FT                   /translation="MYQVGNFVEMKKSHACTIKSTGKKANRWEITRVGADIKIKCSNCE
FT                   HVVMMGRYDFERKMNKIID"
FT   gene            complement(3541..3699)
FT                   /locus_tag="SP670_0004"
FT   CDS_pept        complement(3541..3699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90086"
FT                   /protein_id="ADM90086.1"
FT                   /translation="MIEDFLIDLENIQLEDMEIDFNMDIDIDLNIDFEIDVDLDDLDLT
FT                   LLQELEA"
FT   gene            complement(3753..4145)
FT                   /locus_tag="SP670_0005"
FT   CDS_pept        complement(3753..4145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90087"
FT                   /protein_id="ADM90087.1"
FT                   /translation="MELDKFKTMMNVRERMTYFLRFQRMAGSENQVTIDEEAWKLVLPY
FT                   RWDLSGEHEKAIREGLEIFAQDINSIENKRARKYFIIHYCYMRKKTMSECVEMAATSST
FT                   SYHRYKQIAVLNFARIHQNGELEVYK"
FT   gene            complement(5323..5826)
FT                   /locus_tag="SP670_0006"
FT   CDS_pept        complement(5323..5826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0006"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90088"
FT                   /protein_id="ADM90088.1"
FT                   /translation="MKRLAIETITKPMKLRGISKGIAELDGQGLEIDLDNLEIDFGGES
FT                   FDLARIPGTKGGYRYFFLCPDCGRRCRLLYKRYLYFSCGTCLDIHKSTLNRSKTDCQYY
FT                   WELALKEARKVEPGWSPRRGGYMFDGFPERPKYMKRDRYHKHYKKFLKYIEKGDRFWLN
FT                   GLRL"
FT   gene            complement(5895..6398)
FT                   /locus_tag="SP670_0007"
FT   CDS_pept        complement(5895..6398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0007"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90089"
FT                   /protein_id="ADM90089.1"
FT                   /translation="MTLKTFNFTYEFKDLDTAMVAGHALLGYMTGTYCQPAISLTYKNK
FT                   GTLVAEYVEDKKLNYIFKRICDSFKDYYKQPVNDEAFEERYKRERVLQLKESEDFESLL
FT                   NKVTDYELELLDYAERLLSDKSIPMDSMTAFGTLEMLGNESINLLQKLDVEGEYKGLAD
FT                   YSGQ"
FT   gene            complement(6913..8391)
FT                   /locus_tag="SP670_0008"
FT   CDS_pept        complement(6913..8391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0008"
FT                   /product="prophage Sa05, DNA primase, P4 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90090"
FT                   /protein_id="ADM90090.1"
FT                   /translation="MEVREQEQPPRTMKELENRIFKAGEEWRAEHTETKVNETTGDVTE
FT                   KVAIPQTFTVAKILSEIVTFTFISKSNIADYSLLYIYDLDEGIYTASNDLFNLLCKTFD
FT                   VRIKPREWPQIKLMVRTLTKIRKPLESSNLIPVQNGIINLETKELFPFSPKYVITSKIS
FT                   TAYHAPKRVPTDREGKTFDDWLNSIACNDSELVTLFWQIILEAINSNHTRNKFAIFYGD
FT                   GNNGKGTFQRFLINLIGESNISALKPAQFAEKHNLETLVGKVCNIGDEAPNEYLKNPSD
FT                   LMSITSGDTVLVNPKGRPAFEATFKLFNIFSGNYIPNGGNKTKGWYRRIMIVPFNADFN
FT                   GEKEKPWIKNEFLANDEVLEYALYKAINQEPFTHFIEPKAVKGLLEEYQEENDYLLSWV
FT                   KHEYMERGWHELDVVPVFILTRTLKHYAEDMGIAKPNVYGAGKDTIRHLQQLTPNKYQL
FT                   KKARVRIEDYDKLDPYGFERQKLGRVNHAVTKTE"
FT   gene            complement(8435..9295)
FT                   /locus_tag="SP670_0009"
FT   CDS_pept        complement(8435..9295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0009"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90091"
FT                   /protein_id="ADM90091.1"
FT                   /translation="MTIYEARGFQSNLVYPFDKIEPFQYIERFKPLVVPESADPEEYKR
FT                   TQAPYCLSGKVMPEKNGSYKRNNSSLIYRDLIFLDYDDIQGTSESFIEAVSSALFGYSY
FT                   ILYPTIKHSIEKPRFRLVVKSNNVMNEATYKQVVKEIADKIGLPFDMASLTWSQLQGLP
FT                   VTTGDPATYQKIVEHGLDYPVPKVEPRVKQETPERYKPKPSGQKSMTMRIIDTLFNGFG
FT                   DEGGRNVALTRFVGLLFNKWVDCDLETAYELTKIANSVTVEPLPIEELDRSFSSIARAE
FT                   YRKRG"
FT   gene            complement(9292..9564)
FT                   /locus_tag="SP670_0010"
FT   CDS_pept        complement(9292..9564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0010"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90092"
FT                   /protein_id="ADM90092.1"
FT                   /translation="MFSLSRESEQDLAHGILEVVERYLEAREKVPPRLTKLINRVELKE
FT                   ELKISDNTLNKWESQGLRRYQPPDDGSRMIYYLVTDIWKFLGVDE"
FT   gene            complement(9557..9898)
FT                   /locus_tag="SP670_0011"
FT   CDS_pept        complement(9557..9898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0011"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90093"
FT                   /protein_id="ADM90093.1"
FT                   /translation="MSLSENDKRVLRLIKVGAENSITGSEISLTTKLTERTVRDIIKRL
FT                   VVKHNIPIVGVRCGVFSGYFIPANKGELLDGAKAFYNQVQEESKRLAVLMNSDLESYKE
FT                   TLKEVGGYV"
FT   gene            complement(9879..10172)
FT                   /locus_tag="SP670_0012"
FT   CDS_pept        complement(9879..10172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90094"
FT                   /protein_id="ADM90094.1"
FT                   /translation="MNYIVKIYLDSEKIPDEPYFTKEIFLATCMGNATKLAVTMGLLTK
FT                   QALDLETETAILKTLDTIIETQKAILQGVASGQITFVNKSKGEEELDESIRE"
FT   gene            complement(10169..10384)
FT                   /locus_tag="SP670_0013"
FT   CDS_pept        complement(10169..10384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90095"
FT                   /protein_id="ADM90095.1"
FT                   /translation="MNELDISNTQAAVLIVILIGLLLYLNHRDRKKSAQIERENQQTIE
FT                   TPSEDLNPEYGRYIQLAGVNVWGGME"
FT   gene            complement(10446..10586)
FT                   /locus_tag="SP670_0014"
FT   CDS_pept        complement(10446..10586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90096"
FT                   /protein_id="ADM90096.1"
FT                   /translation="MTLDLGKMTQAEFDEVMADIKARNPNLLQFITDFLDGKVTPGEVD
FT                   D"
FT   gene            complement(10598..11098)
FT                   /locus_tag="SP670_0015"
FT   CDS_pept        complement(10598..11098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90097"
FT                   /protein_id="ADM90097.1"
FT                   /translation="MIADQLKAISTNLEEIQEILVGDGTALAKREISRVLNDLDDVYNE
FT                   LTSTEYREQQETLKEQTERMKQRVVAEVIGGLEEREESYYRNYWGDTKFIKLLSNFDGF
FT                   LFLNTYLAEITKENTYPMEQSQLLNYVWELIAVDIAKKKRGKKNVLDSWTDSSLYTRGM
FT                   MID"
FT   gene            complement(11118..11234)
FT                   /locus_tag="SP670_0016"
FT   CDS_pept        complement(11118..11234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90098"
FT                   /protein_id="ADM90098.1"
FT                   /translation="MEETTYDIIAKSLDRISMELHQADENNDFLEYGFYQDN"
FT   gene            complement(11492..11641)
FT                   /locus_tag="SP670_0017"
FT   CDS_pept        complement(11492..11641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90099"
FT                   /protein_id="ADM90099.1"
FT                   /translation="MTNYDRAKRFYSRATYVLSDFMHGRIDEQEFRKQWQRLADKAVNE
FT                   TKKN"
FT   gene            complement(11628..11774)
FT                   /locus_tag="SP670_0018"
FT   CDS_pept        complement(11628..11774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90100"
FT                   /protein_id="ADM90100.1"
FT                   /translation="MEQYTKRASALIITFNRGVISQDEFIEEFTKLREKVVKAVSEAKN
FT                   DKL"
FT   gene            complement(11778..12206)
FT                   /locus_tag="SP670_0019"
FT   CDS_pept        complement(11778..12206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0019"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90101"
FT                   /protein_id="ADM90101.1"
FT                   /translation="MGKKHQVVKFKDIAEKLPELEGKRLEEITKVLGYRNLESCRTNLC
FT                   KLKQNNRLDFTLEKGVYSKFALLDGTVKEELEDKELSERGRYLKSVDRYKAMLNAFSIA
FT                   FDSTVKAETRQKAEHDGLKALDRIPDKHYALLYDMMEG"
FT   gene            complement(12362..12529)
FT                   /locus_tag="SP670_0020"
FT   CDS_pept        complement(12362..12529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0020"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90102"
FT                   /protein_id="ADM90102.1"
FT                   /translation="MTDKKKMGRPTTDPKNLKMTIRFNDEQSRKIENYASQNNLTKSEV
FT                   IRKAVEQLPE"
FT   gene            complement(12806..13432)
FT                   /locus_tag="SP670_0021"
FT   CDS_pept        complement(12806..13432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90103"
FT                   /protein_id="ADM90103.1"
FT                   /translation="MELVYMDGKKEPYTLSSIVAECAEIKHRHLKILLNKHREDFESFG
FT                   KVQFKISPSESGQNVRDYILNEQQATLLITYLRNTEPVRKFKMNLVKAFFEMRDELSKF
FT                   RMQRALEKPKRKTLHDSIENWEQAPKHAHSTMNNLLLKAVTDRNAKQLREERGGYNGID
FT                   SLTSDELEQYQAFEDMVIAMMGLNMSYQEIKAMAFRNKKTRQRSA"
FT   gene            complement(13423..14007)
FT                   /locus_tag="SP670_0022"
FT   CDS_pept        complement(13423..14007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0022"
FT                   /product="BRO family, N-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90104"
FT                   /protein_id="ADM90104.1"
FT                   /translation="MTTQQKDLCDFFGNFYPKGETHNKKEVLEVVTTQRFGSKHFDVYG
FT                   DIQNPLFVAVEVAEMIEIQNTTDLLKRVDDDEKLTYVISRAGQKREMNMLTEFGVYEVL
FT                   SQSRKPLAKEFKKVVKHILKEIRLNGYYMAGELVEEPQTTIKAPGTLAEAERYYIDTLA
FT                   KAIAEAQNMDEKSRLTSKLTRFMQEVEPQWN"
FT   gene            complement(14307..14459)
FT                   /locus_tag="SP670_0023"
FT   CDS_pept        complement(14307..14459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0023"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90105"
FT                   /protein_id="ADM90105.1"
FT                   /translation="MKQSEVAQKLGISTTTWSKWENGKSFPDVAQVKEIEKLFGVAYDD
FT                   IIFLS"
FT   gene            14702..15418
FT                   /locus_tag="SP670_0024"
FT   CDS_pept        14702..15418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0024"
FT                   /product="cI repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90106"
FT                   /protein_id="ADM90106.1"
FT                   /translation="MADNIKRLLSAKGLNPRQLAIALDFKYTTVNDWVNAKTYPRIDKI
FT                   EMLANFFNVSKSDLVENKNAETPTTSPIQSIYDQLTPPRQEKALTYLKKQLLEQKNENI
FT                   VSENIISLDDYRESKTLPVIGVVTAGNGITQDDNLNMEKCFYTDEIPDDYDAIAYVVGN
FT                   SMEPKIKNGDYLFIKNTPQVDYNTIGIFQVDGANYVKKLRQGYLESLNPDCADIQLDES
FT                   NDIRTIGEVVSIYREN"
FT   gene            16644..17498
FT                   /locus_tag="SP670_0025"
FT   CDS_pept        16644..17498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0025"
FT                   /product="DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90107"
FT                   /protein_id="ADM90107.1"
FT                   /translation="MELQQYDELTFENIKHIDENGVEFWYARDLQKTLEYTEWRNFLLV
FT                   IDKAKIACDTAKNPIVEHFVDVNKSIPNGYNTTRDIKDFKLTRYACYLIVQNGDPRKEV
FT                   IALGQTYFALKTRQQELQENFDNLTEEQKRLAIRDEIKHHNKSLSESAGNAGVKNFGRF
FT                   HNSGYKGLYGGLTMQDIHNLKELNEGEHILDFMGSAELAANLFRATQTDEVLRRRNIKG
FT                   EDLANDTHFNVGRTIRNTMKELGTTMPENLPAPRESIQELKSKQKELEKQDDNNQLSLF
FT                   DDM"
FT   gene            17663..18829
FT                   /locus_tag="SP670_0026"
FT   CDS_pept        17663..18829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0026"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90108"
FT                   /protein_id="ADM90108.1"
FT                   /translation="MKITEYTKKDGSTVYRSSVYLGIDTVTGKKVKTTISGRTKRELKA
FT                   KALQAQIDFEKDGSTVYKAVEIKTYAELVENWLETYCHTVKKSTLMGTKFKIDKYLLPA
FT                   FGNYRLDKLTPPIIQKQVNQWAKDYNQLGKGFQEYPLLHSLNKRILKYAVSLQAIPFNP
FT                   ARDVIVPRRKEKEGQKLKYLDDDNLKKFLTYLEQLPNTYKNFYDTVLYKTLLATGLRIR
FT                   ECLALKWSDIDLKNGTLDVNKTLNIIKEITGPKTKSSIRVIDLDNKTVLMLRLYKARQS
FT                   QIGKEMGLTYEKVFSNSFDKHIDARMLSFRLVKHLERAGCPRFTFHAFRHTHASILLNA
FT                   GLPYKEIQTRLGHAKLSMTMDIYSHLSKDNQKNATSFYEKAIEKLKSS"
FT   gene            18949..20064
FT                   /gene="ychF"
FT                   /locus_tag="SP670_0027"
FT   CDS_pept        18949..20064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="SP670_0027"
FT                   /product="GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90109"
FT                   /protein_id="ADM90109.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVSEPD
FT                   SIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYEDLVKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            20135..20704
FT                   /gene="pth"
FT                   /locus_tag="SP670_0028"
FT   CDS_pept        20135..20704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SP670_0028"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90110"
FT                   /protein_id="ADM90110.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDEYIGILQS
FT                   VDKVDDSVNYYLQEKNFEKTMQRYNG"
FT   gene            20705..24214
FT                   /gene="mfd"
FT                   /locus_tag="SP670_0029"
FT   CDS_pept        20705..24214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SP670_0029"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90111"
FT                   /protein_id="ADM90111.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLMSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEISQLEPCRIEFFGDEIDGIRSFEVETQLSKENKTELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTNICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKGIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNIDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELILQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIAENKGLMELVFDVQNKKDYEILEGLLIFGESLLEIKESKEE
FT                   NSI"
FT   gene            24272..24538
FT                   /locus_tag="SP670_0030"
FT   CDS_pept        24272..24538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0030"
FT                   /product="ribosome-associated heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90112"
FT                   /protein_id="ADM90112.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            24531..24899
FT                   /locus_tag="SP670_0031"
FT   CDS_pept        24531..24899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0031"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90113"
FT                   /protein_id="ADM90113.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            24904..25026
FT                   /locus_tag="SP670_0032"
FT   CDS_pept        24904..25026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90114"
FT                   /protein_id="ADM90114.1"
FT                   /translation="MENLLDVIEQFLSLSDEKLEELADKNQLLRLQEEKERKNA"
FT   gene            25019..26287
FT                   /locus_tag="SP670_0033"
FT   CDS_pept        25019..26287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0033"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90115"
FT                   /protein_id="ADM90115.1"
FT                   /translation="MRKFLIILLLPSFLTISKVVSTEKEVVYTSKEIYYLSQSDFGIYF
FT                   REKLSSPMVYGEVPVYANEDLVVESGKLTPKTSFQITEWRLNKQGIPVFKLSNHQFIAA
FT                   DKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEVKSSLSAYSQVSIDKTMFVEGREF
FT                   LHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDSFSIYVKQLTTGKEAGINQDEKMY
FT                   AASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVNDFPGSYKPEGSGSLPKKEDNKEYS
FT                   LKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKMSAIMGDDWDPKEKLISSKMAGKF
FT                   MEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHKIGDADEFKHDTGVVYADSPFILS
FT                   IFTKNSDYDTISKIAKDVYEVLK"
FT   gene            26284..27561
FT                   /locus_tag="SP670_0034"
FT   CDS_pept        26284..27561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0034"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90116"
FT                   /protein_id="ADM90116.1"
FT                   /translation="MREPDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNINVEDLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEKEDELVLHYQNQVAYQGYLFSFGLPLEGESIQQI
FT                   PVSRETSIHIRHRKTGDVLIQNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            27565..28107
FT                   /gene="hpt"
FT                   /locus_tag="SP670_0035"
FT   CDS_pept        27565..28107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SP670_0035"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90117"
FT                   /protein_id="ADM90117.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKAREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            28123..30081
FT                   /gene="hflB"
FT                   /locus_tag="SP670_0036"
FT   CDS_pept        28123..30081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="SP670_0036"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90118"
FT                   /protein_id="ADM90118.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEGTGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMLGAQSPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            30203..30682
FT                   /locus_tag="SP670_0037"
FT   CDS_pept        30203..30682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0037"
FT                   /product="competence-specific global transcription
FT                   modulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90119"
FT                   /protein_id="ADM90119.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISRE
FT                   EGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLD
FT                   DYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
FT   gene            complement(35091..35210)
FT                   /locus_tag="SP670_0038"
FT   CDS_pept        complement(35091..35210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90120"
FT                   /protein_id="ADM90120.1"
FT                   /translation="MISNHSEGTFGRLRYLLGGDRPSQTARQTLSPIGITYLG"
FT   gene            36259..36441
FT                   /locus_tag="SP670_0039"
FT   CDS_pept        36259..36441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0039"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90121"
FT                   /protein_id="ADM90121.1"
FT                   /translation="MGKLELLCEEFGHKLLPLLPYSPEYNPIEKTWAHIKKNLKKVLPR
FT                   CHTFYEALLSCSCFN"
FT   gene            36632..36769
FT                   /locus_tag="SP670_0040"
FT   CDS_pept        36632..36769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90122"
FT                   /protein_id="ADM90122.1"
FT                   /translation="MKGVDDFLFIFEEGFKQGGKARADRDYSGVSSLRNSSKVYLEFLY
FT                   "
FT   gene            complement(36812..36955)
FT                   /locus_tag="SP670_0041"
FT   CDS_pept        complement(36812..36955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0041"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90123"
FT                   /protein_id="ADM90123.1"
FT                   /translation="MSFIAQDFDKLNIITVLESRTQAIIRNPMNTRLSSDTESSFNKIV
FT                   RN"
FT   gene            complement(37003..37209)
FT                   /locus_tag="SP670_0042"
FT   CDS_pept        complement(37003..37209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0042"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90124"
FT                   /protein_id="ADM90124.1"
FT                   /translation="MEVAETSIVKKNHQIPCIINQKIDQKLIEKTSMTDIDHQLSISTS
FT                   TVIRKINDFHFEHDFSRLPEIMS"
FT   gene            37526..37762
FT                   /locus_tag="SP670_0043"
FT   CDS_pept        37526..37762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90125"
FT                   /protein_id="ADM90125.1"
FT                   /translation="MLQKIYEQMTNFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRY
FT                   GIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            37951..39279
FT                   /gene="purA"
FT                   /locus_tag="SP670_0044"
FT   CDS_pept        37951..39279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SP670_0044"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90126"
FT                   /protein_id="ADM90126.1"
FT                   /translation="MYVRKEEPEGSDKIMTSVVVVGTQWGDEGKGKITDFLSANAEVIA
FT                   RYQGGDNAGHTIVIDGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEG
FT                   VTTDNLRISDRAHVILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIAD
FT                   LLDKDIFRERLERNLAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILN
FT                   DALDNGKRVLFEGAQGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKA
FT                   YTSRVGDGPFPTELFDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNL
FT                   SLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRN
FT                   LEDLPENARNYVRRVSELVGVRISTFSVGPGREQTNILESVWS"
FT   gene            complement(39521..40669)
FT                   /locus_tag="SP670_0045"
FT   CDS_pept        complement(39521..40669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0045"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90127"
FT                   /protein_id="ADM90127.1"
FT                   /translation="MKYNKTKYPNIYYYETAKGKRYYVRRSFFFRGKKREKSKSGLTTL
FT                   PQARAALVELEQQIQEQELGINTNLTLDQYWDIYSEKRLSTGRWNDTSYYLNDNLYKNH
FT                   IKAKFGSTLLKNLDRNEYELFIAEKLQNHTRYTVQTLNSSFMALLNDAVKNGNLLSNRL
FT                   KGVFIGQSDIPAANKKVTLKEFKTWIAKAEEIMPKQFYALTYLTIFGLRRGEVFGLRPM
FT                   DITQNDSGRAILHLRDSRSNQTLKGKGGLKTKDSERYVCLDDIGTDLIYYLIAEASKIK
FT                   RKLGIIKEQHKDYITINEKGGLINPNQLNRNFNLVNEATGLHVTPHMMRHFFTTQSIIA
FT                   GVPLEQLSQALGHTKVYMTDRYNQVEDELAEATTDLFLSHIR"
FT   gene            complement(40841..41755)
FT                   /locus_tag="SP670_0046"
FT   CDS_pept        complement(40841..41755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0046"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90128"
FT                   /protein_id="ADM90128.1"
FT                   /translation="MKIGMRKPSLTRSLKARTTSKWKRQAKKALIPGYGKKGMGWVKNP
FT                   KKAMYNKVYHKTTFGLSDLFKSSKKRKKKVVNNKQQSILASNGKKQHTPKEYKEAGLVF
FT                   MVLGAIFLFLFPPLGFFLFITGFITYIIGRLTAKREKKQKVENYSPQIDTIVFRDNFLL
FT                   MGTNYHQEEAEIAADFLSKGVHYFGKDNKSLKSYMLETYKPVYKYNKLKTVDVQLLPEP
FT                   SNPHDKNAVKVLVNNIFVGYLPAVIASQISSYISNPNYRYDAILTGRGGPYKTLNIETE
FT                   RVVSRKSDLTYYLDLTVWRLAKK"
FT   gene            complement(41768..42502)
FT                   /locus_tag="SP670_0047"
FT   CDS_pept        complement(41768..42502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0047"
FT                   /product="phage transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90129"
FT                   /protein_id="ADM90129.1"
FT                   /translation="MNVGERIKQRRKALKMSADELAESVGVSRSTIFRYEKGDIEKVGP
FT                   EVLKKIADKLNVSPGDLMGWEDNQQELKIPTSPLVHKITEKVVKLSTPRKQKVLNYANE
FT                   QLKEQNNKVITIEEKLFEYRVFEKLSAGTGFSYFNDGNYDTVFYDKDLDHDFASWVFGD
FT                   SMEPKYMNGEVVLIKETGFDYDGAIYAVDWDGQTYIKKVYKEKDGLRLVSINNKYKDKF
FT                   APFEEDPRIIGKIVGNFMPIEN"
FT   gene            42668..42883
FT                   /locus_tag="SP670_0048"
FT   CDS_pept        42668..42883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0048"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90130"
FT                   /protein_id="ADM90130.1"
FT                   /translation="MVNVSKLKGKIIERNTTQEALAKDIGIDKSTFYRKMKQNGSFSIQ
FT                   EVNLIVSSLGLSKDEALSIFFSETVA"
FT   gene            42911..43621
FT                   /locus_tag="SP670_0049"
FT   CDS_pept        42911..43621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0049"
FT                   /product="gp15"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90131"
FT                   /protein_id="ADM90131.1"
FT                   /translation="MNEIFNFHGQEVRTVMFDDEPWFVGKDIAEILGYVNSRDALAKHV
FT                   DEDDKLTSQIATAGQMRNQTVINESGLYSLILSSKLPQAKEFKRWVTSEVLPAIRKQGG
FT                   FIREDLDEDAFIALFTGQKKLREQQTSMLEDIDYLKSEQPIHPSYAQSLLKKRKARVVA
FT                   CLGGIDSPAYADKIFAQSVFRQAEIDFKDHFNISRYDLLPKKHADAALAYWMTWEPSTN
FT                   TKMKIMKLNSFDEG"
FT   gene            43634..43891
FT                   /locus_tag="SP670_0050"
FT   CDS_pept        43634..43891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0050"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90132"
FT                   /protein_id="ADM90132.1"
FT                   /translation="MDNVLLSLSEWIKSIIKDTITRLVEIEKDSDHYPELMDVNTTCEF
FT                   LGIKYATFSDNYRYLKGFPKELPGKKWSKRAIKEWLSNQI"
FT   gene            43977..44297
FT                   /locus_tag="SP670_0051"
FT   CDS_pept        43977..44297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90133"
FT                   /protein_id="ADM90133.1"
FT                   /translation="MFEPPILDQLMGVGALLLGFAGACRHIKLQEQRKEEERREEQEFA
FT                   SMIIRGYNHAYERGREAERQEIRKNIRRPFKGFTYDNEPPIGLRPEPLALPEPKQSAIR
FT                   FL"
FT   gene            44313..44609
FT                   /locus_tag="SP670_0052"
FT   CDS_pept        44313..44609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0052"
FT                   /product="gp18"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90134"
FT                   /protein_id="ADM90134.1"
FT                   /translation="MEELIEWLDNLIMIVKELEGRESTSRHFITIWENDYKNLLLVKEY
FT                   LTDYEKLAKDYRYVTLKNKLLKIEKMELEGRYIYEDMRMKYRANRRKWGARYV"
FT   gene            44593..45408
FT                   /locus_tag="SP670_0053"
FT   CDS_pept        44593..45408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0053"
FT                   /product="gp19"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90135"
FT                   /protein_id="ADM90135.1"
FT                   /translation="MLGMSEIKWIKITTDIFDDEKICLIDALPDPDAILVIWFKILTLA
FT                   GKHNSNGLLMMTDKVHYTDEMLATIFRRPLNTVRMAIGVFEQFGMIEIIDGIISLPNWE
FT                   KHQNVDGMEKIKEQTRNRVAKYRKKQKNLALGNVTGNVTVTDGNALEEDKDKNKNRLDK
FT                   DKNKKRITTTSSGSEENILELFQSEFRRLLSGFEIEEINHLLNENNVDLVKEALKTAIN
FT                   SGKPNIKYIGGILRNWQMNNVTTVEQVRQSEKKNKDKKEEQEAKDEWGY"
FT   gene            45396..45554
FT                   /locus_tag="SP670_0054"
FT   CDS_pept        45396..45554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0054"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90136"
FT                   /protein_id="ADM90136.1"
FT                   /translation="MGVLELIEQFEIDYYPLSYEKKTLLADQPIHQVVACLSEMASWHE
FT                   CGGRLVW"
FT   gene            45548..46318
FT                   /locus_tag="SP670_0055"
FT   CDS_pept        45548..46318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0055"
FT                   /product="gp21"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90137"
FT                   /protein_id="ADM90137.1"
FT                   /translation="MVDNVFEEIALSYRRNTEQQEEFCEKHNIPLIKILRTESVVCRMC
FT                   ESERIHEENQARVNELADAENERERKYYLEKFSLYDEVLKNATLDNFETPTEKEAEKLV
FT                   FAKRICREWSEGARNNIVLQGEAGTGKSHLAFAMVKALSEYTKEIAIFINVTDLLMKIK
FT                   ADFSQEEFLVNKIASAKFLVLDDLGMEKDSEWSFTILYNILNKRSNTIITTNLTSADIQ
FT                   KRYGRPFMSRLMKGVDKDHLMVFNDLTNKRKQYF"
FT   gene            46333..46527
FT                   /locus_tag="SP670_0056"
FT   CDS_pept        46333..46527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90138"
FT                   /protein_id="ADM90138.1"
FT                   /translation="MFILRHGTREDKPFLRSVVIGVTGLDISCSEEKKAMRFVSRGAAV
FT                   QVGKALRGSFGNFYPVEVE"
FT   gene            46527..47201
FT                   /locus_tag="SP670_0057"
FT   CDS_pept        46527..47201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0057"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90139"
FT                   /protein_id="ADM90139.1"
FT                   /translation="MMKFLNGDCMDIMKQYPDNYFDLAIVDPPYFSGPEKRKFYGRKIS
FT                   PIGVSRLYGEISEWKIPNRDYFDELFRVSKNQIIWGVNYFDYSFGSGRIVWDKVNGQSS
FT                   FSDCEIAYCSYHDSTRLFRYMWNGMMQGKSISEGHIQQGNKALNEVRIHPTQKPVNLYL
FT                   WLLQTYAKEGDKILDTHVGSASSLIACGELGFDYVGCEIDKSIFNLAQQRLDAYEKQLK
FT                   LF"
FT   gene            47211..47429
FT                   /locus_tag="SP670_0058"
FT   CDS_pept        47211..47429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90140"
FT                   /protein_id="ADM90140.1"
FT                   /translation="MLNLYFVYNGHCKFYLGTFYNVDDLIEQMEDHQWSFSAITHPRFQ
FT                   KHIGQRTTRFDYGSKDCYYLATFSGGE"
FT   gene            47429..47734
FT                   /locus_tag="SP670_0059"
FT   CDS_pept        47429..47734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90141"
FT                   /protein_id="ADM90141.1"
FT                   /translation="MAKNILMDLAFENLHKCMGISDWKESDEVILVSSANKEQIESDES
FT                   YHSAGKCNYLGKRICIFCEQVKRNNYITLHKSMLEKIIKTMESFTDAEQMKGEEND"
FT   gene            47825..47992
FT                   /locus_tag="SP670_0060"
FT   CDS_pept        47825..47992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90142"
FT                   /protein_id="ADM90142.1"
FT                   /translation="MVGVTYQEIHLFVEFLKKQYGQGRPDYIEALNDLDGLVEVSYREA
FT                   IERFLEDEVR"
FT   gene            48160..48477
FT                   /locus_tag="SP670_0061"
FT   CDS_pept        48160..48477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0061"
FT                   /product="gp24"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90143"
FT                   /protein_id="ADM90143.1"
FT                   /translation="MMEELKQKVNEVYNWTVEDGKPQPPKQDLPQVVKDRADYFWEMAE
FT                   DGMTFMGAMECIFADEKPTDYDLGATKDWLPKSKEFDDWVGYSPSMAQVVIAVYLIYRG
FT                   N"
FT   gene            48479..49153
FT                   /locus_tag="SP670_0062"
FT   CDS_pept        48479..49153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90144"
FT                   /protein_id="ADM90144.1"
FT                   /translation="MNKQELIKKLEERRTITGNFQGYVVWWKDVKEIFEQLAESEIGHA
FT                   DEAPRYVKNILARLRELPLHDREVWLKAIMSEFEQDFSHAKWREGYEQGKIEGMVEREK
FT                   VIVPRFVAEWIEEARKACKDVVELFEFDFTNDEVRKWFMQERPFDLVARAWLDGYEVEE
FT                   EKRYLVTLKNRQPLVKSQSGSTLYFSQDITARNYKGTQKELEDANFGWVFDCEGIEIEE
FT                   VE"
FT   gene            49153..49440
FT                   /locus_tag="SP670_0063"
FT   CDS_pept        49153..49440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90145"
FT                   /protein_id="ADM90145.1"
FT                   /translation="MTQTLEEGMKNQSKCIKIPMEIRPFDVGYRIVNKHGQALALKNGA
FT                   SIFALPSLAEKAIKKEFGKNDPDFDIEKHFVEEVAIVNLSKFHSYFEGVE"
FT   gene            49625..49963
FT                   /locus_tag="SP670_0064"
FT   CDS_pept        49625..49963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90146"
FT                   /protein_id="ADM90146.1"
FT                   /translation="MSYDLEILVKIESGDYICIAEPKYSSPTYNLGRMFRVAMNWDFDQ
FT                   DTTYNIADVLDNIQRGISELERYPEKYVQYEPENRWGTVSVALEVLKSLKECILEQDID
FT                   TKYLYMRW"
FT   gene            50058..50225
FT                   /locus_tag="SP670_0065"
FT   CDS_pept        50058..50225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0065"
FT                   /product="gp27"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90147"
FT                   /protein_id="ADM90147.1"
FT                   /translation="MVVYKADNAGAEIFGRVVEKGRHGKLYTVTIRDYGIFVVTKEQFE
FT                   KIRVGDEVLL"
FT   gene            50225..50683
FT                   /locus_tag="SP670_0066"
FT   CDS_pept        50225..50683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90148"
FT                   /protein_id="ADM90148.1"
FT                   /translation="MDDILQALAKMLNMTVDEVSSLLTTFKGNAPQIYEMFVKEKMFYD
FT                   LFSLFQIMSIVIFSISAVVLAVLTLIYFTYDGGFVYSYDIRTGKTEEEIKLERIERKRK
FT                   DLKIPLKISCISSSASLITLVIAIVLKATLAPNYIFIVNEILPKLTKR"
FT   gene            50692..51075
FT                   /locus_tag="SP670_0067"
FT   CDS_pept        50692..51075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90149"
FT                   /protein_id="ADM90149.1"
FT                   /translation="MNTIEKVKQWFIDRDLENGRVVGLMVLSSKRRIYKMKRLGIIIGA
FT                   VFVIVVSPFVVQYGWNEIITTIVPVGKITVWQALGMDALLSFIWPVLSSKKESEEDYSY
FT                   AVKSSISKIITCAFLIWLASLFI"
FT   gene            51087..51494
FT                   /locus_tag="SP670_0068"
FT   CDS_pept        51087..51494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90150"
FT                   /protein_id="ADM90150.1"
FT                   /translation="MIPKFRGLSIDEKSKGEWQYGHLIEDRGRAFIINEVVEANEQYIT
FT                   IGSWCPVNPATLGQSTGLRDKNGKEVFIGDIVKCTRGCLHEVYLEKEYGGTFIGGMPSI
FT                   YLKGLLSGYAWTEDEEIIGNVYENPELLEDK"
FT   gene            51494..51730
FT                   /locus_tag="SP670_0069"
FT   CDS_pept        51494..51730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0069"
FT                   /product="gp29"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90151"
FT                   /protein_id="ADM90151.1"
FT                   /translation="MNPEIIDNINKPSHYQGANGLEAIDVVHNFVGNLFGASAFFWGNA
FT                   IKYMLRFQKKNGLEDLKKARKNLDWLIEEMEHE"
FT   gene            51892..52122
FT                   /locus_tag="SP670_0070"
FT   CDS_pept        51892..52122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0070"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90152"
FT                   /protein_id="ADM90152.1"
FT                   /translation="MNDKLNPRQASRFAFLLKQKRKERKLSQEKLAAKLGYSRYLIAQW
FT                   EKEESVPDIYNVEDICTYFAFPADIILGSRA"
FT   gene            52195..52623
FT                   /locus_tag="SP670_0071"
FT   CDS_pept        52195..52623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0071"
FT                   /product="gp31"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90153"
FT                   /protein_id="ADM90153.1"
FT                   /translation="MQIELLDIIDEKKTRKEAIKVLKKYSRLRRIAGEEYAPKITISYS
FT                   LEPRSSSGQTSKQVESMVVRRVSAQQDLELIAKAINNLSDMGYTRILIERYCRKKRRED
FT                   YSIYSELGYSSSEYYRILNKALLEFAESYQASNLLVYK"
FT   gene            52620..52739
FT                   /locus_tag="SP670_0072"
FT   CDS_pept        52620..52739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90154"
FT                   /protein_id="ADM90154.1"
FT                   /translation="MISGKILGKIWENLGRIGAEKGAKIVLSNDWATYSHEDS"
FT   gene            52913..53479
FT                   /locus_tag="SP670_0073"
FT   CDS_pept        52913..53479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0073"
FT                   /product="gp32"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90155"
FT                   /protein_id="ADM90155.1"
FT                   /translation="MKKVEPIRDLDDIERIKDYLKNKSDRNYVLFMFGIYSGLRVSDIV
FT                   PLQVKQVIADRIELKEKKTGKIRYFPISPPLRKEINRYIKDNQLAEYDYLFPSKKKKRT
FT                   DGVRITHIGRVAVYQILQDAAKYVGLNHIGTHSMRKTFGYHHYKKNSNVAILQKIFNHS
FT                   TPDITLGYIGYSQDELDQSILSFDY"
FT   gene            54196..55659
FT                   /locus_tag="SP670_0074"
FT   CDS_pept        54196..55659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0074"
FT                   /product="gp34"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90156"
FT                   /protein_id="ADM90156.1"
FT                   /translation="MTLKGMGYLRKKLANYKMGVDTRYNQYAMQHNEIDVGITIPPQIR
FT                   QQYRAVLGWAAKGVDSLADRLVFREFANDEFGANEIFAQNNPDVFFDSAILSALIGSCC
FT                   FVYISQGDDDDAPRLQVIEASNATGVLDPITGLLTEGYAVLKRDDNGYAVLEAYFTSDV
FT                   TWFYPKDGKPFAIGNPTGVPLLVPVIHRPDAVRPFGRSRITRAGMYYQRYAKRTLERSD
FT                   VTAEFYSFPQKYVLGLSQDAEAIDTWKATVSSLLTFTKDDEGDKPNVGQFTTSSMSPFT
FT                   EQLRTAAAGFAGEMGLTLDDLGFVSDNPSSVEAIKASHENLRLAGRKAQRSLGSGLLNV
FT                   AYVATCLRDKFPYLRKQFNKTVVKWEPLFEADANMLTLIGDGVIKLNQAVPGYMDAETI
FT                   RDLTGIKGDMNATPKIEEVEQKSTNSEDKQKNRIISTYEITSLLSNYQKGVLSKENGIL
FT                   LLTSTGMSKQEAEAMINKTELIVKEAADG"
FT   gene            55652..57043
FT                   /locus_tag="SP670_0075"
FT   CDS_pept        55652..57043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0075"
FT                   /product="gp35"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90157"
FT                   /protein_id="ADM90157.1"
FT                   /translation="MVEDIVPSLLKKIKSEFEGARLDSEVLKDLLSKLQHSKASYLDAN
FT                   QYAIEIGEILSKALGASLTNETLPDGKMYYNIAQRVLTDVLGRNYELVSDYTEQVQKNL
FT                   NSEAKIGLTAQVPELNQDRIDGLVNRLASEESFDDVRWLLEEPVVNFTQSIIDDSIQKN
FT                   AEFQHKSGLQPEIVRKSAYHCCEWCQEVQGTYKYPRVPKDIYRRHQRCRCTVDYDPKSG
FT                   KVQNVWSKAWSKSDKSDKIEARKNIGIQSEVSQVRKLALQIGITSNPITKSLKKLTEEE
FT                   IIQAISGGDKTKGSCSSLAFAYIGNKAGYTVLDFRGGKSCVFFGSIDKINMIGSLPGVK
FT                   MHVAKNTNDFKAVKELLEKAENGKEYYLATGRHAAIIRKNDNLVEYLELQSKFVNGFKP
FT                   FDDTVLKKRFKAKKSHAVRGHKYDVDSYLIDANSLKDNPEFHNILSFLNTAESKQMKGI
FT                   TGYEK"
FT   gene            57033..57272
FT                   /locus_tag="SP670_0076"
FT   CDS_pept        57033..57272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90158"
FT                   /protein_id="ADM90158.1"
FT                   /translation="MKSDYEEVNWSEYCYKENDDDKTWWVDTSWYAKGLMLITFDKKKF
FT                   YNLFEDYPQNMTSEEIEIFDKENPFWEDFFSDRK"
FT   gene            57325..57555
FT                   /locus_tag="SP670_0077"
FT   CDS_pept        57325..57555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90159"
FT                   /protein_id="ADM90159.1"
FT                   /translation="MGNTIYFLEKKSSLERGASVKEILEENLEASHDYTSVLVVSLDKD
FT                   GEINLGYSWDSSLQALGMLDVAKNYILNVIN"
FT   gene            57606..59018
FT                   /locus_tag="SP670_0078"
FT   CDS_pept        57606..59018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0078"
FT                   /product="phage terminase, large subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90160"
FT                   /protein_id="ADM90160.1"
FT                   /translation="MARKKLGNQNPTQSVILKYVKKNSKAKEAIEIYERTGLSCYAWQI
FT                   NLLTSIMAVDKDGLWVHQKFGYSIPRRNGKSELLYLFELWGLHNGLNILHTAHRISTSH
FT                   SSFEKVKRYLEKMGYVDGEHFSSIRAKGQERIELFDGGGIVQFRTRTSNGGLGEGFDLL
FT                   VIDEAQEYTTEQESALKYTVTDSSNPITIMCGTPPTPVSNGTVFTNYRKTCLFGKGKYS
FT                   GWAEWSVSEEKEIDDVEAWYNSNPSMGYHLNERKIEAELGDDKLDHNVQRLGYWPEYNQ
FT                   KSAISETEWNELCVDSMPDLSGKLFVGVKYGQDGANVALSIAVRTVDERIFVETIDCQS
FT                   VRNGNDWILDFVKRADVATIVVDGASGQKILDEELKKERMKSVILPTVKEIIVANSMWE
FT                   QGIYQKTLCHAGQPSLKKITTNCEKRNIGSNGGFGYRSHFADMDISLMDSALLAHWACM
FT                   TTKPKKKQKISY"
FT   gene            59101..59565
FT                   /locus_tag="SP670_0079"
FT   CDS_pept        59101..59565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0079"
FT                   /product="gp39"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90161"
FT                   /protein_id="ADM90161.1"
FT                   /translation="MSEFKTIETQEELDNIVKERLRREREKFGDYDDLKKRVSELESEN
FT                   GALKATVEETKQTIAKSDAQITELQGQVSNYETASLRTRIALQNGLPYDLADRLQGADE
FT                   EALRADAERLAGFMRPATPQAPLRDTEPAIGDDKTMQMKQMLRDLQPKGE"
FT   gene            59572..60468
FT                   /locus_tag="SP670_0080"
FT   CDS_pept        59572..60468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0080"
FT                   /product="phage structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90162"
FT                   /protein_id="ADM90162.1"
FT                   /translation="MADNATKAGTLFKPELVKELISKVQGRSVLAKLSSQTPIPFNGVE
FT                   QFIFNLEGNAQIVGEGEQKQAGKAKITSKVIKPLKFVYQARITDEFKYASEEKQMNFLS
FT                   AYMDGFAKKIAEAFDLAALHGLEPKTMTDASFRTTNSFDGLITGNIVNYTEEHIDDNID
FT                   AAVQTIVAKGGEVTGIALSPTAGQALAKVKVNGVVQYPEFRFGQNPDSFYGMKSDINKN
FT                   LTVTGGTAETDHAIVGDFQNRFKWGYAENIPMEIIEYGDPDGAGRDLKAYNEICLRAEA
FT                   FIGWGILDEDAFARVKA"
FT   gene            60474..60686
FT                   /locus_tag="SP670_0081"
FT   CDS_pept        60474..60686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0081"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90163"
FT                   /protein_id="ADM90163.1"
FT                   /translation="MALYRDTKTGVIISAESVLGGDWVPVEDTAPSGADLTVAELKSSL
FT                   DELGVDYDKGSKKSDLVALYEENKS"
FT   gene            60690..61130
FT                   /locus_tag="SP670_0082"
FT   CDS_pept        60690..61130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0082"
FT                   /product="gp42"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90164"
FT                   /protein_id="ADM90164.1"
FT                   /translation="MGTFAKIEDLELLWRSLKFDERARAEALLEVVSNSLRVEAEKVGK
FT                   DLDDMVAESVSFASVAKSVTVDIVARTLMTSTDHEPMTQVSESALGYSFSGSYLVPGGG
FT                   LFIKDTELKRLGLKKKQRYGAIEIYDLPKRNPCHFNRQGGNW"
FT   gene            61117..61413
FT                   /locus_tag="SP670_0083"
FT   CDS_pept        61117..61413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0083"
FT                   /product="gp43"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90165"
FT                   /protein_id="ADM90165.1"
FT                   /translation="METGNDDFGHPIHRDVEIEVQNVLVVPTSSEDVINQMNLTGKKAE
FT                   YTLGIPKGDTNKWENREVKFFGRKWRTIGIPQEGIESMIPLSWNRKVMVEVYE"
FT   gene            61415..61642
FT                   /locus_tag="SP670_0084"
FT   CDS_pept        61415..61642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0084"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90166"
FT                   /protein_id="ADM90166.1"
FT                   /translation="MKFQLNSAGVSALLRSSEMQGILREKGQGIAERAGEGFELTVSPG
FT                   QKRANAKISTTDIKSMARNKKHNILLKAMR"
FT   gene            61639..61974
FT                   /locus_tag="SP670_0085"
FT   CDS_pept        61639..61974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0085"
FT                   /product="gp45"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90167"
FT                   /protein_id="ADM90167.1"
FT                   /translation="MIELVIKKFLDGQLDVPSFFEHKPNMPESYVILEKTGSGGSDYVH
FT                   SATFAFQSYAPSLQKAAELNEKVKKVVEDLITVNEVSGVHHNSDYNFTDTETKQYRYQA
FT                   VYDINYF"
FT   gene            61990..62598
FT                   /locus_tag="SP670_0086"
FT   CDS_pept        61990..62598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0086"
FT                   /product="major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90168"
FT                   /protein_id="ADM90168.1"
FT                   /translation="MTTEARRQNTESTGGKNMTTASASNVTAAKPKIGGAVSTAPAGTT
FT                   LPTNAKTDLDAAFETLGYISDDGLTNANSPESKAIKAWGGQTVLSSQTEKKDTFKYKLI
FT                   EGLNIKVLKEVYGPDNVSGTLETGITVKANGKELPEHCLVIDTLLKNGYVKRVVIPRGK
FT                   VSEIGEISYKDGEPIGYELTITALPDNSENTHYEYIQGA"
FT   gene            62604..62879
FT                   /locus_tag="SP670_0087"
FT   CDS_pept        62604..62879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0087"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90169"
FT                   /protein_id="ADM90169.1"
FT                   /translation="MEEILKGKTESGFEYKIPKKRLRNFYLMREASKMEKGDFEAAEKL
FT                   LNLLFGKKQAEEFLSHLDDGDDFIDTEVLFADIKSIFESNKDLKKS"
FT   gene            62891..63277
FT                   /locus_tag="SP670_0088"
FT   CDS_pept        62891..63277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0088"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90170"
FT                   /protein_id="ADM90170.1"
FT                   /translation="MIALDEDALICDLAETYQIYDYKQLPLNQVAVFAYGLRDDSRIKQ
FT                   MMSDQIVPLETTLLASIVDRLSLSLWLKTKDGQKGVNRPASIAELLTKNNKEEGDERDY
FT                   LVFESGEDFENYRKALLAKTGGED"
FT   gene            63277..65742
FT                   /locus_tag="SP670_0089"
FT   CDS_pept        63277..65742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0089"
FT                   /product="PblA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90171"
FT                   /protein_id="ADM90171.1"
FT                   /translation="MATELGKAYVQIIPSAKGISGMIQKEMGGEVASAGVSAGESLGSK
FT                   MMGAVSGVIAAAGIGKAIGASINEGAALQQSLGGVETLFKDSADKVKGFANEAYKTTGL
FT                   SANAYMENVTGFSASLLQSLGGDTDKAAETANMAMIDMSDNANKMGTSMESIQLAYQGF
FT                   AKQNYTMLDNLKLGYGGTKQEMQRLLADAEKLTGVKYDINNLSDVYSAIHTIQENLDIT
FT                   GTTAREAATTFTGSFESMKSAAQNVLGKLSLGEDIQPALQALMETTSTFLFGNLIPMIG
FT                   NILKQIPILILGGIKGVFSGIFGEGLGSIMGSIVTALGSAFLAFKAFSTVSGLLSGIPA
FT                   VLTTIKTAVTGLFTVMSANPIGIAIAAIAGLTAGLVYFFTQTETGRQIWSSFVAWIKQA
FT                   WQGIADFFVNLWSGISEGASTLWDGVVTAWNAVVTFFSDLWVRIQEAASVAWTAITTAV
FT                   MAIVQPFIDGFMNIWNNISDGLTQIWEGIKMIFQGVWEFIKSIFLGAILIIINLVTGNF
FT                   NQLGADLSLIWKGIKNSISMIWEGIKTYFSGVVDVIVGYGIAIFENFSTTLSTIWKGLS
FT                   AAGKAIFDSFAQILSNIWNTIKSVASSAWEGLKSTVLGLIDGLVQGAKNAWESMKQGVR
FT                   DLVSNVTSIFDGIRNIDLWSAGKAILDGFLGGLKSAWGAVTDFVGGIASWIRDHKGPIE
FT                   YDRKLLIPAGNAIMQGLDRGLQDRFKDVKKSVSGMAGEISNAFSNDDFGLSGTPTIAKN
FT                   IEASLAMPSAQIEAKDSQTVSEIAILRASMEKILTAILEKPSDTYLDADKISMSVYQRQ
FT                   GAIYAREGM"
FT   gene            65742..66440
FT                   /locus_tag="SP670_0090"
FT   CDS_pept        65742..66440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90172"
FT                   /protein_id="ADM90172.1"
FT                   /translation="MFYMIINGFNTSTIPHCVVTDFGQVEAAKPRVAEDANLYGANGSY
FT                   RVLDGGYESYERTFSFYIPKLLDVSTIVEKFQPKDNVLEFSYQLGSVFYADFIGATYSP
FT                   HGMHAWKLEIKLNMQPFRYQKNVAPLIFTASGNINNPGSVYSEPVIEIEGDGDISLTIG
FT                   RTTMHLTVRRKVTIDCRHKKQNIYNADGAVQNTLRKRGGFFELAVGNNSLVFTGSVRKV
FT                   TVRPNWRYIL"
FT   gene            66437..74536
FT                   /locus_tag="SP670_0091"
FT   CDS_pept        66437..74536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0091"
FT                   /product="PblB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90173"
FT                   /protein_id="ADM90173.1"
FT                   /translation="MIYLTEGNTPLNEAYNDEIVHLGNNTYQLTFRFPTSDTKWELLKE
FT                   ETFLTADDLHGEQDFYIFEVEKQQGYIQVYANQVISLLNNYIVSSIEVDRVSGTRVLSA
FT                   FAGSITRANPFSFFSDIDDRHTLNIKDKNAMEVLAKGKHSILGQWGGDMVRNGYNLRLL
FT                   KNGGSENESLFMYKKNLSSYQHKTSTKSLKTRITFKTTVKGEGENAVDHDYMVVIDSPL
FT                   LGNYSQIYEDVVEVNDQDVTDEASLIEYGKQYFRTSMCDMLEDNLEISVVGQSDVAVQM
FT                   FDVVSFYHEWYGLDVRKKITKYTYSPMAKLLKSIGFGTFQSSLANAIGGIVNDAVLNES
FT                   RNLHQIFEERLKKEIANADRAFDAEFFKREKTITDAIELAKAKAEEVKQELSDTINQRF
FT                   NSFDNGPLKETKRKAEEALRNAGASTLLAQEAKRIGLDSVARLEAFKSQTTSAQTALSG
FT                   DLDALKRTIANDIRPKQAQAEAEIAKQAEALSRTKNELAGASTLLAQEAKRIELDSVAR
FT                   LEAFKSQTTSAQTALSGDLDVLKQTIANDIRPKQAQAEAEIAKQVEALSRTKNELAGVK
FT                   SAQATYKETTTRRLSELTNLANGKASKSELTQTAKELASRIASVQASGRNLFLNSLFKQ
FT                   DISKTGIWTTSTYTATIDSESKYLGYNALKIIGLNPSGRDGGNPKVTYPALGQFGKVIP
FT                   GSTTNQDVTISFYAKANKNGIMLRSRLGNIGYKTGNVTLSTEIKRYVVHIPKGWTNESK
FT                   QTTNEWLFNFNQEGTIWIWMPKFEISDVDTSYSEAPEDIEGQISTVESTFKQRANSLEA
FT                   GVSRLTEGLRTKADISSLNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGSIRQE
FT                   ILNATKDKASKSELTQTAEELSSKIASVQVGGRNYIRGTKRMMLARGLWASGTFRPSGA
FT                   GTAKTIDVSDSPVTGFDKAIRLTSSNARDQIGIAQDGFYISQGTYTMSCWVKGRRGQKV
FT                   KLQTYWQVNDNSGISPIFTLKDENWTKLSFTSARNRAGVASIGYVYLVNAEVGEYLDVL
FT                   APQLEDGSLATSSKEAPEDIEGQISTVESTFKQRANSLDAGVRSLTEGLRTKVDISALN
FT                   VTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGSIRQEILNATKDKASKSELTQTAE
FT                   ELASRIASVQASGRNLFLNSLFKQDISKTGIWTTSTYTATIDSESKYLGHKALKIIGLN
FT                   PSGRDGGNPKVTYPALGQFGKVIPGSTTNQDVTISFYAKANKNGIMLRSRLGNIGYKTG
FT                   NVTLSTEIKRYVVHIPKGWTNESKQTTNEWLFNFNQEGTVWIWMPKFEISDVDTSYSEA
FT                   PEDIEGQISTVESTFKQRANSLDAGVRSLTEGLRTKVDISSLNVTAENIRQSVKRLETD
FT                   TQNKLNQKLSQAEFEVRAGSIRQEILNATKDKASKSELTQTAEELSSKIASVQVGGINL
FT                   LRNTASLLIGDRSKGCWMSASGGNGRAISVEVLDPPKKMIKNMIRVIENTNGGNKDLTQ
FT                   LVRLRIGEKYTISCYARIASDSPNANVNLLFRSWANNTDLNRKFQKSISHKNWQKYSFT
FT                   FTADAIENSIQFGQSGAGIIEICAPKIESGTLATDYSEAPEDIEGQISTVESTFKQRAN
FT                   SLDAGVSRLTEGLRTKVDISALNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGS
FT                   IRQEILNATKDKADKTLVVSEAGKLREEFSKMKVGGRNLWIKSKTVGAVIEKLPENHVT
FT                   GQKECYRLENNSTLTFNLEPDFSSRLYQKVTFSAWIKYENVVQGRNFWNVFNCFKHYLF
FT                   RKNSETGVQSGPDYATLGMYKGSADWKYITFTYDYSEKTNFDQLKTSLRFNLEGATSGT
FT                   AWVTGIKVEIGSVATDWSPAPEDADGLITEAKATFERTAQGLRTDLSAIQEYVNKDGQR
FT                   QEALQRYTREESTRQATAVRELVNRDFVGKATYQEDVKGINQRIEAVKTSANKDIASQI
FT                   ASYRQSVDGKFTDISSQITTYKQDVGGQISGLSNRLTSSEQGTTTQISNISNRINSNKQ
FT                   GTDNQISNLKTQVATNKDNAERQMGRISDQVSANKANADSQFANVTNQLARKVETTDFQ
FT                   RVKETSKLYERILGNTENGIADKVARMALTNQLFQVEVGKYSVSGPNLIKNSDFKNATN
FT                   EWGSTQNLGRLVKHSFYHNGQKDLMRLSNATKNENFLYSHRFNLERNTDYVLNFRGFNN
FT                   SALASYDVYILGRRAGESDGFTIVKKVVSSKKLSTSRCEDVSVTFNSGEMDNAYIRFDN
FT                   NGSSSGTADLYITEVDLYKGYKPRTWQPHPEDVVADANKKLEATQTKMTLLTGSWAVQN
FT                   INSAGDIISGINLGANGHNRFVGKLTHITGETLIDRAVIKSAMVDKLKTGNFEAGSVTT
FT                   TILDAEAVTAEKLKVDNALIRKLTANDAFIDQLISKRIFSIKVESVISSSTFLEAYQGR
FT                   IGGFTLGQFDQGGGRWISGVNQFSVGMGNGAGHGVRTAFWANWGNNWNYAGPKAWNVNT
FT                   DGKMYCRNEVGFYDQVDFSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGG
FT                   RNAVVWWNQVGSGSVKYWMEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHE
FT                   EIGLIAQEAETIVPKIVSRDPENPDGYLHIDYTALVPYLIKAIQELNQKIEKMEKTIA"
FT   gene            74533..74649
FT                   /locus_tag="SP670_0092"
FT   CDS_pept        74533..74649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90174"
FT                   /protein_id="ADM90174.1"
FT                   /translation="MNNNMLTNIALKAIQELALENRKRTHRLENLENEHRTA"
FT   gene            74630..74833
FT                   /locus_tag="SP670_0093"
FT   CDS_pept        74630..74833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90175"
FT                   /protein_id="ADM90175.1"
FT                   /translation="MNTEQLNQALQMTISEMSTTSTNSMITSNILSIQLNEQREENQRL
FT                   QARVDELEALLDEQTKPADKGE"
FT   gene            74836..75186
FT                   /locus_tag="SP670_0094"
FT   CDS_pept        74836..75186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90176"
FT                   /protein_id="ADM90176.1"
FT                   /translation="MAETIQNTDNLLDLAKITEPFDLASALRYMKENGEFIRCKNVSDD
FT                   FYMYRDVQKRPVIVNGRRQLKDVETVWAFNQWGGTIATINVAVLLNHEFYIMKFDAEGN
FT                   PDWTDPTVKPKE"
FT   gene            75196..75612
FT                   /locus_tag="SP670_0095"
FT   CDS_pept        75196..75612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0095"
FT                   /product="putative holin 1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90177"
FT                   /protein_id="ADM90177.1"
FT                   /translation="MQIEFFNFLRSVVQTEDGLVLYALALIVSMEIIDFVTGTIAAIIN
FT                   PDIEYKSKIGINGLLRKISGVLLLMILIPASVLLPEKTGFVFLHSIYLGYIAFTFQSLI
FT                   ENYRKLKGNVTLFQPIVKVFQRLLEKDDDTKKGE"
FT   gene            75616..75951
FT                   /locus_tag="SP670_0096"
FT   CDS_pept        75616..75951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0096"
FT                   /product="phage holin, LL-H family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90178"
FT                   /protein_id="ADM90178.1"
FT                   /translation="MQQITEIITNGAISILVILAGVVVRAVKDYLVQKGGEKTIKIVEI
FT                   LAKNAVNAVEQVASETGFKGDEKLEQARAKVRAELTKYNISMTDKDLDTFVESAVKQMN
FT                   DAWKGQE"
FT   gene            75951..76907
FT                   /locus_tag="SP670_0097"
FT   CDS_pept        75951..76907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0097"
FT                   /product="autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90179"
FT                   /protein_id="ADM90179.1"
FT                   /translation="MDIDRNRLRTGLPQVGVQPYRQVHAHSTGNRNSTVQNEADYHYRK
FT                   DPELGFFSHVVGNGRVMQVGPVNNGSWDVGGGWNTESYAAVELIESHSTKEEFMTDYRL
FT                   YIELLRNLADEAGLPKTLDTGSLAGIKTHEYCTNNQPNNHSDHVDPYPYLAKWGISREQ
FT                   FKHDIENGLTIETGWQKNDTGYWYVHSDGSYPKDKFEKINGTWYYFDSSGYMLADRWRK
FT                   HTDGNWYWFDNSGEMATGWKKIAEKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSN
FT                   AFIQSADGTGWYYLKPDGTLADKPEFTVEPDGLITVK"
FT   gene            complement(77177..77356)
FT                   /locus_tag="SP670_0098"
FT   CDS_pept        complement(77177..77356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90180"
FT                   /protein_id="ADM90180.1"
FT                   /translation="MREVIQELLDSSMSTSAISQGAGVPWTTVSDLRKGKTSMDKMALL
FT                   TAEKLYEFATTDKQ"
FT   gene            77929..78396
FT                   /locus_tag="SP670_0099"
FT   CDS_pept        77929..78396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0099"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90181"
FT                   /protein_id="ADM90181.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGGAGSLYNILTDERLNHRVEVEIGILEDECAAIMQDFFRNRRKK"
FT   gene            78582..79025
FT                   /locus_tag="SP670_0100"
FT   CDS_pept        78582..79025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0100"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90182"
FT                   /protein_id="ADM90182.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
FT   gene            78985..79542
FT                   /locus_tag="SP670_0101"
FT   CDS_pept        78985..79542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0101"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90183"
FT                   /protein_id="ADM90183.1"
FT                   /translation="MAFELVDLDRQGTRMKIIFVRHGEPDYRELEERSYIGFGIDLAPL
FT                   SEMGRQQVQKLSKNPLLSSAEIIVSSAVTRALETASYVVCATGFPLRVEPLLHEWQVYK
FT                   TGIENFETARRLFLENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAHRML
FT                   MRQFVPNEKIDFCQVIECELEI"
FT   gene            79655..80917
FT                   /gene="radA"
FT                   /locus_tag="SP670_0102"
FT   CDS_pept        79655..80917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SP670_0102"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90184"
FT                   /protein_id="ADM90184.1"
FT                   /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFN
FT                   RVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERL
FT                   GDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAE
FT                   LMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFG
FT                   STNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPT
FT                   MFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVA
FT                   IASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPQNSLTGITL
FT                   PKEIQVIGVTTIQEVLKKVFA"
FT   gene            80990..81487
FT                   /locus_tag="SP670_0103"
FT   CDS_pept        80990..81487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0103"
FT                   /product="carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90185"
FT                   /protein_id="ADM90185.1"
FT                   /translation="MSYFEQFMQANQAYVALHGQLNLPLKPKTRVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFENEPFQE
FT                   YLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESPLIPDDVIISGAIYNVDTGSMTVV
FT                   EL"
FT   gene            81508..82323
FT                   /locus_tag="SP670_0104"
FT   CDS_pept        81508..82323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90186"
FT                   /protein_id="ADM90186.1"
FT                   /translation="MYEEKQYFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGVSIFLA
FT                   LFYMIPALYFLFRIGKKWELPKKVLILSLLGGMFLAGWLSSFANTYIHDLLGVLFPDSP
FT                   FLNAFESAIVAPLVEEPLKLLPLVFVLALIPVRKLKFLFLLGIASGLGFQMIEDIGYIR
FT                   TDLPEGFDFTISRILERIISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIFLGL
FT                   ALGTHFLFNSPFVELETELPLAIPVVTAIALYGFYHAYCFVEKHNELMT"
FT   gene            82468..83436
FT                   /locus_tag="SP670_0105"
FT   CDS_pept        82468..83436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0105"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90187"
FT                   /protein_id="ADM90187.1"
FT                   /translation="MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQVN
FT                   IEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGKTCIL
FT                   IDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVLDTIYL
FT                   PEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            complement(83978..84211)
FT                   /locus_tag="SP670_0106"
FT   CDS_pept        complement(83978..84211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90188"
FT                   /protein_id="ADM90188.1"
FT                   /translation="MFSQLHMREEQVLLAQDYALETARAEDLEQGLERGKVEGRAERKL
FT                   FAFLDIVRQGLLTSEVASQQLGMSVSEFEALL"
FT   gene            complement(84535..84888)
FT                   /locus_tag="SP670_0107"
FT   CDS_pept        complement(84535..84888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90189"
FT                   /protein_id="ADM90189.1"
FT                   /translation="MILRHLGISPTNDLVAKKIFSNPEITCQFIRDMLDLPAKNVTILE
FT                   GSNIHVLPSMPYSVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQ
FT                   NLEKIHQREGDTH"
FT   gene            85141..87774
FT                   /locus_tag="SP670_0108"
FT   CDS_pept        85141..87774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0108"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90190"
FT                   /protein_id="ADM90190.1"
FT                   /translation="MDKKKLLLIDGSSVAFRAFFALYQQLDRFKNAAGLHTNAIYGFQL
FT                   MLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMG
FT                   IRHYELAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTVVEISKKGVAEFE
FT                   AFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLLLEHGSLEGIYEN
FT                   IDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGKFYDEM
FT                   GFKQLKQALNVSSADVAKGLDFTIVDQISQDMLSEESIFHFELFGENYHTDNLVGFAWS
FT                   CGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDLQAPAFDIRLAKY
FT                   LLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHLACKLAVLVETEP
FT                   ILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIVVKKETLLEMQAENELVIEKLTQEI
FT                   YELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLERLAPIAPIVKKIL
FT                   DYRQIAKIQSTYVIGLQDWILADGKIHTRYMQDLTQTGRLSSVDPNLQNIPARLEQGRL
FT                   IRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIER
FT                   PDNVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYFERFPGIKNYMDE
FT                   VVREARDKSYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGSAADILKIAMIQL
FT                   DKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQLSVPLIADENEGA
FT                   TWYEAK"
FT   gene            87859..88296
FT                   /locus_tag="SP670_0109"
FT   CDS_pept        87859..88296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0109"
FT                   /product="CoA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90191"
FT                   /protein_id="ADM90191.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKTAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   gene            88337..88585
FT                   /locus_tag="SP670_0110"
FT   CDS_pept        88337..88585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0110"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90192"
FT                   /protein_id="ADM90192.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVADRTDEVSSKHRFEVVDRTDEVSS
FT                   KHRFEVVDRTDEVSSKHRFEVVDRTDEVSNIYTARRR"
FT   gene            complement(88614..89624)
FT                   /locus_tag="SP670_0111"
FT   CDS_pept        complement(88614..89624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90193"
FT                   /protein_id="ADM90193.1"
FT                   /translation="MSFLSKNGAGILVCLLISILSWYLGGFFPVIGAPVFAIFMGMLLH
FT                   PFLSSHKQLDAGLTFSSKKLLQYAVILLGFGLNISQVFAVGQSSLPVILSTISIALIVA
FT                   YLFQRFFALDTKLATLIGVGSSICGGSAIAATAPVIHAKEKEVAQAISVIFFFNVLAAL
FT                   IFPTLGTWLHLSNDGFALFAGTAVNDTSSVTATASAWDSLYQTNTLESATIVKLTRTLA
FT                   IIPITLFLSYWQSREQKNKQGLQLKKVFPLFILYFILASLLTTLLTSLGVSSSFFTPLK
FT                   QLSKFLIIMAMSAIGLKTNLVAMVKSSGKSIVLGAVCWIAIILTSLGMQTLIGIF"
FT   gene            89773..90942
FT                   /locus_tag="SP670_0112"
FT   CDS_pept        89773..90942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0112"
FT                   /product="putative aminotransferase A"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90194"
FT                   /protein_id="ADM90194.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQAISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEIFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQAIIINGLSKSHAMTGWRLGLIFAPAAFTAQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            90939..91709
FT                   /gene="recO"
FT                   /locus_tag="SP670_0113"
FT   CDS_pept        90939..91709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SP670_0113"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90195"
FT                   /protein_id="ADM90195.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGACLCPEHYHEDKRRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            91706..92698
FT                   /gene="plsX"
FT                   /locus_tag="SP670_0114"
FT   CDS_pept        91706..92698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SP670_0114"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90196"
FT                   /protein_id="ADM90196.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLVADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLNYSDVG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
FT   gene            92704..92937
FT                   /locus_tag="SP670_0115"
FT   CDS_pept        92704..92937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0115"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90197"
FT                   /protein_id="ADM90197.1"
FT                   /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK"
FT   gene            92980..93273
FT                   /locus_tag="SP670_0116"
FT   CDS_pept        92980..93273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0116"
FT                   /product="mobile genetic element"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90198"
FT                   /protein_id="ADM90198.1"
FT                   /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTLEDKAC
FT                   NHALSKERSKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            93476..93706
FT                   /locus_tag="SP670_0117"
FT   CDS_pept        93476..93706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0117"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90199"
FT                   /protein_id="ADM90199.1"
FT                   /translation="MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGVARGLQL
FT                   GIKTRTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            93709..93834
FT                   /locus_tag="SP670_0118"
FT   CDS_pept        93709..93834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0118"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90200"
FT                   /protein_id="ADM90200.1"
FT                   /translation="MDFKSFIIGLVVGIFGPYMDDLIRKKFLKSSEKKTEKSIKK"
FT   gene            complement(94281..94394)
FT                   /locus_tag="SP670_0119"
FT   CDS_pept        complement(94281..94394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0119"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90201"
FT                   /protein_id="ADM90201.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSHIYTARRR"
FT   gene            94421..96574
FT                   /locus_tag="SP670_0120"
FT   CDS_pept        94421..96574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0120"
FT                   /product="transport/processing ATP-binding protein ComA"
FT                   /EC_number="3.4.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90202"
FT                   /protein_id="ADM90202.1"
FT                   /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTT
FT                   MDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQD
FT                   KDSIHIADPDPGVKLTKLPRERFEEEWTGVTLFMAPSPDYKPYKEQKNGLLSFIPILVK
FT                   QRGLIANIVLATLLVTVINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYILQQIL
FT                   SYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALAS
FT                   TILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEAN
FT                   AVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAH
FT                   LLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRL
FT                   NEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLIVPQGSKVAFVG
FT                   ISGSGKTTLAKMMVNFYDPSQGEISLGGVNLNQIDKKALRQYINYLPQQPYVFNGTILE
FT                   NLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQRQRIALARA
FT                   LLTDAPVLILDEATSSLDILTEKRIVDNLMALDKTLIFIAHRLTIAERTEKVVVLDQGK
FT                   IVEEGKHADLLAQGGFYAHLVNS"
FT   gene            96587..97936
FT                   /locus_tag="SP670_0121"
FT   CDS_pept        96587..97936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0121"
FT                   /product="transport protein ComB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90203"
FT                   /protein_id="ADM90203.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLISQTEAKIRDYQTAKSAMETGASLASQNLAYSLYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSATQQAYASGLSSQLESLKSQHLAKV
FT                   GQELTLLAQKILEAESGKKVQGNLLDKGKITASEDGVLHLNPETSDSSMVAEGALLAQL
FT                   YPSLEREGKAKLTAYLSSKDVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            98106..98813
FT                   /gene="purC"
FT                   /locus_tag="SP670_0122"
FT   CDS_pept        98106..98813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SP670_0122"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90204"
FT                   /protein_id="ADM90204.1"
FT                   /translation="MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGK
FT                   GVLNNQISSFIFEKLNAAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRF
FT                   GVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKV
FT                   WFTEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHMDKDVFRRGLGELTD
FT                   VYEIVWEKLQELK"
FT   gene            99015..102740
FT                   /locus_tag="SP670_0123"
FT   CDS_pept        99015..102740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0123"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90205"
FT                   /protein_id="ADM90205.1"
FT                   /translation="MDKRIFVEKKADFQVKSESLVRELQHNLGLSSLKSIRIVQVYDVF
FT                   DLAEDLFAPAEKHIFSEQGTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQEAL
FT                   LLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFSESD
FT                   KTIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYW
FT                   SDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGKTGRDGVGG
FT                   ATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDAFVAECNKENIDAV
FT                   VVATVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKLPEERQTSAETL
FT                   ESDTLTVLSDLNHASQKGLQTVFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGVT
FT                   HTASVIAQGFNPYVAEWSPYHGAAYAVIEATARLVAAGANWSKARFSYQEYFERMDKQA
FT                   ERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADSRKVLS
FT                   PEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEASQADHKVTSASAVKYGGVVESLA
FT                   LATFGNYIGAEVTLPELKTALTAQLGGFVFTSPEEIAGVEKIGQTKADFTLTVNGVKLD
FT                   GHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTNS
FT                   EYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPDG
FT                   SAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEDANSTSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDNG
FT                   QIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPGN
FT                   KDQHLFASAVKHFTGK"
FT   gene            102833..104275
FT                   /gene="purF"
FT                   /locus_tag="SP670_0124"
FT   CDS_pept        102833..104275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SP670_0124"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90206"
FT                   /protein_id="ADM90206.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPANLDKLTGAGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEQRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWIRDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAICSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSLTYLSIDSLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            104312..105334
FT                   /gene="purM"
FT                   /locus_tag="SP670_0125"
FT   CDS_pept        104312..105334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SP670_0125"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90207"
FT                   /protein_id="ADM90207.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLASSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKA
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            105331..105876
FT                   /gene="purN"
FT                   /locus_tag="SP670_0126"
FT   CDS_pept        105331..105876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SP670_0126"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90208"
FT                   /protein_id="ADM90208.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKTDYEAALVELLEEHQIDLVCLAGYIKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGQVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            105960..106469
FT                   /locus_tag="SP670_0127"
FT   CDS_pept        105960..106469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0127"
FT                   /product="teicoplanin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90209"
FT                   /protein_id="ADM90209.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEMLFNLIFFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLIGV"
FT   gene            106494..108041
FT                   /gene="purH"
FT                   /locus_tag="SP670_0128"
FT   CDS_pept        106494..108041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SP670_0128"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90210"
FT                   /protein_id="ADM90210.1"
FT                   /translation="MTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVALDNAGVD
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNLYP
FT                   FKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDELAANGET
FT                   SYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQPMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDSPTVVALKHMNPCGI
FT                   GQADDIETAWDYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPSYTDEALA
FT                   ILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQVVTKRQPT
FT                   ETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAKDRLNGAV
FT                   LASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGVRHFRH"
FT   gene            108163..109425
FT                   /gene="purD"
FT                   /locus_tag="SP670_0129"
FT   CDS_pept        108163..109425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SP670_0129"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90211"
FT                   /protein_id="ADM90211.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVSTAAYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGMIKEGRPYLGVLYAGLILTADGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNITDILDSKEPNIMWTDKGVTLGVVVASKGYPL
FT                   DYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LYQQKIEGLFYRTDIGSKAIK"
FT   gene            109682..109798
FT                   /locus_tag="SP670_0130"
FT   CDS_pept        109682..109798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90212"
FT                   /protein_id="ADM90212.1"
FT                   /translation="MKERLDDNPIVQGNWKTLGFQFRHETPLVAAAVPHKLR"
FT   gene            109852..110316
FT                   /gene="purE"
FT                   /locus_tag="SP670_0131"
FT   CDS_pept        109852..110316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SP670_0131"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90213"
FT                   /protein_id="ADM90213.1"
FT                   /translation="MGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPDLMFKHAEEA
FT                   RSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGVDSLYSIVQMPGGVPVA
FT                   TMAIGEAGATNAALFALRLLSVEDKSIADALANFAEEQGKIAEESSNELI"
FT   gene            110303..111394
FT                   /gene="purK"
FT                   /locus_tag="SP670_0132"
FT   CDS_pept        110303..111394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SP670_0132"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90214"
FT                   /protein_id="ADM90214.1"
FT                   /translation="MSSSKTIGIIGGGQLGQMMAISAIYMGHKVIALDPAADCPASRVA
FT                   EIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKTATGGYDGHGQKVIRSEVDLEA
FT                   AYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNNILSKTIVPARISE
FT                   SLVDKAKAMAVRIAEQLNLSGTLCVEMFATDDDVIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEQYVTENSSAHLHMYGKIEAKHNRK
FT                   MGHVTLFSDVPDSVDELGEGIDF"
FT   gene            111404..111631
FT                   /locus_tag="SP670_0133"
FT   CDS_pept        111404..111631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90215"
FT                   /protein_id="ADM90215.1"
FT                   /translation="MIQIIVNTFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPEN
FT                   YLAIYDVPLDTDLNTLDHYPSVFIEKEEFE"
FT   gene            111694..112992
FT                   /gene="purB"
FT                   /locus_tag="SP670_0134"
FT   CDS_pept        111694..112992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SP670_0134"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90216"
FT                   /protein_id="ADM90216.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
FT   gene            complement(113047..116985)
FT                   /locus_tag="SP670_0135"
FT   CDS_pept        complement(113047..116985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0135"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90217"
FT                   /protein_id="ADM90217.1"
FT                   /translation="MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQ
FT                   PTIHTVSDSPQSSENRTEETPKAVLQPEAPKTVETETPATDKVASLPKTEEKPQEEVSS
FT                   TPSDKAEVVTPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKA
FT                   EADKPETEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLL
FT                   VGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYA
FT                   KDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKAL
FT                   IDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYAN
FT                   DLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKG
FT                   HQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAW
FT                   ADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQTLNEVPKDLNRYTAESVAAVKE
FT                   AEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEALKEEEAKREVEKLAKNKVI
FT                   SIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYASDDV
FT                   KKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKL
FT                   GIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATS
FT                   AQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISY
FT                   WSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQ
FT                   LASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREE
FT                   LAKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHS
FT                   GSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISV
FT                   LTENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPF
FT                   TTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVE
FT                   VGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVTEKKLPET
FT                   GTHDSAGLVVAGLMSTLAAYGLTKRKED"
FT   gene            complement(117301..118044)
FT                   /locus_tag="SP670_0136"
FT   CDS_pept        complement(117301..118044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0136"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90218"
FT                   /protein_id="ADM90218.1"
FT                   /translation="MEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTEAELIS
FT                   MYDVSSITVVRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDDKVTVL
FT                   SIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPNLEYYS
FT                   SIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKLESTGQ
FT                   VLEYSETYKRSDYYKIKFISCDRDH"
FT   gene            118364..120151
FT                   /locus_tag="SP670_0137"
FT   CDS_pept        118364..120151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0137"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90219"
FT                   /protein_id="ADM90219.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPREGEFHFDGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRNPKELADAVREVLEQGSINLYMFHGGT
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNGQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            120148..120624
FT                   /locus_tag="SP670_0138"
FT   CDS_pept        120148..120624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0138"
FT                   /product="phosphotransferase system sugar-specific eiib
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90220"
FT                   /protein_id="ADM90220.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            120652..121557
FT                   /locus_tag="SP670_0139"
FT   CDS_pept        120652..121557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0139"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90221"
FT                   /protein_id="ADM90221.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            121544..122359
FT                   /locus_tag="SP670_0140"
FT   CDS_pept        121544..122359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0140"
FT                   /product="PTS system, IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90222"
FT                   /protein_id="ADM90222.1"
FT                   /translation="MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGL
FT                   MGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYK
FT                   EGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQ
FT                   IFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            122432..122770
FT                   /locus_tag="SP670_0141"
FT   CDS_pept        122432..122770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0141"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90223"
FT                   /protein_id="ADM90223.1"
FT                   /translation="MIMGLQDNIYTVALLPEDGPEEFTAKFEAVIEGLDDFLVFADLLG
FT                   GTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLTGADADYKSRAAESIVKVNDLLA
FT                   GFDDDEDE"
FT   gene            123066..124232
FT                   /locus_tag="SP670_0142"
FT   CDS_pept        123066..124232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0142"
FT                   /product="putative tagatose-6-phosphate ketose/aldose
FT                   isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90224"
FT                   /protein_id="ADM90224.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATVLVSFARSGNSPESVATVDLAKSLVDELYQVTITCAADGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTTLLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINENT
FT                   VVLVFGTRTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
FT   gene            124348..125385
FT                   /locus_tag="SP670_0143"
FT   CDS_pept        124348..125385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0143"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90225"
FT                   /protein_id="ADM90225.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYK
FT                   VTTDQDTLVNPTNHSYFNMSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHVYNGTLLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            125593..126447
FT                   /locus_tag="SP670_0144"
FT   CDS_pept        125593..126447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0144"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90226"
FT                   /protein_id="ADM90226.1"
FT                   /translation="MTYEYKSHIYLAETALNVKDLASQTAFYQQVIGLEILSQTETESI
FT                   LGLGGKVLVQLIQAQESGEVREYYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEAIYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEALAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSSQFYQKVLGLENKFSVPGASWIAAGDYHHHLAVNEWGGKG
FT                   LASRKQGLPGLAYYVIEVAHKKELLTIAQRAQEVDAPIKWMTSIQLEITDSDGIVTRIR
FT                   LAR"
FT   gene            126632..126841
FT                   /locus_tag="SP670_0145"
FT   CDS_pept        126632..126841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90227"
FT                   /protein_id="ADM90227.1"
FT                   /translation="MCGIQKMIEGDRDCADIVTQLTAVKSSVERVIEMIITENLTECIN
FT                   QPLDDSEAQKERLEKAIRYLIKRK"
FT   gene            complement(126883..127245)
FT                   /locus_tag="SP670_0146"
FT   CDS_pept        complement(126883..127245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0146"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90228"
FT                   /protein_id="ADM90228.1"
FT                   /translation="MKIKVQTRKLAAGCSKHCFKVVDGTDEVSSKHCFEVVDRTDEVSN
FT                   HIYGKVKLTWFEEIFEEYKSLHNKTHITKVLMNCTPKVRQKKSNFWGSVHSTPDTMRFF
FT                   NFKDFLQLLLTHIKLF"
FT   gene            complement(127299..127595)
FT                   /locus_tag="SP670_0147"
FT   CDS_pept        complement(127299..127595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0147"
FT                   /product="conserved hypothetical protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90229"
FT                   /protein_id="ADM90229.1"
FT                   /translation="METSISMADFYGKYQNENLELIDVREAHEFQAGHAPGAKNLPLST
FT                   LEQGYKELKPDHEYYVICQGGVRSASTCQFLSSQGLTVTNVEGGMNAWPGQVE"
FT   gene            complement(127585..127704)
FT                   /locus_tag="SP670_0148"
FT   CDS_pept        complement(127585..127704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0148"
FT                   /product="coenzyme A disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90230"
FT                   /protein_id="ADM90230.1"
FT                   /translation="MRSYIAEPILKQAGFTAQNLDGAYSLYKMVNPEGVEYGN"
FT   gene            127816..128580
FT                   /locus_tag="SP670_0149"
FT   CDS_pept        127816..128580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0149"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90231"
FT                   /protein_id="ADM90231.1"
FT                   /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEID
FT                   RYAREVGADCVGEFVSATKTYPVYVINYKGEEVCLAQAPVGSAPAAQFMDWLIGYGVEQ
FT                   IISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPCRYMEMQPEAIAAIEEVLEDRG
FT                   IPYEEVMTWTTDGFYRETAEKVAYRKEEGCAVVEMECSALAAVAQLRGVLWGELLFTAD
FT                   SLADLDQYDSRDWGSEAFNKALELSLASVHHL"
FT   gene            complement(128820..128972)
FT                   /locus_tag="SP670_0150"
FT   CDS_pept        complement(128820..128972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0150"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90232"
FT                   /protein_id="ADM90232.1"
FT                   /translation="MRTKASLRKLVTGCSKHCFEVVDRTDEVSSKHCFEVADRTDEVSN
FT                   IYTAR"
FT   gene            129190..130569
FT                   /locus_tag="SP670_0151"
FT   CDS_pept        129190..130569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0151"
FT                   /product="Trk transporter membrane-spanning protein-K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90233"
FT                   /protein_id="ADM90233.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIAPRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLIFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            130583..131248
FT                   /locus_tag="SP670_0152"
FT   CDS_pept        130583..131248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0152"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90234"
FT                   /protein_id="ADM90234.1"
FT                   /translation="MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEPV
FT                   LARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTVIAKVKSQ
FT                   TAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIPQSWAGQS
FT                   LSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDTLVALNS"
FT   gene            131383..131541
FT                   /locus_tag="SP670_0153"
FT   CDS_pept        131383..131541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0153"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90235"
FT                   /protein_id="ADM90235.1"
FT                   /translation="MKIKDQTRKLAAGCSKHCFEVVDRTDEVSSKHCFEVADRTDEVSN
FT                   IYTARRR"
FT   gene            131603..132142
FT                   /locus_tag="SP670_0154"
FT   CDS_pept        131603..132142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0154"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90236"
FT                   /protein_id="ADM90236.1"
FT                   /translation="MKLLSIAIPSYNAAAYLHYCVESLVIGGEQVGILIINDGSQDQTQ
FT                   EIAECLASKYPNIVRAIYQENKCHGGAVNRGLAEASGRYFKVVDSDDWVDPRAYLKILE
FT                   TLQELESKGQEVDVFVTNFVYEKEGQSRKKSMSYDSVLPVRQIFGWDQVGNFSKGQYTM
FT                   MHSLIYRTDLLRASQF"
FT   gene            132209..132619
FT                   /locus_tag="SP670_0155"
FT   CDS_pept        132209..132619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0155"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90237"
FT                   /protein_id="ADM90237.1"
FT                   /translation="MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLVDQLDL
FT                   SQVSHPKMREYLLNHIEITTVISSTLLNRSGTTEHLAKKRQLWTYIQQKNPEVFQAIRK
FT                   TMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN"
FT   gene            132735..134852
FT                   /locus_tag="SP670_0156"
FT   CDS_pept        132735..134852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0156"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90238"
FT                   /protein_id="ADM90238.1"
FT                   /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVV
FT                   NPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNS
FT                   SSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSI
FT                   DVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPAL
FT                   PPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTN
FT                   LVATKNVDININGLVAKETVEKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYE
FT                   LFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVALDGNVAGKE
FT                   KQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVQKAVA
FT                   DNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKVSDKAPWSDNG
FT                   DAKNPALSPLGENVKTKGQYFYQLALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGN
FT                   KDGKPDLDNIVATKKVTIKINVKETSDTANGSLSPSNSGSGVTPMNHNHATGTTDSMPA
FT                   DTMTSSTNTMAGENMAASANKMSDTMMSEDKAMLPNTGETQTSMASIGFLGLALAGLLG
FT                   GLGLKNKKEEN"
FT   gene            135019..135717
FT                   /locus_tag="SP670_0157"
FT   CDS_pept        135019..135717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0157"
FT                   /product="response regulator SaeR"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90239"
FT                   /protein_id="ADM90239.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            135714..136766
FT                   /locus_tag="SP670_0158"
FT   CDS_pept        135714..136766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0158"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90240"
FT                   /protein_id="ADM90240.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKGQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            136961..137572
FT                   /gene="rpsD"
FT                   /locus_tag="SP670_0159"
FT   CDS_pept        136961..137572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SP670_0159"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90241"
FT                   /protein_id="ADM90241.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            137758..137916
FT                   /locus_tag="SP670_0160"
FT   CDS_pept        137758..137916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0160"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90242"
FT                   /protein_id="ADM90242.1"
FT                   /translation="MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKT
FT                   GELNHQV"
FT   gene            138285..138635
FT                   /locus_tag="SP670_0161"
FT   CDS_pept        138285..138635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90243"
FT                   /protein_id="ADM90243.1"
FT                   /translation="MTGVSNPTTDSAPLVLAEAKKAFADDSLTEQGLRDILQTVKDAIA
FT                   SLESIKESQSATKDGGQTAGKETADKDVLENSQEELQKAVLFLADEKGSEHTAAELIDN
FT                   LKEVIAKLKANA"
FT   gene            138954..139883
FT                   /locus_tag="SP670_0162"
FT   CDS_pept        138954..139883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0162"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90244"
FT                   /protein_id="ADM90244.1"
FT                   /translation="MKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFGNVVAFKDYHM
FT                   TSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLVVSVGIAIILS
FT                   ELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLGLKEVNFYADL
FT                   GIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRIRNVTIPQLTP
FT                   LVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQTADIGMAAAAG
FT                   LYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            139897..140820
FT                   /locus_tag="SP670_0163"
FT   CDS_pept        139897..140820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0163"
FT                   /product="protein LplC"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90245"
FT                   /protein_id="ADM90245.1"
FT                   /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFV
FT                   IIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFI
FT                   TTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLL
FT                   SPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFW
FT                   NDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVA
FT                   TLPIAILYPFFQRYFVKGLTIGGVKE"
FT   gene            141078..142553
FT                   /locus_tag="SP670_0164"
FT   CDS_pept        141078..142553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0164"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90246"
FT                   /protein_id="ADM90246.1"
FT                   /translation="MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKM
FT                   YQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFAD
FT                   NYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFA
FT                   FNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGL
FT                   PFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVR
FT                   EETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILN
FT                   LLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINEN
FT                   VTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKA
FT                   IPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            142825..143811
FT                   /locus_tag="SP670_0165"
FT   CDS_pept        142825..143811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0165"
FT                   /product="Rhodanese-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90247"
FT                   /protein_id="ADM90247.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEDLWFKIDEESEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            144144..144947
FT                   /locus_tag="SP670_0166"
FT   CDS_pept        144144..144947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90248"
FT                   /protein_id="ADM90248.1"
FT                   /translation="MNAKSILALLDGLESHSYDVVYLRQPLNRLEYIECAIVGQSQFLF
FT                   KVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGTDIEGLDGFDFEAYFQASIQ
FT                   AYLADAVARFTICQGIFNPIFFSRENLKSFLEADGLAQFEARVRAVQETDAYFARVSFY
FT                   QDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEVQWEIDLVQITGDGSKPEDY
FT                   ESIARLDYAKFLEVLPPSFYHQLDANQIEIQPILGQDFKTLAQEK"
FT   gene            complement(145019..146083)
FT                   /locus_tag="SP670_0167"
FT   CDS_pept        complement(145019..146083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90249"
FT                   /protein_id="ADM90249.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADLDTPIGKN
FT                   TQVEEEVSQAEVELESQQEEKIETPEVGEARTEIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQDPKSRDKWKEQVLDFWSWLVEAIKSPT
FT                   SKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSI
FT                   ISILVATTLFFFSFLLGSFVVRRFIHQEKYWTLDKVLQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGDYLRILAFL"
FT   gene            complement(146146..147057)
FT                   /locus_tag="SP670_0168"
FT   CDS_pept        complement(146146..147057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90250"
FT                   /protein_id="ADM90250.1"
FT                   /translation="MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPVYD
FT                   SRTEKLTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSLSAHHDLITNQNDRTLSL
FT                   TDKKLSETPFLSSGIGGILHIASSYSSRFEEVILQLPKGRTLKGINISANRGQTTIINA
FT                   SLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTENHFHAENIQVH
FT                   GKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYKTEKTD
FT                   VKDQLIARSDDNIDLISTPSRR"
FT   gene            complement(147050..147643)
FT                   /locus_tag="SP670_0169"
FT   CDS_pept        complement(147050..147643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90251"
FT                   /protein_id="ADM90251.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYVTRFFGLLIVRLVQFVLKKGKRGNQHA"
FT   gene            complement(147630..147956)
FT                   /locus_tag="SP670_0170"
FT   CDS_pept        complement(147630..147956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0170"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90252"
FT                   /protein_id="ADM90252.1"
FT                   /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWTLYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(148095..149261)
FT                   /locus_tag="SP670_0171"
FT   CDS_pept        complement(148095..149261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0171"
FT                   /product="cyanate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90253"
FT                   /protein_id="ADM90253.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVV
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPAVAALLLIDILMTVALFTVDRADKIL"
FT   gene            149319..150479
FT                   /locus_tag="SP670_0172"
FT   CDS_pept        149319..150479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0172"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90254"
FT                   /protein_id="ADM90254.1"
FT                   /translation="MSSKVSGFQDKNGKVLKIMIEWWKEKFRRVVVTQNVESLLVSIVI
FT                   SAYNEEKYLPGLIEDLKNQTYPKENIEILFINAMSTDGTTAIIQQFIKEDTEFNSIRLY
FT                   NNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTESFVMNNVAIIQQGEFVCGGPRPTIV
FT                   EGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSSIFHGMYKREVFQKVGLVNEQLGR
FT                   TEDNDIHYRIREHGYKIRYSPSILSYQYIRPTFKKMLHQKYSNGLWIGLTSHVQFKCLS
FT                   LFHYVPCLFVLSLVFSLALLPITFVFITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPF
FT                   LLFSIHFAYGLGTIVGLIRGFKWKKEYKRTIIYLDKISQINQNMLQ"
FT   gene            150518..152368
FT                   /locus_tag="SP670_0173"
FT   CDS_pept        150518..152368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0173"
FT                   /product="CapD protein, required for the biosynthesis of
FT                   type 1 capsular polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90255"
FT                   /protein_id="ADM90255.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVAKAVDEAKVSKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
FT   gene            complement(152393..152515)
FT                   /locus_tag="SP670_0174"
FT   CDS_pept        complement(152393..152515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0174"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90256"
FT                   /protein_id="ADM90256.1"
FT                   /translation="MDRTDEVSNHTYGKATLTWFEEIFEEYKSLHNKTHITKVV"
FT   gene            complement(152673..153305)
FT                   /locus_tag="SP670_0175"
FT   CDS_pept        complement(152673..153305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0175"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90257"
FT                   /protein_id="ADM90257.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYI
FT                   TTTKDTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLAPEQAIIIGDT
FT                   KFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
FT   gene            complement(153327..154199)
FT                   /gene="sdaAA"
FT                   /locus_tag="SP670_0176"
FT   CDS_pept        complement(153327..154199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAA"
FT                   /locus_tag="SP670_0176"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90258"
FT                   /protein_id="ADM90258.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIKNEKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(154208..154879)
FT                   /gene="sdaAB"
FT                   /locus_tag="SP670_0177"
FT   CDS_pept        complement(154208..154879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAB"
FT                   /locus_tag="SP670_0177"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90259"
FT                   /protein_id="ADM90259.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            155121..155708
FT                   /locus_tag="SP670_0178"
FT   CDS_pept        155121..155708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0178"
FT                   /product="LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90260"
FT                   /protein_id="ADM90260.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYS
FT                   AENQERVADAYVAGRYGSWTAAKNFWLNNGWY"
FT   gene            complement(155760..156080)
FT                   /locus_tag="SP670_0179"
FT   CDS_pept        complement(155760..156080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90261"
FT                   /protein_id="ADM90261.1"
FT                   /translation="MQRLEVYKNYQRLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            156850..158958
FT                   /locus_tag="SP670_0180"
FT   CDS_pept        156850..158958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0180"
FT                   /product="ABC transporter membrane-spanning permease-amino
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90262"
FT                   /protein_id="ADM90262.1"
FT                   /translation="MKKISNFCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLY
FT                   LKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFT
FT                   TDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKD
FT                   RIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEM
FT                   KRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHF
FT                   LLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTALLIGVGR
FT                   SLEQENKELAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFYQDLVEKT
FT                   QAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPNTGIKKVILMP
FT                   ASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENL
FT                   SNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSS
FT                   IQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKL
FT                   VDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLGLASRMEKRSLV
FT                   ELLKGGIL"
FT   gene            158955..159596
FT                   /locus_tag="SP670_0181"
FT   CDS_pept        158955..159596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0181"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90263"
FT                   /protein_id="ADM90263.1"
FT                   /translation="MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK"
FT   gene            159803..160609
FT                   /locus_tag="SP670_0182"
FT   CDS_pept        159803..160609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0182"
FT                   /product="ABC transporter solute-binding protein-amino acid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90264"
FT                   /protein_id="ADM90264.1"
FT                   /translation="MNKMKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALN
FT                   PDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLA
FT                   ISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETM
FT                   AKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQ
FT                   DDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
FT   gene            160626..161045
FT                   /locus_tag="SP670_0183"
FT   CDS_pept        160626..161045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0183"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90265"
FT                   /protein_id="ADM90265.1"
FT                   /translation="MSKEKVILAYSGGLDTSVAITWLKKDYDVVSVCMDVGEGKDLDFI
FT                   HDKALKVGAVESYVIDVKDEFATDYVLVAHQSHAYYEQKYPLVSALSRPLISKKLVEIA
FT                   HQIGATTIAHGCTGKGNDQVEYQIAVAKKANEAKK"
FT   gene            complement(161334..161882)
FT                   /locus_tag="SP670_0184"
FT   CDS_pept        complement(161334..161882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0184"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90266"
FT                   /protein_id="ADM90266.1"
FT                   /translation="MQHLSRAMSRVRVQIMNQFHRKSHEYKAIKRYWKLIQQDSRKLSD
FT                   KRFYRPTFRMHLTNKEILNKLLSYSQDLKHHYQLYQLLLFHFQNKEPEKFFELIEDNLK
FT                   QVHPIFQTVFKTFLKDKEKIINALQLHYSNAKLEATNNLIKLIKRNAFGFRNFENFKKR
FT                   IFIALNIKKERTKFVLSRA"
FT   gene            complement(162142..162660)
FT                   /locus_tag="SP670_0185"
FT   CDS_pept        complement(162142..162660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0185"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90267"
FT                   /protein_id="ADM90267.1"
FT                   /translation="MEQLHFITKLLDIKDPNIQILDIINKDTHKEIIAKLDYEAPSCPE
FT                   CGSQMKKYYFQKPSKIPYLETTGMPTRILLRKRRFKCYHCSKIMVAETSIVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLSISTSTVIRKLNDFHFECNFRNLPKIMSWDVETVRG
FT                   VTVSIGRWR"
FT   gene            complement(162824..163144)
FT                   /locus_tag="SP670_0186"
FT   CDS_pept        complement(162824..163144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90268"
FT                   /protein_id="ADM90268.1"
FT                   /translation="MQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICRDDAKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            163901..164281
FT                   /locus_tag="SP670_0187"
FT   CDS_pept        163901..164281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90269"
FT                   /protein_id="ADM90269.1"
FT                   /translation="MELVLPNNYVVIDEEEMMYLDGGGVGCNWWNSRGSFATVLDVGLA
FT                   IYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALNVALTVTGFS
FT                   LGGAIAYGADWADGSLDGYIFA"
FT   gene            complement(164698..165546)
FT                   /locus_tag="SP670_0188"
FT   CDS_pept        complement(164698..165546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0188"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90270"
FT                   /protein_id="ADM90270.1"
FT                   /translation="MRYDFGKVYKEIRESKGLTQEEVCGGVLSRTSLSKIESGKTTPKY
FT                   ENMEFLLRQINMSFEEFEYICQLYQPSQRTEIMQTYLNMRSIIGTSDLVNLFQKCQDYL
FT                   KTHHDLPIEEIRDMLEVVIYIRQHGAGELSDHAEQVVKKLWRKIEKQDTWYESDLKILN
FT                   TILFSFPIEYLHLITGKILQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQIC
FT                   YTLLEDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVETH
FT                   Y"
FT   gene            166012..166350
FT                   /locus_tag="SP670_0189"
FT   CDS_pept        166012..166350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0189"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90271"
FT                   /protein_id="ADM90271.1"
FT                   /translation="MLKKYPCTIQHDQSDCAAAVVSTVLLSYKKELSIMKIREIIGTDM
FT                   YGTTVSGIVSGLNKLNFTVKAVRVALEDLTPKLTFPAILQVKNDLGQNHFVVLHSIKEK
FT                   IKGTRITK"
FT   gene            166444..166821
FT                   /locus_tag="SP670_0190"
FT   CDS_pept        166444..166821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90272"
FT                   /protein_id="ADM90272.1"
FT                   /translation="MSPGTFIALTGAAVLTKKLINYIKVGGLGGWLIGAAAGVLALIFL
FT                   IKICVDTTIKVLLNRIFKASKVMKRRIFSLFVLDLMVYIFLGYVLVIQKDVYLFSILII
FT                   FSNFSVPFIREKEYELFKNKK"
FT   gene            166975..167187
FT                   /locus_tag="SP670_0191"
FT   CDS_pept        166975..167187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90273"
FT                   /protein_id="ADM90273.1"
FT                   /translation="MMIVLISVIVAFLYHKITEYVNNRKIDIVIFLSLLISHFIWNYYF
FT                   LPIEILIAISGANLLLSFLKKLQTK"
FT   gene            167919..168977
FT                   /locus_tag="SP670_0192"
FT   CDS_pept        167919..168977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90274"
FT                   /protein_id="ADM90274.1"
FT                   /translation="MKDDQKYLLAGLYSLLVAIFYFPLIESKGIFVSILMAVLLLYLIY
FT                   FIATVIHIVIIKFIRKKSFKYLVLYPFTYDGSWRFQPINLLYFPEMVRDVIPINLVQEY
FT                   CQGQPYGLLKKMLKRIRLSREISLLLATIIVYFFTHRILPLSVFTFIFSYILLFVQSYL
FT                   GSNTAWIGNRRLIIDDEFEKILLSKSYIKEISSARYSEYLTCEYKNLTPIILIAIFENL
FT                   LDSYLLQNQSEVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYDNEALR
FT                   DLSKQYLNKNISELQDGSFEGGIQDAVASKQIVVINEFIACLNSRCVPSQYDRFFYKDR
FT                   PYIFSRKSPIKG"
FT   gene            169292..170269
FT                   /locus_tag="SP670_0193"
FT   CDS_pept        169292..170269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90275"
FT                   /protein_id="ADM90275.1"
FT                   /translation="MKNKRYFFDTILIILLLISTIFCVSPVFIKLDILGTPSHAILTFV
FT                   LAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFHFIFVIIIGARKYYRILFHQLMGFSPG
FT                   IAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKPLLLPLIPFSIIIALVQKLY
FT                   RIENQQLFLLKSKVLTILESKRDCEFNLQDYHEIWKLQSKSELPCVALSYISLIKPYLS
FT                   ESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKNKYESMLNKILEVRPD
FT                   FVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVYMGIKHVSIRR"
FT   gene            170646..171020
FT                   /locus_tag="SP670_0194"
FT   CDS_pept        170646..171020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90276"
FT                   /protein_id="ADM90276.1"
FT                   /translation="MELVLPNNYVALEQEEMMYLDGGFSILRWPVATAINIAFNGVLGG
FT                   GAISLVRNYIRNYGLRRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGDAI
FT                   TTIWANNDVNRRDPNLNALW"
FT   gene            171027..171209
FT                   /locus_tag="SP670_0195"
FT   CDS_pept        171027..171209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90277"
FT                   /protein_id="ADM90277.1"
FT                   /translation="MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVF
FT                   LILIIAMMIYPKLRK"
FT   gene            171228..172130
FT                   /locus_tag="SP670_0196"
FT   CDS_pept        171228..172130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90278"
FT                   /protein_id="ADM90278.1"
FT                   /translation="MIRKLIVFLLMLPLFVLWLELHVLVNNLLLNLESPLDFVISMSLA
FT                   FCSLILSKIVLDILYALKDLYKKEALITIFPFIFIGRKKVNVRFSPYFSFHRKSLSPDD
FT                   LRSRIIWSFILEIAIILVFILKIPFAIIMLTTIFFWTIMDINHLVFNKTEFLFNQNKWE
FT                   KEDSFESDLTKTLKDKIQKSELSYSDLMSLQLYDAMNQSTFLTDSELFEDILKKIEDSH
FT                   NTLLCTGLVELLMYEMSISNNNNWSNKVDKIRIHLIRINQLDFFYYTSWLRQNFDFCMN
FT                   REYHKMKSRKLLLSNKKIV"
FT   gene            172186..172518
FT                   /locus_tag="SP670_0197"
FT   CDS_pept        172186..172518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90279"
FT                   /protein_id="ADM90279.1"
FT                   /translation="MELVLPNNYVVIDEEEMMYLDGGAYLSKRACQGICVALAMSSGTF
FT                   IALAGAAVLTKKLINYIKVGGLGGWLIGAAAGKIAYCIGYGVLNRGCDINGNPYPWDGF
FT                   ISATVR"
FT   gene            172515..173243
FT                   /locus_tag="SP670_0198"
FT   CDS_pept        172515..173243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90280"
FT                   /protein_id="ADM90280.1"
FT                   /translation="MSNVDKIRKIHIIVCWVYIFLSFRAIINDTEYFLLIFLAFIYSIV
FT                   SLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFILELAIFHLIR
FT                   KDFDIKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVDNHVLTLIFLI
FT                   KICVDTTIKFLFIRLFDTSTLMKRRIFFLFALDVIVYLFLGYLLVIQKAGYLFSVLLLF
FT                   SNFSVPFIKEKEFELFKNSK"
FT   gene            174483..174665
FT                   /locus_tag="SP670_0199"
FT   CDS_pept        174483..174665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90281"
FT                   /protein_id="ADM90281.1"
FT                   /translation="MTDLHHLFGLHKITRDYASQTKPAIQAGVFILEDFRNILLYNDVI
FT                   ERISLCEFIGDIFYI"
FT   gene            175165..177090
FT                   /locus_tag="SP670_0200"
FT   CDS_pept        175165..177090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0200"
FT                   /product="surface protein PspA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90282"
FT                   /protein_id="ADM90282.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVASQPTVVRAEEAPVASQSKAEKD
FT                   YDAAKRDAENAKKALEEAKRAQKKYEDDQKKTEEKAKEEKQASEAEQKANLKYQLLLQK
FT                   YVSESDGKKKKEIEKQADAAKKENEIKKAELNKIRQEIVVPSSQQLEVTRRKAEVAKAK
FT                   EPGLRKRVEEAEKKVTEAKQKLDAERAKEVALQAKIAELENEVYRLETELKGIDESDSE
FT                   DYVKEGLRAPLQSELDAKRTKLSTLEELSDKIDELDAEIAKLEKNVEYFKKTDAEQTEQ
FT                   YLAAAEKDLADKKAELEKTEADLKKAVNEPEKPAEETPAPAPKPEQPAEQPKPAPAPQP
FT                   APAPKPEKTDDQQAEEDYARRSEEEYNRLPQQQPPKAEKPAPAPKPEQPVPAPKPEQPV
FT                   PAPKTGWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNGAMATGWLQYNGSWYYLNA
FT                   NGAMATGWAKVNGSWYYLNANGAMATGWLQYNDSWYYLNASGAMATGWAKVNGSWYYLN
FT                   ANGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWAKVNGSWYYL
FT                   NANGSMATGWVKDGDTWYYLEASGAMKASQWFKVSDKWYYVNGLGALAVNTTVDGYEVN
FT                   ANGEWV"
FT   gene            177343..177468
FT                   /locus_tag="SP670_0201"
FT   CDS_pept        177343..177468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90283"
FT                   /protein_id="ADM90283.1"
FT                   /translation="MTISFKKQFLSSSLSSLTKRVIMNTAQATFNREAHTTFNRE"
FT   gene            177491..178612
FT                   /gene="trmU"
FT                   /locus_tag="SP670_0202"
FT   CDS_pept        177491..178612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SP670_0202"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90284"
FT                   /protein_id="ADM90284.1"
FT                   /translation="MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD
FT                   ENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCN
FT                   KEIKFKAFLDYAMTLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQ
FT                   LQKTMFPLGHLEKPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRM
FT                   MTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHD
FT                   SLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAI
FT                   TPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            178753..179208
FT                   /locus_tag="SP670_0203"
FT   CDS_pept        178753..179208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0203"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90285"
FT                   /protein_id="ADM90285.1"
FT                   /translation="MTQQDFRTKVDNTVFGVRATALILQNRKLLVTKDKGKYYIIGGAI
FT                   QVNEKTEDAVVREVKEELGVKSQAGQLAFVVENRFEVDGVSYHNIEFHYLVDLLEDAPL
FT                   TMQEDEKRQPCEWIDLDKLEDIQLVPAFLKTALPDWEGQLRHIHLEE"
FT   gene            179218..181131
FT                   /gene="gidA"
FT                   /locus_tag="SP670_0204"
FT   CDS_pept        179218..181131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SP670_0204"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90286"
FT                   /protein_id="ADM90286.1"
FT                   /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEAPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   gene            complement(181326..183005)
FT                   /locus_tag="SP670_0205"
FT   CDS_pept        complement(181326..183005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0205"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90287"
FT                   /protein_id="ADM90287.1"
FT                   /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQGEIIIVDAGIKFPE
FT                   DDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALAL
FT                   IRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIVCT
FT                   GDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQG
FT                   IEGRIIFASFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFI
FT                   EPNEIKDYPAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTT
FT                   SVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLCLIKPKYFMPVHGEYRMQKV
FT                   HAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKD
FT                   RRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIAL
FT                   KNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(183007..183240)
FT                   /locus_tag="SP670_0206"
FT   CDS_pept        complement(183007..183240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0206"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90288"
FT                   /protein_id="ADM90288.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRALYLDIDTSSELEGRITARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
FT   gene            complement(184058..184210)
FT                   /locus_tag="SP670_0207"
FT   CDS_pept        complement(184058..184210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0207"
FT                   /product="bacteriocin-type signal sequence domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90289"
FT                   /protein_id="ADM90289.1"
FT                   /translation="MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(184212..184397)
FT                   /locus_tag="SP670_0208"
FT   CDS_pept        complement(184212..184397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90290"
FT                   /protein_id="ADM90290.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKVIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            184576..185259
FT                   /locus_tag="SP670_0209"
FT   CDS_pept        184576..185259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0209"
FT                   /product="glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90291"
FT                   /protein_id="ADM90291.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAYTLNIELVGMSSLLALVPYQQ
FT                   EGLFVPLMDARRNNVYAGFYENAKPVMAEAHLSFEEVLEKVKGTSQVTFVGEVGPFVEQ
FT                   IQKHLPRTDYKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGES
FT                   YIKRL"
FT   gene            185256..185693
FT                   /gene="rimI"
FT                   /locus_tag="SP670_0210"
FT   CDS_pept        185256..185693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="SP670_0210"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90292"
FT                   /protein_id="ADM90292.1"
FT                   /translation="MIEIKRIQQQPDLAQAIYAVMAAVYLVSPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            185683..186693
FT                   /locus_tag="SP670_0211"
FT   CDS_pept        185683..186693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0211"
FT                   /product="O-sialoglycoprotein endopeptidase
FT                   (Glycoprotease)"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90293"
FT                   /protein_id="ADM90293.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKTFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   HHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEEYPVKTLVVAGGVAANKGLRER
FT                   LAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWDLNAKPSLAFDTME"
FT   gene            complement(186733..187119)
FT                   /locus_tag="SP670_0212"
FT   CDS_pept        complement(186733..187119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0212"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90294"
FT                   /protein_id="ADM90294.1"
FT                   /translation="MHLTHREVRDKLLSYSEGLQVYYELYQLLLFHFQEKNADHFFGLI
FT                   EQELPTVHPLFQTVFWTFLRDRDKIINALKLPYSNAKLEATNNLIKVIKRKAFGFRNFN
FT                   NFKKRILMTLNIKKESTNFVLSRL"
FT   gene            complement(187110..188087)
FT                   /locus_tag="SP670_0213"
FT   CDS_pept        complement(187110..188087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0213"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90295"
FT                   /protein_id="ADM90295.1"
FT                   /translation="MTYNEKRLTNSLERVHMEQLKNTTDLLGLEDKNIKILSVLKYQTH
FT                   LVVQAKLDSPAPPCPHCQGKMIKYDFQKASKIPLLDCQGLPTVLHLKKRRFQCKNCLKV
FT                   VVSQTSIVKKNCQISNMVRQKIAQLLLEKQSMTEIAHRLAVSTSTVIRKLREFKFETDW
FT                   TKLPKVMSWDEYSFKKSKMSFIAQDFESKSILAILDGRTHAVIRNHFQRYQREVRELVE
FT                   VITMDMYSPYYRLAKQLFPKAKIVLDRFHIVQHLSRAMNRVRIQIMNQFDRKSLEYRAL
FT                   KRFWNPRFFVSRLGLNQSTGLIYYTRIASSSVRNDSISPRFECT"
FT   gene            complement(188746..188949)
FT                   /locus_tag="SP670_0214"
FT   CDS_pept        complement(188746..188949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0214"
FT                   /product="degenerative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90296"
FT                   /protein_id="ADM90296.1"
FT                   /translation="MGYSLKKSRTYCEQDPEKVNRFLKELNHLSYLTPIYIYETGVETY
FT                   FYLKYDRALSRQLVSLEEDIII"
FT   gene            189309..189863
FT                   /locus_tag="SP670_0215"
FT   CDS_pept        189309..189863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0215"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90297"
FT                   /protein_id="ADM90297.1"
FT                   /translation="MQYSCGKININIPDGYGDIKDIVFSAHIIVRYNNGHCGGIDPHII
FT                   GLCKKQIRRMSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKNILKLL
FT                   KIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDFWTYSM
FT                   GDAFICVSETMKKRLESIIKK"
FT   gene            190090..190452
FT                   /locus_tag="SP670_0216"
FT   CDS_pept        190090..190452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0216"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90298"
FT                   /protein_id="ADM90298.1"
FT                   /translation="MWAALKEKICHLKCRDNFRLLGEIYPATIVYQISDLLYIPSDTEG
FT                   IPMCVLESMSQGTPVLASNVGGLSEIIEHRVDGFLFEKEDVEGVCACANFLLNDSEYLK
FT                   YIGENSKSKIRKHESI"
FT   gene            190554..191429
FT                   /locus_tag="SP670_0217"
FT   CDS_pept        190554..191429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0217"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90299"
FT                   /protein_id="ADM90299.1"
FT                   /translation="MKSCLHQSYKNIEVIIIDDNYSNVNLRNKIIHQFGYTNHRIKLIL
FT                   SNEDLGATNARNIGIKNSRGKYISFLDDDDEYMPDRIFKLMACFKKSRMKNLALVYSYG
FT                   IIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTSFWLCKKEVLELINGFEKIDSHQDGVV
FT                   LLKLLAQGYQIDIVREFLVNYYAHSKENGITGVTQKTINADEEYYNYCRKYFNLLSFNE
FT                   RILVTKKYYSLNIKRLLLIGDKCKALKVIKKAREEKIFNEFLFLKYMLLYNFGFFYCIY
FT                   DNYVQLKFRK"
FT   gene            191439..193055
FT                   /locus_tag="SP670_0218"
FT   CDS_pept        191439..193055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0218"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90300"
FT                   /protein_id="ADM90300.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            193756..194505
FT                   /locus_tag="SP670_0219"
FT   CDS_pept        193756..194505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0219"
FT                   /product="GlcNAc-PI de-N-acetylase family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90301"
FT                   /protein_id="ADM90301.1"
FT                   /translation="MSNNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSGYP
FT                   LSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNGNF
FT                   LYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHIDHVFVNSIGRALEFMR
FT                   YKVIYYEDFPYVSDSSMVSYMGKTKELKMYQEELDEKHYIDRISSILCYKSQILIIWKS
FT                   VEKLLNNIKELYLRNGAAYSIRFWIKK"
FT   gene            194942..195559
FT                   /gene="ugd"
FT                   /locus_tag="SP670_0220"
FT   CDS_pept        194942..195559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="SP670_0220"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90302"
FT                   /protein_id="ADM90302.1"
FT                   /translation="MREGCSIYDNLYPSRIVVGDETVEGRKIAELFLSISTHSTANIKN
FT                   VMLVSPTEAEAIKLFSNTFLALRVAFFNELDSFAERRSLNAEVVIKGVCLDPRIGNFYN
FT                   NPSFGFGGYCLPKDTKQLKKEFIEINAPVIEAIDISNTNRKQFIVKQILERKPKIVGIY
FT                   KLGMKYNSDNYKESAILSIINELLIVGIKILVYEPNLNVSYR"
FT   gene            196076..196939
FT                   /locus_tag="SP670_0221"
FT   CDS_pept        196076..196939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0221"
FT                   /product="MutR"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90303"
FT                   /protein_id="ADM90303.1"
FT                   /translation="MIEKMELGEFYKELRLARKLKQTDVACEGLTASQLSKFELGQSML
FT                   SADKLILAIQGINVTFDEFGHKLNNYQESPHMRIGRKVVNRFAHQDIAALEQLLEEVDQ
FT                   EQMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYDIESWTWFELYLFCNTMP
FT                   FLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELE
FT                   RMLRPYDVFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLTSLFELRFQQ
FT                   YKELID"
FT   gene            197230..197427
FT                   /locus_tag="SP670_0222"
FT   CDS_pept        197230..197427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90304"
FT                   /protein_id="ADM90304.1"
FT                   /translation="MLNLQFAETMELTEAELETVYGGEFGNNAVIPAGAWGGLGTSWSI
FT                   TNFWKKYFNHDSSTVNRRHY"
FT   gene            197495..198160
FT                   /locus_tag="SP670_0223"
FT   CDS_pept        197495..198160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0223"
FT                   /product="caax amino protease family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90305"
FT                   /protein_id="ADM90305.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVAGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVAWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIAGPIFEDMIYRGLVMTALEKGKKWGLDVLGSA
FT                   VLFGVSHISNHGWVLTDFVFYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            198232..199458
FT                   /locus_tag="SP670_0224"
FT   CDS_pept        198232..199458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0224"
FT                   /product="transporter, major facilitator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90306"
FT                   /protein_id="ADM90306.1"
FT                   /translation="MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLTI
FT                   LLITISETLPQILQIFLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLV
FT                   AFICLLNLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVL
FT                   LGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTISYQEGLSVKSFCQHLLQSSKL
FT                   IWNMNKVLLVLFIISTSQAVINVTVPISTLFLRNQPFLNLQTGQSLALLSTFELSALIV
FT                   GSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQ
FT                   ELVFKQIPEESMGAVQSSIGAITVVLPSLFTIALVTIATSFGTLAVSFVLLLFLLVAFV
FT                   MLLNIRESI"
FT   gene            complement(199692..199931)
FT                   /locus_tag="SP670_0225"
FT   CDS_pept        complement(199692..199931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0225"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90307"
FT                   /protein_id="ADM90307.1"
FT                   /translation="MKIKEQTRKLAAGCSKHRFEVADRTDEVSSKHCFEVVDRTDEVSS
FT                   KHRFEVVDRTDEVSNHTYGKVKLTWFEESFEEYK"
FT   gene            200002..200658
FT                   /locus_tag="SP670_0226"
FT   CDS_pept        200002..200658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0226"
FT                   /product="branched-chain amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90308"
FT                   /protein_id="ADM90308.1"
FT                   /translation="MPTALGYVSIGLACGTIGAPYVTPVEMGLMSLFVYAGSAQFAMLA
FT                   LIVVQAPVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGE
FT                   LAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFGLDFALVGMFIGIFAS
FT                   QFQMMQRRIPVRNLLIILAVVAVSFFLLLTVVSQSLAVLFAMLLGCSMGVVLDGQ"
FT   gene            200648..200857
FT                   /locus_tag="SP670_0227"
FT   CDS_pept        200648..200857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0227"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90309"
FT                   /protein_id="ADM90309.1"
FT                   /translation="MVSKYLLLAVIFSGLVTWIPRMIPFILVKYKGLPTIVERFLKFLP
FT                   VSIIFALILSSVVTGKVGNLPPIK"
FT   gene            201075..201905
FT                   /locus_tag="SP670_0228"
FT   CDS_pept        201075..201905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0228"
FT                   /product="ABC transporter substrate-binding protein-amino
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90310"
FT                   /protein_id="ADM90310.1"
FT                   /translation="MKKIVKYSSLAALGLVAAGVLAACSGGAKKEGEAASKKEIIVATN
FT                   GSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   LSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            202059..202913
FT                   /locus_tag="SP670_0229"
FT   CDS_pept        202059..202913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0229"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90311"
FT                   /protein_id="ADM90311.1"
FT                   /translation="MKIKKWLGLAALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIGDTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEETSDGLDQ
FT                   PVW"
FT   gene            203013..204386
FT                   /locus_tag="SP670_0230"
FT   CDS_pept        203013..204386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0230"
FT                   /product="acetylornithine
FT                   deacetylase/succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90312"
FT                   /protein_id="ADM90312.1"
FT                   /translation="MVFPSEQEQIEKFEKDHVVQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            204379..205440
FT                   /locus_tag="SP670_0231"
FT   CDS_pept        204379..205440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0231"
FT                   /product="methionine import ATP-binding protein MetN"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90313"
FT                   /protein_id="ADM90313.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSGLSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   ANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSDPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLK
FT                   YAGSSTDEPLLNELYKHYQVTANILYGNIEILDGTPVGELVVVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGVQ"
FT   gene            205442..206134
FT                   /locus_tag="SP670_0232"
FT   CDS_pept        205442..206134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0232"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90314"
FT                   /protein_id="ADM90314.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIGPN
FT                   AALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            complement(206163..206732)
FT                   /locus_tag="SP670_0233"
FT   CDS_pept        complement(206163..206732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0233"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90315"
FT                   /protein_id="ADM90315.1"
FT                   /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALV
FT                   GGSVYMILVAKVPRFGAITTIGLVIAFFFLGTKHGAGSFLPGIICGLLADEVAHLGKYK
FT                   DKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLF
FT                   IASIVIGALVGALIGQALSKKFAQKI"
FT   gene            206867..207481
FT                   /locus_tag="SP670_0234"
FT   CDS_pept        206867..207481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90316"
FT                   /protein_id="ADM90316.1"
FT                   /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLAGGIILGLAPASATLMSL
FT                   YAEHGYSFREYSLKEAWSLYKQNFVSSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIVHL
FT                   IATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKILLGTVLL
FT                   VAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
FT   gene            207531..209129
FT                   /locus_tag="SP670_0235"
FT   CDS_pept        207531..209129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0235"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90317"
FT                   /protein_id="ADM90317.1"
FT                   /translation="MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRE
FT                   STQIAQALVENQARIEGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRNDF
FT                   VTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIYISL
FT                   DPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHIGETVDKESENWLVGLTSHGYQVQVAV
FT                   PKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVDSIQAIAQGQEGL
FT                   RIDTLEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNT
FT                   LEFLRMYAVMQSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPK
FT                   SIAYGFKIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVV
FT                   DNGRGMSAEKLANIREKLSQRYFEHQASYSDQRQSIGIVNVHERFVLYFGDRYAITIES
FT                   AEQAGVQYRITIQDE"
FT   gene            209141..210427
FT                   /locus_tag="SP670_0236"
FT   CDS_pept        209141..210427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0236"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90318"
FT                   /protein_id="ADM90318.1"
FT                   /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATAGHADEALEYVQ
FT                   ENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDYLV
FT                   KPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAGFVSYLGDKENWWIGLSKEKQGS
FT                   FTIPYYVLGQDWQIFISGQPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNLQQSE
FT                   SLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRVPITKQLFIQFVMDVFHLFEH
FT                   LKADDLTDIVKTIHAIQSFDELVPYIKETLTSFFGQYRMNENVVSVLEVIGRDYQKELS
FT                   LKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIEDICYAVGY
FT                   SNLGYFYKVFRKLCGKSPKAYRKQVETIL"
FT   gene            210479..211012
FT                   /locus_tag="SP670_0237"
FT   CDS_pept        210479..211012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90319"
FT                   /protein_id="ADM90319.1"
FT                   /translation="MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRAAQKQVAG
FT                   VNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVGYV
FT                   LLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKMWRQ
FT                   QKALAEEEETEELA"
FT   gene            211090..211560
FT                   /locus_tag="SP670_0238"
FT   CDS_pept        211090..211560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0238"
FT                   /product="ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90320"
FT                   /protein_id="ADM90320.1"
FT                   /translation="MKTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVK
FT                   EGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGN
FT                   RNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   gene            complement(211853..213115)
FT                   /locus_tag="SP670_0239"
FT   CDS_pept        complement(211853..213115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0239"
FT                   /product="mn2+ and fe2+ transporter of the nramp family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90321"
FT                   /protein_id="ADM90321.1"
FT                   /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGSY
FT                   GWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLYLWIFFILNVFSAMVN
FT                   TAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSALTI
FT                   ATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWSAEKR
FT                   KTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQFVGMYA
FT                   SVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRKSLNIWMTIT
FT                   AIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWLKHLAIAG
FT                   LIFLFGFAIFFIYALAIGKAG"
FT   gene            complement(213425..213883)
FT                   /locus_tag="SP670_0240"
FT   CDS_pept        complement(213425..213883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90322"
FT                   /protein_id="ADM90322.1"
FT                   /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(213880..214320)
FT                   /locus_tag="SP670_0241"
FT   CDS_pept        complement(213880..214320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0241"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90323"
FT                   /protein_id="ADM90323.1"
FT                   /translation="MKVELQISETYEEEKLIVQAPQPTDKVQKVIEFAENLDQREKIKG
FT                   KIDDQVYLVEIGKIQRFYIENRKVLAETASQTYSIDLRLYQVLKLLPTNFIQISQSEII
FT                   NIDSISHLKLTPNGLVEIFLKNESFTYSSRRYLKTIKEKLEL"
FT   gene            214436..214615
FT                   /locus_tag="SP670_0242"
FT   CDS_pept        214436..214615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90324"
FT                   /protein_id="ADM90324.1"
FT                   /translation="MTLSVLSTTSKQCFELSAPSFLVCSLIFIEYTTILLPLARYFVYV
FT                   EGLGSYVVELFCSF"
FT   gene            214955..215770
FT                   /locus_tag="SP670_0243"
FT   CDS_pept        214955..215770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0243"
FT                   /product="transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90325"
FT                   /protein_id="ADM90325.1"
FT                   /translation="MSQRELAEGICKQGQISRLESGEFTPGADFLHALAKKLKVSMDYF
FT                   FDEQVVEKVEELSEFKKLAQTFITNRNYESLKYIYELENVKAHRLSLADKIYMEWIKSL
FT                   IDFYFYGQKEDAIVRLEGVLSQLSVSDLNYLQVSNTLFNFYYDIGDLGRFNKIREKLEY
FT                   RVNQLNLSTIEELELSIKFNYNVCRYLWLQKNIEEAITKITATIKQCKAYRTNYLLADL
FT                   YLLMGNVSENFSSKSSVKEYFETAHFLYKLEENMSMALKVEHYIADITE"
FT   gene            215920..216054
FT                   /locus_tag="SP670_0244"
FT   CDS_pept        215920..216054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90326"
FT                   /protein_id="ADM90326.1"
FT                   /translation="MRSLFKKIVAVLVIGLILLGIARTPQVHKIARGIDPGPANGQAL"
FT   gene            216082..216225
FT                   /locus_tag="SP670_0245"
FT   CDS_pept        216082..216225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90327"
FT                   /protein_id="ADM90327.1"
FT                   /translation="MRFDKISPHRIKILNFIIEGEIKLKFKKKSLKPKKIRFVLGYNGG
FT                   DK"
FT   gene            216475..217923
FT                   /locus_tag="SP670_0246"
FT   CDS_pept        216475..217923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90328"
FT                   /protein_id="ADM90328.1"
FT                   /translation="MYLEKKMQILISEVNVTSFGITREILKKMDFNFSKMGSEEAKFLI
FT                   FPELPRGGELSLTARQSYDSQLRYSMLPRVEDIMKKIVNQLREHLKILDIELSDLSYLS
FT                   EGDQFILKELSSHVKINIKITPIKKIRYVYEDIFLNQSAEELHELGLKYLSAGDLWASK
FT                   KIFTYLVNKYDNRRDVFKLATTYNMLLETEKAEYYYNLYKHDGKVDHIVAANYMLAMLY
FT                   ARHHPKYLQDDQKAIVLLNEAYDLIKDKVTLESIFNRNGYALLLFKMGKVEETIILLKR
FT                   CLNQIKQLDNSSSSVVLHESVLWFNLYQCYVTIGDNTNSRKTFYILKNMDPLFIEYYLE
FT                   YSRNLLETDVENFLEFIESMPHHSNNFAEKYSLLGYYFRGTAKSLEYFSKAFELSNRTF
FT                   SFWYDITYELTEFNLYNEAYNNLPLLNNKLYELNDEDLLNYILISAEIFYNLDRLDEFK
FT                   RTIEIGYRIFPDSESIKEIIENAE"
FT   gene            217920..219095
FT                   /locus_tag="SP670_0247"
FT   CDS_pept        217920..219095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0247"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90329"
FT                   /protein_id="ADM90329.1"
FT                   /translation="MKRYKTLFIKYPDSFQFLVFNILFYLSMSLSRSVHSIWFDLNGSL
FT                   LNYSISYSAMAFSGMFAGILGRRINYFNLRNLIRIGVILYSIGLLLRLFPNDWLISLIS
FT                   GLISGIGAATIILLLRTWAVGIGKEKDRVVTISLKRFSSSLGTSIGGILSGILLYCLIY
FT                   FFHSMAYPIVLASASMLCLVTFFCIPKIDSFVDKSERAERILESSNYMKKRIIFFGIFS
FT                   GLIASIFSPYLPVILRRQEISEVFIGPVLTILSLLTIYFSSIFSSRKVDNHKQGYYILS
FT                   ELLISILTLLFSFHLKYYLVITILIIRVFFVNLSSITQELMELSIYPKEKISYFYGISQ
FT                   TSYFIGDTLGGFIGGWLFNQDMKYSIYLFSVLLLFNAVLFNRFYLRNNKNS"
FT   gene            complement(219229..220286)
FT                   /pseudo
FT                   /locus_tag="SP670_0248"
FT   CDS_pept        complement(219229..220286)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0248"
FT                   /note="transposase, degenerate"
FT   gene            complement(220592..220714)
FT                   /locus_tag="SP670_0251"
FT   CDS_pept        complement(220592..220714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90330"
FT                   /protein_id="ADM90330.1"
FT                   /translation="MVYSIKIKEQTRKLGEETLVNKDVLEAYLPWTKVVQEKCK"
FT   gene            220857..222806
FT                   /locus_tag="SP670_0252"
FT   CDS_pept        220857..222806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0252"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90331"
FT                   /protein_id="ADM90331.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGYGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVEQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   gene            complement(223131..223598)
FT                   /gene="ribH"
FT                   /locus_tag="SP670_0253"
FT   CDS_pept        complement(223131..223598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SP670_0253"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90332"
FT                   /protein_id="ADM90332.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(223599..224804)
FT                   /locus_tag="SP670_0254"
FT   CDS_pept        complement(223599..224804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0254"
FT                   /product="riboflavin biosynthesis protein ribAB"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90333"
FT                   /protein_id="ADM90333.1"
FT                   /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENV
FT                   NFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERG
FT                   LTARMCVAEDITPSDFRRPGHMFPLMAKKGGVLERNGHTEATVDLLKLAGLKECGLCCE
FT                   IMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKA
FT                   ISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIV
FT                   ENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAQMLK
FT                   DLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNME
FT                   EK"
FT   gene            complement(224824..225459)
FT                   /gene="ribE"
FT                   /locus_tag="SP670_0255"
FT   CDS_pept        complement(224824..225459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SP670_0255"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90334"
FT                   /protein_id="ADM90334.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
FT   gene            complement(225444..226544)
FT                   /gene="ribD"
FT                   /locus_tag="SP670_0256"
FT   CDS_pept        complement(225444..226544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SP670_0256"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90335"
FT                   /protein_id="ADM90335.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAIIVKDNHIIGQGYHEF
FT                   FGGPHAERNALKNCRKSPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHHVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   gene            226949..227542
FT                   /gene="ruvA"
FT                   /locus_tag="SP670_0257"
FT   CDS_pept        226949..227542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SP670_0257"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90336"
FT                   /protein_id="ADM90336.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDDLPAKVAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            227552..228115
FT                   /locus_tag="SP670_0258"
FT   CDS_pept        227552..228115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0258"
FT                   /product="DNA-3-methyladenine glycosylase 1"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90337"
FT                   /protein_id="ADM90337.1"
FT                   /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLYDDQALFELLCMETYQAG
FT                   LSWETVLNKRQAFREAFHSYQIHSVAEMTDTELEAMLENPAIIRNRAKIFATRANAQAF
FT                   LQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRDFKFTGPVA
FT                   VLSFLQAAGLVDDHENDCEWKGLK"
FT   gene            228112..228789
FT                   /locus_tag="SP670_0259"
FT   CDS_pept        228112..228789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0259"
FT                   /product="caax amino protease family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90338"
FT                   /protein_id="ADM90338.1"
FT                   /translation="MMSNKNKGILIFAILYTILFVFDGVKLLASLMPSAIANYLVYVVL
FT                   ALYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDG
FT                   QGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLPGLLSIILVGLV
FT                   FALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAIS
FT                   IVK"
FT   gene            complement(228944..229975)
FT                   /locus_tag="SP670_0260"
FT   CDS_pept        complement(228944..229975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0260"
FT                   /product="MccC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90339"
FT                   /protein_id="ADM90339.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKVLGLNPIFLPHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKAIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGSAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEEPKPEDFKKMLLTLKDTGIFAVINGLLV
FT                   GKPMDETFHDDYKEALLDIIDNNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVIRFD
FT                   YNK"
FT   gene            complement(230230..230913)
FT                   /locus_tag="SP670_0261"
FT   CDS_pept        complement(230230..230913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90340"
FT                   /protein_id="ADM90340.1"
FT                   /translation="MSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQI
FT                   LEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFITSLFALV
FT                   SALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRPPFWKSVL
FT                   VILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSASAGP
FT                   TRYQE"
FT   gene            complement(230925..231869)
FT                   /locus_tag="SP670_0262"
FT   CDS_pept        complement(230925..231869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0262"
FT                   /product="magnesium and cobalt transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90341"
FT                   /protein_id="ADM90341.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
FT   gene            232001..234832
FT                   /gene="uvrA"
FT                   /locus_tag="SP670_0263"
FT   CDS_pept        232001..234832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SP670_0263"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90342"
FT                   /protein_id="ADM90342.1"
FT                   /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTTTE
FT                   INDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPERQRLQILAPVIRKKKGQH
FT                   KSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRLFDSI
FT                   EAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCSECDGL
FT                   GIKLEVDTDLVVPDASKTLREGALAPWNPISSNYYPNMLEQAMKVFGVAMDKPFEDLSE
FT                   EDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYTRTQMRLY
FT                   MNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTLSENEAIIA
FT                   RPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGAGVFGGEIVAA
FT                   GTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVIGARENNLQNVTARFPLGK
FT                   FIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVDRLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQHIPKIQRKLQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPTTGLHTEDIARL
FT                   LKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTGTPEEVAANEAS
FT                   YTGHYLKGKLHHE"
FT   gene            234825..235886
FT                   /locus_tag="SP670_0264"
FT   CDS_pept        234825..235886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0264"
FT                   /product="proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90343"
FT                   /protein_id="ADM90343.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGVIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMGLTRIGFEDEISVSYYHR
FT                   MQAAFAGLDLFPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            complement(235963..236924)
FT                   /pseudo
FT                   /locus_tag="SP670_0265"
FT   CDS_pept        complement(235963..236924)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0265"
FT                   /note="transposase, unverified frameshift"
FT   gene            237272..237670
FT                   /locus_tag="SP670_0267"
FT   CDS_pept        237272..237670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0267"
FT                   /product="regulatory protein spx"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90344"
FT                   /protein_id="ADM90344.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            237736..238305
FT                   /locus_tag="SP670_0268"
FT   CDS_pept        237736..238305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90345"
FT                   /protein_id="ADM90345.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLTIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGLENLLKNEPSKYISDRLANGATEQ"
FT   gene            238392..238658
FT                   /locus_tag="SP670_0269"
FT   CDS_pept        238392..238658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90346"
FT                   /protein_id="ADM90346.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            238671..239081
FT                   /locus_tag="SP670_0270"
FT   CDS_pept        238671..239081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90347"
FT                   /protein_id="ADM90347.1"
FT                   /translation="MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKEL
FT                   VDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAERML
FT                   IEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
FT   gene            239097..239402
FT                   /locus_tag="SP670_0271"
FT   CDS_pept        239097..239402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0271"
FT                   /product="YrzB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90348"
FT                   /protein_id="ADM90348.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            239708..240958
FT                   /locus_tag="SP670_0272"
FT   CDS_pept        239708..240958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0272"
FT                   /product="dihydrofolate:folylpolyglutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90349"
FT                   /protein_id="ADM90349.1"
FT                   /translation="MFEVEEWLHSRIGLNFRSGLGRMQQAVDLLGNPEQSYPIIHVTGT
FT                   NGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLTDQVKEME
FT                   KTLLQTPAQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGELAVITSIG
FT                   LDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVNLYQAGQDF
FT                   LMLNGDFSSSLLNLSQLNIGLEGVYQQENAALALQTFLLFMGEGKEAVDEQAVRKALEQ
FT                   THWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGALKRKDYQGMLG
FT                   YLTEKLPQVELKVTGFDYQGALDERDVTGYDIVSSYREFISDFEERADAQDLLFVTGSL
FT                   YFISEVRGYLLDREQIN"
FT   gene            240955..241512
FT                   /locus_tag="SP670_0273"
FT   CDS_pept        240955..241512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90350"
FT                   /protein_id="ADM90350.1"
FT                   /translation="MTPLFELVILGELLVRENFSKLVAERKFIMKLKRFTLSLASLASF
FT                   SLLVACSQRAQQVQQPVAQQQVQQPAQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTD
FT                   IDGTYTGQDDGDRITLVVTGTTGTWTELESDGDQTVKQVTFDSANQRMIIGDDVKIYTV
FT                   NGNQIVVDDMDRDPSDQIVLTK"
FT   gene            241658..243190
FT                   /locus_tag="SP670_0274"
FT   CDS_pept        241658..243190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0274"
FT                   /product="cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90351"
FT                   /protein_id="ADM90351.1"
FT                   /translation="MKYRKFQLLMSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWITV
FT                   LILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKKLG
FT                   SMHFQEANSQLLKEKLKESDKAAYGVIKSLLSMDTNADIYDQTASTFFPNGEAMWKKMV
FT                   EDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTGDYAH
FT                   RLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHVERFGY
FT                   WKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPYGSGPKP
FT                   IFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRIITPYIPDK
FT                   KFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYRSLVHHYEN
FT                   AVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAPIL"
FT   gene            243268..243411
FT                   /locus_tag="SP670_0275"
FT   CDS_pept        243268..243411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90352"
FT                   /protein_id="ADM90352.1"
FT                   /translation="MLTKEEVNDMIEFKQTHLHRFREIETFVKLCKKSLKQPSQADNPR
FT                   TF"
FT   gene            243448..244986
FT                   /locus_tag="SP670_0276"
FT   CDS_pept        243448..244986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0276"
FT                   /product="competence-induced protein Ccs4"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90353"
FT                   /protein_id="ADM90353.1"
FT                   /translation="MSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKILLWSTL
FT                   VTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYVSQGGFF
FT                   FAIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATLLALPFL
FT                   FAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVSLGLLVFNLGHRRF
FT                   AHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKILENMFF
FT                   YGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHASYLMVV
FT                   FPVFLLLLVTNIKSQQRGRSVRRSRRETPVSLWSRFFKGNLYLLVFGLVYLLSVPFLMK
FT                   FVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILSPLHYTATE
FT                   ENRNKLLNDLKEKQPKVIVVNDKVVVWSEVETLLKENYQQVKTDYSEFKVYKIK"
FT   gene            245106..247313
FT                   /gene="nrdD"
FT                   /locus_tag="SP670_0277"
FT   CDS_pept        245106..247313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="SP670_0277"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90354"
FT                   /protein_id="ADM90354.1"
FT                   /translation="MIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHKAADKVMDV
FT                   TPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRTQR
FT                   DFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLPKH
FT                   VANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATAQI
FT                   SQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKWEDYAWKKTQKD
FT                   VYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHRTA
FT                   IFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPMGC
FT                   RSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDALV
FT                   YRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIGLYEVATVFF
FT                   GNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDKFG
FT                   SIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNPKA
FT                   LEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVKRT
FT                   CGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            247325..247465
FT                   /locus_tag="SP670_0278"
FT   CDS_pept        247325..247465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90355"
FT                   /protein_id="ADM90355.1"
FT                   /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNKK
FT                   K"
FT   gene            247509..248015
FT                   /locus_tag="SP670_0279"
FT   CDS_pept        247509..248015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0279"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90356"
FT                   /protein_id="ADM90356.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKSQSAHDGGFWDVEDFSYEEWLE
FT                   GNRNKEMGIWLPENRVPSIQFVLFGESGCALGFLNLRLRLNEGLLNYAGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWI
FT                   EVANE"
FT   gene            248008..248598
FT                   /gene="nrdG"
FT                   /locus_tag="SP670_0280"
FT   CDS_pept        248008..248598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="SP670_0280"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90357"
FT                   /protein_id="ADM90357.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVAGCMFH
FT                   CEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            248595..249212
FT                   /locus_tag="SP670_0281"
FT   CDS_pept        248595..249212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0281"
FT                   /product="phosphoribulokinase / Uridine kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90358"
FT                   /protein_id="ADM90358.1"
FT                   /translation="MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDS
FT                   TTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQASMDVLTIE
FT                   EPWKVSEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRD
FT                   ASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT"
FT   gene            249479..249787
FT                   /gene="rpsJ"
FT                   /locus_tag="SP670_0282"
FT   CDS_pept        249479..249787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SP670_0282"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90359"
FT                   /protein_id="ADM90359.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            250003..250629
FT                   /gene="rplC"
FT                   /locus_tag="SP670_0283"
FT   CDS_pept        250003..250629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SP670_0283"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90360"
FT                   /protein_id="ADM90360.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            250654..251277
FT                   /gene="rplD"
FT                   /locus_tag="SP670_0284"
FT   CDS_pept        250654..251277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SP670_0284"
FT                   /product="ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90361"
FT                   /protein_id="ADM90361.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            251277..251573
FT                   /gene="rplW"
FT                   /locus_tag="SP670_0285"
FT   CDS_pept        251277..251573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SP670_0285"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90362"
FT                   /protein_id="ADM90362.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            251591..252424
FT                   /gene="rplB"
FT                   /locus_tag="SP670_0286"
FT   CDS_pept        251591..252424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SP670_0286"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90363"
FT                   /protein_id="ADM90363.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            252528..252809
FT                   /gene="rpsS"
FT                   /locus_tag="SP670_0287"
FT   CDS_pept        252528..252809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SP670_0287"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90364"
FT                   /protein_id="ADM90364.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            252821..253165
FT                   /gene="rplV"
FT                   /locus_tag="SP670_0288"
FT   CDS_pept        252821..253165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SP670_0288"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90365"
FT                   /protein_id="ADM90365.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            253178..253831
FT                   /gene="rpsC"
FT                   /locus_tag="SP670_0289"
FT   CDS_pept        253178..253831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SP670_0289"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90366"
FT                   /protein_id="ADM90366.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            253835..254248
FT                   /gene="rplP"
FT                   /locus_tag="SP670_0290"
FT   CDS_pept        253835..254248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SP670_0290"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90367"
FT                   /protein_id="ADM90367.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            254258..254464
FT                   /gene="rpmC"
FT                   /locus_tag="SP670_0291"
FT   CDS_pept        254258..254464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SP670_0291"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90368"
FT                   /protein_id="ADM90368.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            254489..254749
FT                   /gene="rpsQ"
FT                   /locus_tag="SP670_0292"
FT   CDS_pept        254489..254749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SP670_0292"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90369"
FT                   /protein_id="ADM90369.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            254775..255143
FT                   /gene="rplN"
FT                   /locus_tag="SP670_0293"
FT   CDS_pept        254775..255143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SP670_0293"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90370"
FT                   /protein_id="ADM90370.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            255221..255526
FT                   /gene="rplX"
FT                   /locus_tag="SP670_0294"
FT   CDS_pept        255221..255526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SP670_0294"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90371"
FT                   /protein_id="ADM90371.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            255550..256092
FT                   /locus_tag="SP670_0295"
FT   CDS_pept        255550..256092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0295"
FT                   /product="50S ribosomal protein L5 (BL6)"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90372"
FT                   /protein_id="ADM90372.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            256110..256379
FT                   /locus_tag="SP670_0296"
FT   CDS_pept        256110..256379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0296"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90373"
FT                   /protein_id="ADM90373.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            256664..257062
FT                   /gene="rpsH"
FT                   /locus_tag="SP670_0297"
FT   CDS_pept        256664..257062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SP670_0297"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90374"
FT                   /protein_id="ADM90374.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            257254..257790
FT                   /locus_tag="SP670_0298"
FT   CDS_pept        257254..257790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0298"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90375"
FT                   /protein_id="ADM90375.1"
FT                   /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIRV
FT                   EGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            257874..258230
FT                   /gene="rplR"
FT                   /locus_tag="SP670_0299"
FT   CDS_pept        257874..258230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SP670_0299"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90376"
FT                   /protein_id="ADM90376.1"
FT                   /translation="MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            258248..258742
FT                   /gene="rpsE"
FT                   /locus_tag="SP670_0300"
FT   CDS_pept        258248..258742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SP670_0300"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90377"
FT                   /protein_id="ADM90377.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            258756..258938
FT                   /gene="rpmD"
FT                   /locus_tag="SP670_0301"
FT   CDS_pept        258756..258938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SP670_0301"
FT                   /product="ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90378"
FT                   /protein_id="ADM90378.1"
FT                   /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRG
FT                   MITAVSHLVTVEEVN"
FT   gene            259083..259523
FT                   /gene="rplO"
FT                   /locus_tag="SP670_0302"
FT   CDS_pept        259083..259523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SP670_0302"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90379"
FT                   /protein_id="ADM90379.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            259536..260846
FT                   /locus_tag="SP670_0303"
FT   CDS_pept        259536..260846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0303"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90380"
FT                   /protein_id="ADM90380.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            260997..261635
FT                   /locus_tag="SP670_0304"
FT   CDS_pept        260997..261635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0304"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90381"
FT                   /protein_id="ADM90381.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLAEL
FT                   GIELEGIINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            261752..261970
FT                   /gene="infA"
FT                   /locus_tag="SP670_0305"
FT   CDS_pept        261752..261970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SP670_0305"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90382"
FT                   /protein_id="ADM90382.1"
FT                   /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            262129..262494
FT                   /gene="rpsM"
FT                   /locus_tag="SP670_0306"
FT   CDS_pept        262129..262494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SP670_0306"
FT                   /product="ribosomal protein S13p/S18e"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90383"
FT                   /protein_id="ADM90383.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            262512..262895
FT                   /gene="rpsK"
FT                   /locus_tag="SP670_0307"
FT   CDS_pept        262512..262895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SP670_0307"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90384"
FT                   /protein_id="ADM90384.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            262938..263873
FT                   /gene="rpoA"
FT                   /locus_tag="SP670_0308"
FT   CDS_pept        262938..263873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SP670_0308"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90385"
FT                   /protein_id="ADM90385.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            263885..264271
FT                   /gene="rplQ"
FT                   /locus_tag="SP670_0309"
FT   CDS_pept        263885..264271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SP670_0309"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90386"
FT                   /protein_id="ADM90386.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            264536..264802
FT                   /locus_tag="SP670_0310"
FT   CDS_pept        264536..264802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0310"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90387"
FT                   /protein_id="ADM90387.1"
FT                   /translation="MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI"
FT   gene            264812..266149
FT                   /locus_tag="SP670_0311"
FT   CDS_pept        264812..266149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90388"
FT                   /protein_id="ADM90388.1"
FT                   /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIY
FT                   QKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAK
FT                   EIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVAD
FT                   MGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRA
FT                   LEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIP
FT                   KGKEGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            266393..267085
FT                   /locus_tag="SP670_0312"
FT   CDS_pept        266393..267085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0312"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90389"
FT                   /protein_id="ADM90389.1"
FT                   /translation="MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIGL
FT                   RESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMDKRIREWCFGSFDGAYDGDL
FT                   FMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEMIAKEMEDQ
FT                   GGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYRELGR
FT                   EKMEEGSI"
FT   gene            complement(267188..268180)
FT                   /locus_tag="SP670_0313"
FT   CDS_pept        complement(267188..268180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0313"
FT                   /product="ABC transporter membrane-spanning permease-iron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90390"
FT                   /protein_id="ADM90390.1"
FT                   /translation="MLIGEGYRTFPVLIYTQFISEVGGNSAFAIMAIIIALAIFLIQKH
FT                   IANRYSFSMNLLHPIEPKKTTKGKMAAIYATVYGIIFISVLPQIYLIYTSFLKTSGMVF
FT                   VKGYSPNSYKLAFNRMGSAIFNTIRIPLIALVLVVLFATFISYLAVRKRNLFTNLIDSL
FT                   SMVPYIVPGTVLGIAFISSFNTGLFGSGFLMITGTAFILIMSLSVRRLPYTIRSSVASL
FT                   QQIAPSIEEAAESLGSSRLNIFAKITTPMMLSGIISGAILSWVTMISKLSTSILLYNVK
FT                   TRTMTVAIYTEVLRGNYGVAAALSTILTVLTVGSLLLFMKISKSNSITL"
FT   gene            complement(268207..268833)
FT                   /locus_tag="SP670_0314"
FT   CDS_pept        complement(268207..268833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0314"
FT                   /product="ABC transporter membrane-spanning permease-iron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90391"
FT                   /protein_id="ADM90391.1"
FT                   /translation="MECKKLNIWTASSFFIFLTYLVFLVYPIVTVLKQALIHEGQFSLA
FT                   NFVTFFSKTYYSETLVNSFRVSITATVTSLVVGTLLAYLFSMYDFKGKKFLQILIIIAS
FT                   MSAPFVGAYSWILLLRRNEVITKFLTNALHLPAIDIYGFKGSILVFTLQLFPLVFLYVA
FT                   GTMNSIDNSLLEAAESMGSFGFKSIVTVVLPLLVSTLLAAPCLYL"
FT   gene            complement(268823..269915)
FT                   /pseudo
FT                   /locus_tag="SP670_0315"
FT   CDS_pept        complement(268823..269915)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0315"
FT                   /note="ABC transporter, ATP-binding protein, unverified
FT                   frameshift"
FT   gene            complement(269928..270944)
FT                   /locus_tag="SP670_0317"
FT   CDS_pept        complement(269928..270944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0317"
FT                   /product="iron ABC transporter, iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90392"
FT                   /protein_id="ADM90392.1"
FT                   /translation="MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATI
FT                   PAFEEKYGIKVELIQAGTGELFKKLESEKEVPVADVIFGGSYTQYTTHGELFENYTSKE
FT                   NDNVIKEYQNTTGYSTPYTLDGSVLIVNPDLTKGMNIEGYNDLFKPELKGKIATADPAN
FT                   SSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGKIGLSSSGVYKAVADGEMTVGLS
FT                   YEDPAIKLLNDGANIKVVYPKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTL
FT                   GTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIKNKSDIVKKYNEVFTDIQSKQ"
FT   gene            complement(271161..271358)
FT                   /locus_tag="SP670_0318"
FT   CDS_pept        complement(271161..271358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0318"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90393"
FT                   /protein_id="ADM90393.1"
FT                   /translation="MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKV
FT                   FKKYLHISPKKLKSLGRIVK"
FT   gene            complement(271433..272209)
FT                   /locus_tag="SP670_0319"
FT   CDS_pept        complement(271433..272209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0319"
FT                   /product="pyruvate formate-lyase 3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90394"
FT                   /protein_id="ADM90394.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDGVNALHPEDLIDYQKVFLNHHINCYF"
FT   gene            272331..273077
FT                   /locus_tag="SP670_0320"
FT   CDS_pept        272331..273077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0320"
FT                   /product="putative HTH-type transcriptional regulator YciT"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90395"
FT                   /protein_id="ADM90395.1"
FT                   /translation="MKRLEQIIKLVSEYEKIDVNTLSEKLNVSKVTVRKDLDKLESKGL
FT                   LHREHGYAVLNSGDDLNVRLSINYETKRKIVQEAVKLVSDNETIMIESGSTCALLAEEI
FT                   CKQKRNVTIVTNSFFIANFVRAYDSCRVIVLGGEFQKDSQVTVGPLLKEMIQTFHVCQA
FT                   FVGTDGYDKEMGFTGKDLMRSEVVQYISAVSDKVIVLTDSSKFDKRGTVRRFALSQVYE
FT                   VITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            273090..274070
FT                   /locus_tag="SP670_0321"
FT   CDS_pept        273090..274070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0321"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90396"
FT                   /protein_id="ADM90396.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NVGIVKIEIENFDTNMFKLENYVKEKYSLESLEIIPNEFDDTPTILSERISQVAAGVLR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            274265..274585
FT                   /locus_tag="SP670_0322"
FT   CDS_pept        274265..274585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0322"
FT                   /product="phosphotransferase system sugar-specific eiia
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90397"
FT                   /protein_id="ADM90397.1"
FT                   /translation="MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            274631..274939
FT                   /locus_tag="SP670_0323"
FT   CDS_pept        274631..274939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0323"
FT                   /product="phosphotransferase system sugar-specific eiib
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90398"
FT                   /protein_id="ADM90398.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQASGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            274956..276254
FT                   /locus_tag="SP670_0324"
FT   CDS_pept        274956..276254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0324"
FT                   /product="lichenan permease EIIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90399"
FT                   /protein_id="ADM90399.1"
FT                   /translation="MSKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTVVGSLFLIM
FT                   GQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNSGVEALPAG
FT                   VLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIKRKI
FT                   VIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYSAIQVPLQG
FT                   LTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASGNLSLENGA
FT                   HIVTQQFLDSFLILSGSGITFGLVVAMLFAAKSKQYQTLGKVAAFPAIFNVNEPVVFGF
FT                   PIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGFLVGGWQGV
FT                   VTQLLVLVISTVVYFPFFKIQDRLAYQNEIKQS"
FT   gene            276405..278843
FT                   /locus_tag="SP670_0325"
FT   CDS_pept        276405..278843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0325"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90400"
FT                   /protein_id="ADM90400.1"
FT                   /translation="MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVLA
FT                   TRAYERYKEQPNVLKRAYMLKEILENMSIYIEEESMIAGNQASSNKDAPIFPEYTLEFV
FT                   LNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETGFFG
FT                   MEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIFIVI
FT                   DAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWFIQC
FT                   ILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVRSQS
FT                   HTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDAR
FT                   FMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWGYRC
FT                   TGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDKTLRYLTRMS
FT                   VIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLA
FT                   AIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVTAAY
FT                   DIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCS
FT                   PSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTFFNR
FT                   LHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
FT                   "
FT   gene            278862..279530
FT                   /locus_tag="SP670_0326"
FT   CDS_pept        278862..279530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0326"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90401"
FT                   /protein_id="ADM90401.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKE
FT                   GYHITATAIYTVIQGLLAIEVGADYLAPYYNRMENLNIDSNSVIRQLALAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVTQNSRSI
FT                   "
FT   gene            279548..280636
FT                   /locus_tag="SP670_0327"
FT   CDS_pept        279548..280636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0327"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90402"
FT                   /protein_id="ADM90402.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   gene            281091..283592
FT                   /gene="leuS"
FT                   /locus_tag="SP670_0328"
FT   CDS_pept        281091..283592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SP670_0328"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90403"
FT                   /protein_id="ADM90403.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQAEAVA
FT                   DYKHQASLKSDLARTDLAKEKTGVWIGAYAINPVNGKEMPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAY
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPETELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVTTDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALDKAYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYIDYAKGFIQLIAPFAPHLAEELWQTVAETGE
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKAEI
FT                   DGKEIVKVIAVPNKLVNIVVK"
FT   gene            283731..284573
FT                   /locus_tag="SP670_0329"
FT   CDS_pept        283731..284573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90404"
FT                   /protein_id="ADM90404.1"
FT                   /translation="MNRLVNDSRKCEILLFKISIIVVSVIVLVMSIVGAYYFKNCLWDK
FT                   ESLNLTLTLDTLFAVFITFFSFSNDKSSNIFGISPNEIIRTQSEVYQFLFTKSFATLLI
FT                   VTNLLSIIHYFGAKNLIVSFNETYPRIQSSVGIMWLPLFGILIIYFIWLLIEGLKYIRK
FT                   INYIIQNREIIYFYSQVKVVDKLTDSESKKYGEYIDLYESCRQNNLSVLLNFLQNSDDK
FT                   RGVIASNSVRIMFESLDKADQIAALNICRNYVARENVLNKEDAEKLLNEIDKKLEISR"
FT   gene            284629..285324
FT                   /locus_tag="SP670_0330"
FT   CDS_pept        284629..285324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0330"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90405"
FT                   /protein_id="ADM90405.1"
FT                   /translation="MPVNEYGQMIGESMEGYTPGALPSIDFLEGRYARIEALSVEKHAE
FT                   DLLAVYGPDTPREMWTYLFQEPVADMGELVSLLNQMLARKDRFYYAIIDKATGKALGTF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYIFEELNYRRYEWKCDALNLP
FT                   SRRVAERLGFVYEGTFRQAVVYKGRTRDTDWLSMIDMDWPQVKDRLETWLRPENFDKNG
FT                   QQYKSLREL"
FT   gene            285336..285752
FT                   /locus_tag="SP670_0331"
FT   CDS_pept        285336..285752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0331"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90406"
FT                   /protein_id="ADM90406.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEHALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVFVQDLIVLPIYQRQGIGSALMKEALKDYKDAYQVQLV
FT                   TEETEKNVGFYRSMGFEILSTYNCIGMTWANREK"
FT   gene            286810..287781
FT                   /gene="ruvB"
FT                   /locus_tag="SP670_0332"
FT   CDS_pept        286810..287781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SP670_0332"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90407"
FT                   /protein_id="ADM90407.1"
FT                   /translation="MGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAAKMRDEALDH
FT                   VLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELEPGDVLFIDEIH
FT                   RLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGMLSNPLRARF
FT                   GITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANRLLKRVRDFA
FT                   QIMGNGVIDDIITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGGPVGLGTLSVNIAEE
FT                   RETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
FT   gene            287762..288334
FT                   /locus_tag="SP670_0333"
FT   CDS_pept        287762..288334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90408"
FT                   /protein_id="ADM90408.1"
FT                   /translation="MNTVKNKQEILEAFRENPDMMAILTIIRDLGLKDSWLAAGSVRNF
FT                   IWNLLSDKSPFDHETDIDVIFFDPDFSYEETLLLEKKLREDFPQYQWELKNQVYMHQHS
FT                   PHTASYTSSRDAMSKYPERCTTVGLRLNEESDFELYAPYGLEDILNFQVRPTPHFLENE
FT                   DRMELYQTRLSKKNWQEKWKNLIFKNT"
FT   gene            288565..289323
FT                   /gene="uppS"
FT                   /locus_tag="SP670_0334"
FT   CDS_pept        288565..289323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SP670_0334"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90409"
FT                   /protein_id="ADM90409.1"
FT                   /translation="MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGH
FT                   KAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPVQEVKFIMNLPVEFYDNYVPELHA
FT                   NNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQD
FT                   VLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYF
FT                   TDTLWPDFDEAALQEAILAYNRRHRRFGGV"
FT   gene            289332..290135
FT                   /gene="cdsA"
FT                   /locus_tag="SP670_0335"
FT   CDS_pept        289332..290135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="SP670_0335"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90410"
FT                   /protein_id="ADM90410.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIIAMLAMHEL
FT                   LKMRGLETMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKVLLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            290157..291416
FT                   /gene="rseP"
FT                   /locus_tag="SP670_0336"
FT   CDS_pept        290157..291416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="SP670_0336"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90411"
FT                   /protein_id="ADM90411.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            291429..293282
FT                   /gene="proS"
FT                   /locus_tag="SP670_0337"
FT   CDS_pept        291429..293282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SP670_0337"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90412"
FT                   /protein_id="ADM90412.1"
FT                   /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTDLDR
FT                   WVVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDGYHLTGVNPGRDFTSEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            293382..294761
FT                   /locus_tag="SP670_0338"
FT   CDS_pept        293382..294761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0338"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90413"
FT                   /protein_id="ADM90413.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTVFRTSIQWSRIFPQGCGKVNPQGVDFYRKVF
FT                   EAIKAKGIRLLVNLYHFDLPFALQEYGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKELSDNNG
FT                   F"
FT   gene            294954..296762
FT                   /gene="glmS"
FT                   /locus_tag="SP670_0339"
FT   CDS_pept        294954..296762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SP670_0339"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90414"
FT                   /protein_id="ADM90414.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEEGLSVLEAFKKALHIIRGSYAFALVDS
FT                   QDPEVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNRRERTSYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDEAGQVVVDP
FT                   DIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLVHELSIVAQSIESTLSEKETIEAKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLSL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            complement(296774..296977)
FT                   /locus_tag="SP670_0340"
FT   CDS_pept        complement(296774..296977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0340"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90415"
FT                   /protein_id="ADM90415.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEVVDRTDEVSNHTYGKATLTWFEEIF
FT                   EEYNTNLEYKQPICSQEKGLDN"
FT   gene            297034..298083
FT                   /locus_tag="SP670_0341"
FT   CDS_pept        297034..298083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0341"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90416"
FT                   /protein_id="ADM90416.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRAEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYREIGSE
FT                   AGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLEQV
FT                   GPNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(298183..301998)
FT                   /locus_tag="SP670_0342"
FT   CDS_pept        complement(298183..301998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0342"
FT                   /product="pullulanase, extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90417"
FT                   /protein_id="ADM90417.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPRNANASLEKTEEKPAASPADP
FT                   APQTGQDRSSEPTTSTSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEK
FT                   PSENWPNGALSFKDAKKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVP
FT                   KMNEAWLDQDYKVFSYEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTD
FT                   FTATGKYGRYIDIPLNEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDD
FT                   DESIYTNPYYVHDIRMTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTIT
FT                   DVAIDEAGKKVTYSGDFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGKLGADLKEE
FT                   GKQVDLTLWSPSADKVSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFT
FT                   GYYYQYQIERQGKTVLALDPYAKSLAAWNSDDAKIDDAHKVAKAAFVDPAKLGPQDLTY
FT                   GKIHNFKTREDAVIYEAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQL
FT                   LPVLSYYFVNELKNHERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFK
FT                   NLINEIHKRGMGAILDVVYNHTAKVDIFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHH
FT                   MTKRLLVDSIKYLVDTYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTY
FT                   AGDENMPTKAADQDWMKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKN
FT                   LIAQPTNFEADSPGDVIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLM
FT                   VLTAQGTPFIHSGQEYGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHD
FT                   SYDSSDAVNKFDWTKATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHL
FT                   ITVPGQNGVEKEDVVIGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADE
FT                   NQAGSVGIANPKGLEWTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSTPSKPEHQD
FT                   PTPEARPDSTKPDAKVADAENKPSQATADSQAEQPAQEAQASSVKEAVQNESVENSSKK
FT                   NIPATPDRQAELPNTGIKNENKLLFAGISLLALLGLGFLLKNKKEN"
FT   gene            302415..302828
FT                   /gene="rpsL"
FT                   /locus_tag="SP670_0343"
FT   CDS_pept        302415..302828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SP670_0343"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90418"
FT                   /protein_id="ADM90418.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            302848..303318
FT                   /gene="rpsG"
FT                   /locus_tag="SP670_0344"
FT   CDS_pept        302848..303318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SP670_0344"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90419"
FT                   /protein_id="ADM90419.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            303743..305824
FT                   /gene="fusA"
FT                   /locus_tag="SP670_0345"
FT   CDS_pept        303743..305824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SP670_0345"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90420"
FT                   /protein_id="ADM90420.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKSKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            305928..310319
FT                   /gene="polC"
FT                   /locus_tag="SP670_0346"
FT   CDS_pept        305928..310319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="SP670_0346"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90421"
FT                   /protein_id="ADM90421.1"
FT                   /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGPCA
FT                   SQGFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPVFDFQAKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   MEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFEPVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEAIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            310421..310684
FT                   /locus_tag="SP670_0347"
FT   CDS_pept        310421..310684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0347"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90422"
FT                   /protein_id="ADM90422.1"
FT                   /translation="MSKMSMSIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQVLTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            310677..310955
FT                   /locus_tag="SP670_0348"
FT   CDS_pept        310677..310955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0348"
FT                   /product="DNA damage inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90423"
FT                   /protein_id="ADM90423.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARYR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            310976..311128
FT                   /locus_tag="SP670_0349"
FT   CDS_pept        310976..311128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90424"
FT                   /protein_id="ADM90424.1"
FT                   /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLSGAIALAGIFS
FT                   ALKEK"
FT   gene            311150..312391
FT                   /locus_tag="SP670_0350"
FT   CDS_pept        311150..312391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0350"
FT                   /product="aminopeptidase PepS"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90425"
FT                   /protein_id="ADM90425.1"
FT                   /translation="MVLPNFKENLEKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGITFFNTL
FT                   FDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            312401..312631
FT                   /locus_tag="SP670_0351"
FT   CDS_pept        312401..312631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0351"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90426"
FT                   /protein_id="ADM90426.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAVLGAMIVLAIFWRRGS"
FT   gene            312854..313576
FT                   /locus_tag="SP670_0352"
FT   CDS_pept        312854..313576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0352"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90427"
FT                   /protein_id="ADM90427.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEIFPVGRLDI
FT                   DTHGLLLLTNDGQLAHVLLSPKRHVDKTYLAQVKGIMTQEDVEIFAEGIPLKDFTCQPA
FT                   ILELVSIDTEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   gene            313794..315128
FT                   /locus_tag="SP670_0353"
FT   CDS_pept        313794..315128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0353"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90428"
FT                   /protein_id="ADM90428.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALERRQSHV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYQSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQTGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
FT   gene            complement(315184..316095)
FT                   /locus_tag="SP670_0354"
FT   CDS_pept        complement(315184..316095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0354"
FT                   /product="IIDman"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90429"
FT                   /protein_id="ADM90429.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(316119..316922)
FT                   /locus_tag="SP670_0355"
FT   CDS_pept        complement(316119..316922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0355"
FT                   /product="IICman"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90430"
FT                   /protein_id="ADM90430.1"
FT                   /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(316950..317939)
FT                   /locus_tag="SP670_0356"
FT   CDS_pept        complement(316950..317939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0356"
FT                   /product="mannose-specific phosphotransferase system
FT                   component iiab"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90431"
FT                   /protein_id="ADM90431.1"
FT                   /translation="MSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLIQAY
FT                   TERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQAAIPEGTVIG
FT                   DGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPGNVK
FT                   ANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTGKTL
FT                   VNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(318172..319191)
FT                   /locus_tag="SP670_0357"
FT   CDS_pept        complement(318172..319191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0357"
FT                   /product="alcohol dehydrogenase, propanol-preferring"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90432"
FT                   /protein_id="ADM90432.1"
FT                   /translation="MKAVVVNPESTGVAVEEKVLRPLETGEALVEIEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   gene            complement(319300..319551)
FT                   /locus_tag="SP670_0358"
FT   CDS_pept        complement(319300..319551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0358"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90433"
FT                   /protein_id="ADM90433.1"
FT                   /translation="MKIKEQTRKLAIGCSKHCFEVVDETDEVNNHIYGKAKLTWFEEIF
FT                   EEYDQLASWSLCSFHSLINQLIDCSTFCLQNLGKGFLL"
FT   gene            complement(319568..320380)
FT                   /locus_tag="SP670_0359"
FT   CDS_pept        complement(319568..320380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0359"
FT                   /product="Cof family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90434"
FT                   /protein_id="ADM90434.1"
FT                   /translation="MTKKIIAVDLDGTLLNSDSQISDFTKKTIKKVAEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVRRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKDPNCILLQTRASDKYA
FT                   LAKEMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKVMNRDKKNLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQIALTNDQDGVAKTLQDLFL"
FT   gene            320570..321988
FT                   /locus_tag="SP670_0360"
FT   CDS_pept        320570..321988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0360"
FT                   /product="inner membrane protein YicO"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90435"
FT                   /protein_id="ADM90435.1"
FT                   /translation="MDKLFKLKENGTDVRTEVLAGLTTFFAMSYILFVNPQILSQTGMP
FT                   AQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTFTVVFGLGYSWQEALAMVF
FT                   ICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYVGIKNAGLLKFTIDPGNYT
FT                   VIGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAITIFFVIKGIKGGILLSILT
FT                   TTVLAIAVGLVDLSSIDFANNHVGAAFKDLKTIFGAALGSEGLGALVSDTARLPETLMA
FT                   ILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKALYSDLIGTSIGAIAGTSN
FT                   VTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIVPTAATAPILIIVGIMMLA
FT                   SLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYTLTKLVKGQAKDVHVMIWI
FT                   LDALFILNYISMAL"
FT   gene            322042..322749
FT                   /locus_tag="SP670_0361"
FT   CDS_pept        322042..322749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0361"
FT                   /product="caax amino protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90436"
FT                   /protein_id="ADM90436.1"
FT                   /translation="MKEKNIWKELLNRAGWLLIFLLATILYQIPLAVTAILTLREVPLL
FT                   QSGLIVAGISIVVLALFIIGARKTQLASFNFSFFRAKDLARLGLSYLVIICSSILGSIL
FT                   LQLSNETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIVPKKIFRGKENLG
FT                   FVVGTIVFALLHQPSNLPSLLIYGGMSIVLSWTAYKTQRLEMSILLHMIVNGVAFCLLA
FT                   LMVIMRRTLGISV"
FT   gene            322820..322933
FT                   /locus_tag="SP670_0362"
FT   CDS_pept        322820..322933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90437"
FT                   /protein_id="ADM90437.1"
FT                   /translation="MTRFEEIFEEYKIIDNCLLVSTGKKMNAIVSIFFFLW"
FT   gene            322978..323925
FT                   /gene="folP"
FT                   /locus_tag="SP670_0363"
FT   CDS_pept        322978..323925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SP670_0363"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90438"
FT                   /protein_id="ADM90438.1"
FT                   /translation="MSSKANHAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAE
FT                   GASMLDIGGESTRPGRSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALA
FT                   AGANLVNDITGLMGDEKMAHVVAKAGAKVVIMFNPVMARPQHPSSLIFPHFGFGQAFTG
FT                   EELADFETRSIEDLMETFFERALARAEEAGIAQENILLDPGIGFGLTKKENLLLLRDLD
FT                   KLHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEV
FT                   VRVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
FT   gene            323927..325249
FT                   /locus_tag="SP670_0364"
FT   CDS_pept        323927..325249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0364"
FT                   /product="dihydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90439"
FT                   /protein_id="ADM90439.1"
FT                   /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIG
FT                   GTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEVRLEALMADYQS
FT                   LLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALAVIDRIAEGKDAPRLAYG
FT                   TDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGREL
FT                   ASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADYHKEILF
FT                   TCIKTKALEDMLDLLGAMPDTELTLTHFADSRATDENVLKEAAKSRNLSYQDWHDFLEQ
FT                   NLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
FT   gene            325230..325784
FT                   /gene="folE"
FT                   /locus_tag="SP670_0365"
FT   CDS_pept        325230..325784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SP670_0365"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90440"
FT                   /protein_id="ADM90440.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            325827..326639
FT                   /locus_tag="SP670_0366"
FT   CDS_pept        325827..326639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0366"
FT                   /product="bifunctional folate synthesis protein"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90441"
FT                   /protein_id="ADM90441.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIYILKESSVLATEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(326684..327001)
FT                   /locus_tag="SP670_0367"
FT   CDS_pept        complement(326684..327001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90442"
FT                   /protein_id="ADM90442.1"
FT                   /translation="MAFTNTHMRSASFGIVTSLPDDIIDSFWYIIDHFLKNVFELEEEL
FT                   EFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVLVLDMDGRETILLPEENDL
FT                   F"
FT   gene            327358..327804
FT                   /gene="rplM"
FT                   /locus_tag="SP670_0368"
FT   CDS_pept        327358..327804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SP670_0368"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90443"
FT                   /protein_id="ADM90443.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            327823..328215
FT                   /gene="rpsI"
FT                   /locus_tag="SP670_0369"
FT   CDS_pept        327823..328215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SP670_0369"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90444"
FT                   /protein_id="ADM90444.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   gene            328591..328773
FT                   /locus_tag="SP670_0370"
FT   CDS_pept        328591..328773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0370"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90445"
FT                   /protein_id="ADM90445.1"
FT                   /translation="MGKLELLCEEFGHKLLPLPPYSSEYNPIEKTWAHIKKHLKKVLPS
FT                   CNTFYEALLSCSCFN"
FT   gene            328928..329266
FT                   /locus_tag="SP670_0371"
FT   CDS_pept        328928..329266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0371"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90446"
FT                   /protein_id="ADM90446.1"
FT                   /translation="MTLTIHVYYKGDGDSAIKFAREMLDSGLVEEIRNQKGNLKYEYFL
FT                   PIEKEGTILLIDQWINQETLDKHYQSKTMQKILDLRKKYHLQMQVERYIEDDSGMPESD
FT                   KSFIDTGN"
FT   gene            329456..330892
FT                   /locus_tag="SP670_0372"
FT   CDS_pept        329456..330892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0372"
FT                   /product="6-phospho-beta-glucosidase BglA"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90447"
FT                   /protein_id="ADM90447.1"
FT                   /translation="MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR
FT                   EITLGVLEGKYYPNHEAIDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNE
FT                   EGLQFYDNLFDECLKNGIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVIFKR
FT                   YKDKVKYWMTFNEINNQANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAV
FT                   KIGHEINPDFQIGCMIAMCPIYPATCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFK
FT                   YWERKGISVDFTAQDKEDLLGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNN
FT                   YVKASEWEWQIDPEGLRYALNWFTDHYHLPLFIVENGFGAIDKVAADGMVHDDYRIEYL
FT                   GAHIREMKKAVVEDGVDLMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRS
FT                   PKKSFGWYKEVISSNGESVE"
FT   gene            330944..331183
FT                   /locus_tag="SP670_0373"
FT   CDS_pept        330944..331183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0373"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90448"
FT                   /protein_id="ADM90448.1"
FT                   /translation="MIGSIAAILTTFAFLPQVFRVVKTKDTGSIALGMYVMQVIGIALW
FT                   LAHGIRIGDLPLILANSVSFLLSGIILFYKLKYK"
FT   gene            331313..331627
FT                   /locus_tag="SP670_0374"
FT   CDS_pept        331313..331627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0374"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90449"
FT                   /protein_id="ADM90449.1"
FT                   /translation="MAKALIICAAGMSSSLMAQKTTEFLKGKGKDIVVDAISATEGGKA
FT                   IAAAAFDLYLVSPQTKMYFKQFEEAGSKAGKPVVQIPPQAYIPIPMGIEKMANLILENI
FT                   "
FT   gene            331751..333724
FT                   /locus_tag="SP670_0375"
FT   CDS_pept        331751..333724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0375"
FT                   /product="transcription antiterminator BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90450"
FT                   /protein_id="ADM90450.1"
FT                   /translation="MLNIKEKDILQFLIKNKERFVTSKELAEYLSCSDRTVRNVLKLIE
FT                   KTMIIQGVRLISKQGQGYQIFFENQGAYQEFRQTYELEEDYTKTAVSKGDDRLVFILNK
FT                   LLFEQVPVLFDDLADELYVSRSTLSHDFRKIRVMLSEYNLSIESRANKGVYVSGEERDK
FT                   RRFIINYFLENQFFKTIHCYVKFNFFDQTVPLEEFARIVLDECQEANLKLSDFVLQNLV
FT                   VHIALSVIRLKSGFEIKNIDCQMTDDATERKVAQRILSKVREVTNQEFPVQEIDYITLH
FT                   LLAKSQQCQKNQKNISEEVLKKSLFKTFQNLGLDDMYNFSSDFQLIEGLITHLMTLQVR
FT                   LESRITLNNPLVDEIKQNYSDIFFMTREILANMDKFLEWTISDDEVAYVSLHFLAAMER
FT                   SKESTKFNILAICATGFGAAQMLRNRLETEFGKRVEVVDVIGYYELNQEKLKGIDFIVS
FT                   AVDLSNLYFQIPVFKVSVFLKSDEMEMIRKAMDQMQVSSYVPSSKINKFENNGFRQYFS
FT                   KENFLICTESDKVNLLEKMVEGLSVGESNEFEQSLLYGIKQREELSSVVFSEKIAVPHP
FT                   IQPFGTEGKVSVAICKDSLLWDNQSSYVQLVFLLSPSIYGNEGLATVTKKIVSLTENDE
FT                   LQNQLISCNNFEDFINIFEKIK"
FT   gene            333734..334048
FT                   /locus_tag="SP670_0376"
FT   CDS_pept        333734..334048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0376"
FT                   /product="lichenan-specific phosphotransferase EIIA
FT                   component"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90451"
FT                   /protein_id="ADM90451.1"
FT                   /translation="MNQEELQVAAFEIILHSGNARSEIHEAFAKMREGSFDDAESKLNQ
FT                   SNEIILEAHHAQTKLLQEYASGVEIKIEIIMVHAQDHLMTTMTLLEVAKEMLALYKKVN
FT                   "
FT   gene            334079..334585
FT                   /locus_tag="SP670_0377"
FT   CDS_pept        334079..334585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90452"
FT                   /protein_id="ADM90452.1"
FT                   /translation="MDKKERQKIEQQRREMALTNTFFNRYLLLRYSIALFFFGNIYWLL
FT                   NQFINPSPIIIFPIMLIVFSILATVEQFKLYGNRKEKLGITLMFVRIQMLISIGLLVLT
FT                   WTSWFKNLFPIFENNQVARLFVFVVLLLGLVLSLLDIRRIKKIYKRTDKVYQQFVQLEK
FT                   NSLSL"
FT   gene            334665..336011
FT                   /locus_tag="SP670_0378"
FT   CDS_pept        334665..336011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0378"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90453"
FT                   /protein_id="ADM90453.1"
FT                   /translation="MDQQNGLFGFLENHVMGPMGKLAQFKVVRAITAAGMAAVPFTIVG
FT                   SMFLVFSILPQAFSFWPIVADIFSASFDKFRSLYMVANYATMGSLSLYFVLSLAYELTK
FT                   IYAEEEELNMNPLNGALLALMAFVMTVPQIIFDGGMMKTVTSLKEGAVIADGWAMGNGV
FT                   ARFGTTGIFTAIIMAIVTVLIYRMCVKHNWVIKMPEAVPEGVSRGFTALVPGFVVAFVV
FT                   IFINGLLVAMGTDIFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAF
FT                   VSPIALANMAENAAGGHFAVAGEFSNMFVIAGGSGATLGLCLYIAFASKSEQLKAIGRA
FT                   SVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFIKPIIAQVPWP
FT                   TPVGIGAFLGTADLRAVLVALVCAFAAFLVYLPFIRVYDQKLVKEEQGI"
FT   gene            336684..336824
FT                   /locus_tag="SP670_0379"
FT   CDS_pept        336684..336824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90454"
FT                   /protein_id="ADM90454.1"
FT                   /translation="MIASKSLKLFINPILEKLTSDNSLINSWFVKRYFVHYIFSIDYYL
FT                   S"
FT   gene            336919..339132
FT                   /locus_tag="SP670_0380"
FT   CDS_pept        336919..339132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0380"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90455"
FT                   /protein_id="ADM90455.1"
FT                   /translation="MKIFKGEFYRISVLTDKLVRLEYSQTGSFEDRTTQLIYNRDFGQV
FT                   SLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKGT
FT                   ARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDYR
FT                   GAIRDFYHLTGSTPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMDW
FT                   HITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYPQ
FT                   IAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDPL
FT                   WLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATASN
FT                   IGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTSK
FT                   IMKKYLRLRHQMIPYLYTMNVKTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELMV
FT                   APIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAII
FT                   PLVGSEIGMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDWEMGMVELALQG
FT                   DSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLPY
FT                   ELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(339354..339830)
FT                   /locus_tag="SP670_0381"
FT   CDS_pept        complement(339354..339830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0381"
FT                   /product="peroxiredoxin Hyr1"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90456"
FT                   /protein_id="ADM90456.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGL
FT                   QELYERYQDQGFEILDFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLKDHKSGPLGKRIEWNFAKFLISRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            340053..343256
FT                   /locus_tag="SP670_0382"
FT   CDS_pept        340053..343256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0382"
FT                   /product="hyaluronate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90457"
FT                   /protein_id="ADM90457.1"
FT                   /translation="MQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETTTNTIQQSQKEV
FT                   QYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSTWVDQKNSSADASTRVIEAKDGAI
FT                   TISSPEKLRAAVHRMVPIEAKKKYKLRFKIKTDNKVGIAKVRIIEESGKDKRLWNSATT
FT                   SGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQLSEDSQTDKQL
FT                   EEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIVSKDGKEVKKIP
FT                   LKILASVKDAYTARLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVADSLSSISSQADR
FT                   TYLWEKFSNYKMSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVY
FT                   NSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFVPDPEHFRKTTD
FT                   NPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDH
FT                   TNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDM
FT                   SRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQSDSYYDVFKNL
FT                   KTYKDISLMQSLLSDAGVASVPRTSYLSAFNKMDKTAMYNAEKGFGFGLSLFSSRTLNY
FT                   EHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKV
FT                   LPSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQNTSTDTAAT
FT                   TIDQRKLESSNPYKVYVNDKEASLTEQEKDYPETQSVFLESFDSKKNIGYFFFKKSSIS
FT                   MSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYMLIPNVDRATFNQMIKE
FT                   LESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYTIRKEGDEYKIA
FT                   YYNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKNHSDQKNLPQTGEGQSILA
FT                   SLGFLLLGAFYLFRRGKNN"
FT   gene            complement(343494..344246)
FT                   /locus_tag="SP670_0383"
FT   CDS_pept        complement(343494..344246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0383"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90458"
FT                   /protein_id="ADM90458.1"
FT                   /translation="MDRGYESYNLMAHFQEKGWLYIIRIRDGKQSMPSSFNLPNTECFD
FT                   QKVSLKLSRKQTNQLKKLYRDFPNDYHFIPHNSIFDFLPETSRKQDPVTLYELPFRMVR
FT                   LEVEEGKYETLVTNTDYSVQELKNLYASRWGIETSFRDLKYSIGLVNFHAKKKGGILQE
FT                   IFARFTNFNFCRWVTSQVAIDSSHKKQRYKVCFSDAAYACRLFFNGSLSSLQLKNYLKK
FT                   QLSIIRPNRKYSRKIKAQSVVDFIYRVT"
FT   gene            complement(344239..344784)
FT                   /locus_tag="SP670_0384"
FT   CDS_pept        complement(344239..344784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0384"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90459"
FT                   /protein_id="ADM90459.1"
FT                   /translation="MIKQIKAHLNKSIQSIIGQKVEFVKQDEQAFTRKRRLSLETMIRT
FT                   ILGMGGKSLSKELLDARLTVSNSAFVQRRYQIKPEAFYALFKEFTAPIPLNTDFPIFAA
FT                   DGSDICIPRNPMDTETSIQTQTDVKSYNLIHINALYDLTTGVYRDVSIQDKHAQHERLA
FT                   LIQMMEASPFRESSCYHG"
FT   gene            345422..345547
FT                   /locus_tag="SP670_0385"
FT   CDS_pept        345422..345547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0385"
FT                   /product="transposase of family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90460"
FT                   /protein_id="ADM90460.1"
FT                   /translation="MMFDKHANLKYKFGNRHFWAEGYYVSPVGLSEATIKKYSQD"
FT   gene            complement(345923..346552)
FT                   /locus_tag="SP670_0386"
FT   CDS_pept        complement(345923..346552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0386"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90461"
FT                   /protein_id="ADM90461.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSTLSPAYISAVKAPIPQVSVMVTGG
FT                   VGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYITLR"
FT   gene            complement(346562..347563)
FT                   /locus_tag="SP670_0387"
FT   CDS_pept        complement(346562..347563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0387"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90462"
FT                   /protein_id="ADM90462.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMDSLFQGISHFHFSGITVAIGQEVRTILLLLLEEAKRRGIVVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEEVENRM
FT                   RLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEELFEESVQLKTAVYQRIGSGDAFISG
FT                   ALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSATSIENLLANAQDIIR"
FT   gene            complement(347594..348235)
FT                   /locus_tag="SP670_0388"
FT   CDS_pept        complement(347594..348235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0388"
FT                   /product="galactose-6-phosphate isomerase LacB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90463"
FT                   /protein_id="ADM90463.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKGYQLFNYGMRGEEGES
FT                   QLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITHNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(348254..349069)
FT                   /locus_tag="SP670_0389"
FT   CDS_pept        complement(348254..349069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0389"
FT                   /product="gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90464"
FT                   /protein_id="ADM90464.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIEAYREVGIEAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
FT   gene            349341..349775
FT                   /locus_tag="SP670_0390"
FT   CDS_pept        349341..349775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0390"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90465"
FT                   /protein_id="ADM90465.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            349787..350977
FT                   /locus_tag="SP670_0391"
FT   CDS_pept        349787..350977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0391"
FT                   /product="unsaturated glucuronyl hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90466"
FT                   /protein_id="ADM90466.1"
FT                   /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDRVN
FT                   KRVELDHHDLGFLYTPSCMAEYKINGDGEAREATLKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEHYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            350988..351479
FT                   /locus_tag="SP670_0392"
FT   CDS_pept        350988..351479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0392"
FT                   /product="N-acetylgalactosamine-specific phosphotransferase
FT                   EIIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90467"
FT                   /protein_id="ADM90467.1"
FT                   /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKNVKDALTLVEGGVPIKEIN
FT                   IGNIHNATGKEQVTRSIFLGEEDKVALKELSQTHQVTFNTKTTPTGNDGAVQVNIMDYI
FT                   "
FT   gene            351494..352273
FT                   /locus_tag="SP670_0393"
FT   CDS_pept        351494..352273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0393"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90468"
FT                   /protein_id="ADM90468.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
FT   gene            352260..353078
FT                   /locus_tag="SP670_0394"
FT   CDS_pept        352260..353078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0394"
FT                   /product="PTS system, IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90469"
FT                   /protein_id="ADM90469.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
FT   gene            353078..353371
FT                   /locus_tag="SP670_0395"
FT   CDS_pept        353078..353371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0395"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90470"
FT                   /protein_id="ADM90470.1"
FT                   /translation="MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLAS
FT                   LTSGDEVLLLSGIHGKIISIQDDLVSLQIAKGVVIYVEKESVMGKTKELLFK"
FT   gene            353393..355294
FT                   /locus_tag="SP670_0396"
FT   CDS_pept        353393..355294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0396"
FT                   /product="oligohyaluronate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90471"
FT                   /protein_id="ADM90471.1"
FT                   /translation="MKEERRQFFERIDGNQCRDYILSHCSKDYEKVKSSLERLMDNRFM
FT                   FDSPWDMEPCSKIHQNQPMVWDQVFEDDPEWAYMLNRQEYLLQFMIGYVVEGDKDYIQK
FT                   CKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKILVSL
FT                   EKQIDFMKSYYRAKYTLSNWGILQTIPMLAIYHFFSDKMDLEEAYHFASEELKQQIETQ
FT                   ILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYQELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEMLSLSAVVLNKEDLLNGLDVKVDLLSLLFLGREKVKRLQEFERRAWQP
FT                   KSMIFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   IYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGVHYIEGAYWSA
FT                   EPDLPYLHKRKILMLVEDVWLLVDDIRCQGQHEALTQFILDKDVTYQDGKINQLRLWSE
FT                   VDFDLEDTIISPKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRHSVYQTDDREV
FT                   ENALAFEVKNDETDKLILLLSEDICVGEKLCLVDGTKMRGKCLVYDKINERMIRLQC"
FT   gene            355354..356355
FT                   /locus_tag="SP670_0397"
FT   CDS_pept        355354..356355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0397"
FT                   /product="sugar binding transcriptional regulator RegR"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90472"
FT                   /protein_id="ADM90472.1"
FT                   /translation="MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIH
FT                   ETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSNYS
FT                   QESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWVKTN
FT                   NYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANMRHASLTIEDK
FT                   HTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFDNTEWT
FT                   CFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF"
FT   gene            complement(356465..356800)
FT                   /locus_tag="SP670_0398"
FT   CDS_pept        complement(356465..356800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90473"
FT                   /protein_id="ADM90473.1"
FT                   /translation="MKSLARLLNIHVFISIFLFFALISGAVSHTVLLLLLLFLPALNKG
FT                   LEKIQSKRIPVLNAALFFLLISFPQLLTNPVQWKFSIFLVVTIISSLAYFYNFYQVVKE
FT                   VDQKQLI"
FT   gene            complement(356811..357053)
FT                   /locus_tag="SP670_0399"
FT   CDS_pept        complement(356811..357053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90474"
FT                   /protein_id="ADM90474.1"
FT                   /translation="MKKEKKQLRYPGLKAGSIYGTVIFFIIPLIDTLTSENPNFISSLL
FT                   NTKHIFKTMLGAFFFGVMIHIVDSLRIARAKKDQD"
FT   gene            complement(357064..357318)
FT                   /locus_tag="SP670_0400"
FT   CDS_pept        complement(357064..357318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90475"
FT                   /protein_id="ADM90475.1"
FT                   /translation="MLNEKESKQLHYPGLKAGLFFGLWMFFITPLLSILIDEGQDYFHS
FT                   LLTIRNGVSSILGSIFFGASIQFLISRRIAKTKKNQDED"
FT   gene            complement(357326..357607)
FT                   /locus_tag="SP670_0401"
FT   CDS_pept        complement(357326..357607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90476"
FT                   /protein_id="ADM90476.1"
FT                   /translation="MKKETFTEKLIKRTYGISGPLDEYKRREADSIGNQVFIVLFYLMI
FT                   FGNLIPLLLAYKYPQEVALIYPPLILVIALIAAGYVTYQMKKNRHHSH"
FT   gene            357662..357853
FT                   /locus_tag="SP670_0402"
FT   CDS_pept        357662..357853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90477"
FT                   /protein_id="ADM90477.1"
FT                   /translation="MEAAGEIETEFQSWIVLVVFNHIDGLSRDTDILGELELGNAQFLA
FT                   KFFHTIHLVSFLICVVYI"
FT   gene            357983..358933
FT                   /gene="mraW"
FT                   /locus_tag="SP670_0403"
FT   CDS_pept        357983..358933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SP670_0403"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90478"
FT                   /protein_id="ADM90478.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNHYDYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQVREVKPIETTTELAEIIKSAKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMEMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVSRKPILPSAEELEANNRSHSAKLRVARKIHK"
FT   gene            358945..359262
FT                   /gene="ftsL"
FT                   /locus_tag="SP670_0404"
FT   CDS_pept        358945..359262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SP670_0404"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90479"
FT                   /protein_id="ADM90479.1"
FT                   /translation="MAERMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            359266..361518
FT                   /locus_tag="SP670_0405"
FT   CDS_pept        359266..361518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0405"
FT                   /product="penicillin-binding protein 2X"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90480"
FT                   /protein_id="ADM90480.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAVFLVNFA
FT                   VIIGTGTRFGTDLAKEAKKVHQTTRIVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENY
FT                   KSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANM
FT                   MSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGTDGIITYEKDRLGNIVPGTEQVSQQTVDGKDVYTTISSTLQSFMETQMDAFL
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFNADTKEGITEDFVWRDILYQSNYEPGSAMK
FT                   VMTLASSIDNNTFPSGEYFNSSEFKIADATTRDWDVNDGLTTGGMMTFLQGFAHSSNVG
FT                   MSLLEQKMGDATWLDYLKRFKFGVPTRFGLTDEYAGQLPADNIVSIAQSSFGQGISVTQ
FT                   TQMLRAFTAIANDGVMLEPKFISAIYDTNNQSVRKSQKEIVGNPVSKEAASTTRNHMIL
FT                   VGTDPLYGTMYNHYTGKPIITVPGQNVAVKSGTAQIADEKNGGYLVGSTNYIFSVVTMN
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFATPILERASAMKDSLNLQTTAKALEQVSQQSP
FT                   YPMPSVKDISPGDLAEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKVE
FT                   EVPDMYGWTKETAETLAKWLNIELEFQGSGSTVQKQDVRANTAIKDIKKITLTLGD"
FT   gene            361520..362500
FT                   /gene="mraY"
FT                   /locus_tag="SP670_0406"
FT   CDS_pept        361520..362500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SP670_0406"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90481"
FT                   /protein_id="ADM90481.1"
FT                   /translation="MFISISAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLITSVLVAFFFALFSSQFSNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGVIFYLFYERGGDMLSVFGYQVHLGIFYIVFALFWLVGFSNA
FT                   VNLTDGVDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLSFFIFNHKPAKIF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
FT   gene            362698..362814
FT                   /locus_tag="SP670_0407"
FT   CDS_pept        362698..362814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90482"
FT                   /protein_id="ADM90482.1"
FT                   /translation="MVDRTDEVSSKHGFEVVDKEKLMWFEEVFEECKKILVS"
FT   gene            363095..365200
FT                   /locus_tag="SP670_0408"
FT   CDS_pept        363095..365200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0408"
FT                   /product="ATP-dependent protease ATP-binding subunit ClpL"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90483"
FT                   /protein_id="ADM90483.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEFA
FT                   HYRATGQLPGNAETDVQMPQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   TSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFNILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELERKIENHTEDMKVTASVNDVAESVERMTGIPVSQMG
FT                   ASDIERLKDMAHRLQDKVIGQDKAVEVVARAIRRNRAGFDEGNRPIGSFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLNPFFRPELLNRFNAVIEFSHLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMEDGV
FT                   LVIREKA"
FT   gene            complement(365496..365978)
FT                   /gene="luxS"
FT                   /locus_tag="SP670_0409"
FT   CDS_pept        complement(365496..365978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SP670_0409"
FT                   /product="S-Ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90484"
FT                   /protein_id="ADM90484.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI"
FT   gene            complement(366073..367557)
FT                   /locus_tag="SP670_0410"
FT   CDS_pept        complement(366073..367557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90485"
FT                   /protein_id="ADM90485.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYTGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISSKGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPVWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIVTGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            367710..369320
FT                   /locus_tag="SP670_0411"
FT   CDS_pept        367710..369320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0411"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90486"
FT                   /protein_id="ADM90486.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNGDGVGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIAAIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENTDSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLVRADFELLDTADKVFAYIRKDGDRRFLVVANLSNDKQNFSVDGKVRSVLIENTAAKE
FT                   VLEKQVLAPWDAFCVEMTD"
FT   gene            complement(369420..369761)
FT                   /locus_tag="SP670_0412"
FT   CDS_pept        complement(369420..369761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0412"
FT                   /product="transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90487"
FT                   /protein_id="ADM90487.1"
FT                   /translation="MLNQAFTEKHYENTILHSDQGWQYQHDFYHRFLESKGIQPSMSRK
FT                   GNSPDNGMMESFFGILKSEMFYGYEKNFRSLENLEQAIVDYIDYYNNKRIKVKLKGLSP
FT                   VQYRTKSFG"
FT   gene            complement(369776..370258)
FT                   /locus_tag="SP670_0413"
FT   CDS_pept        complement(369776..370258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90488"
FT                   /protein_id="ADM90488.1"
FT                   /translation="MVSGGFRLDFLLETARLARSTYYYQLKQLDGVDKDKEIKTEIQAI
FT                   YNEHKGNYGYRRIHLELRNRGFVVNHKKVQRLMKVLGLTARIRRKRKYSSYQGEIGKKA
FT                   ENLIQRQFEATKPMEKCYTDVTEFAIPNSTQKLYLSPVLDGFNSEISPIIFQLHQT"
FT   gene            complement(370234..370770)
FT                   /locus_tag="SP670_0414"
FT   CDS_pept        complement(370234..370770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0414"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90489"
FT                   /protein_id="ADM90489.1"
FT                   /translation="MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNLRYMIKLIDRY
FT                   GIEFVKKGKNQYYSPELKQEMIDKVLHANWSQDRVSLKYALPNRGMLPNWLAQYKKNGY
FT                   TIVEKTRGRPAKMERKRKKTWEEMTELERLQEENERLRTEVAYLKKLKELEERDEALER
FT                   ERQKQLEKWFQEDFD"
FT   gene            complement(370839..371789)
FT                   /locus_tag="SP670_0415"
FT   CDS_pept        complement(370839..371789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0415"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90490"
FT                   /protein_id="ADM90490.1"
FT                   /translation="MNSIRKTLNKNQNKKKKDASISLHKPIRGNSHLSNNIFIKIKRIM
FT                   KSLKEDFSVRAEKYENYQETFQGPNSFSKTDPDATFMRMKEDHMKNGQLKAAYNLQIAT
FT                   ENQFVLHYDVFSNPTDTKTLLPFLETYPHDLKTVVADAGYGSEENLLRLDEKEVNHLIK
FT                   YAMFDKEQKRGYKQSARNLANWHYNDKEDSYTHPDGWYYRFHHTKHQKTQTDFQQEIKV
FT                   YYADEPESAPQKGLYMNEGYQNLKAKECQALLSPQGRQIFAQRKIDVEPVFGQIKACLG
FT                   YKRCNLRGKRQVRIDMGLVLMANNLLKYNKRTTQN"
FT   gene            complement(371954..373006)
FT                   /locus_tag="SP670_0416"
FT   CDS_pept        complement(371954..373006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0416"
FT                   /product="transposase for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90491"
FT                   /protein_id="ADM90491.1"
FT                   /translation="MNETKKYLVIKAIAQGKKTKKRACVELNLSERQINRLLLAYQQKE
FT                   KEAFRHGNRNRKPKHAIPDEIKERILKKYLSYQTYKPNVRHFCELLAEEEGIQLSDTTV
FT                   RKILYKKNILSPKSHRKTKKRVRKQAKLNPKQPLDNPILPTAENFLEDPKKVHPSRPRK
FT                   KFAGELIQMDASPHAWFGVETSNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILAN
FT                   HGIPLQIKTDKRTVFTYQASNSKKMEDDTHTQFGYACHQLGILLETTSIPQAKGRVERL
FT                   NQTLQSRLPIELERNNIHTLEEANTFLPSYIQTFNEQFGNKTKLSVFEEAPKPSERNLI
FT                   LARLAGESRR"
FT   gene            373183..374628
FT                   /locus_tag="SP670_0417"
FT   CDS_pept        373183..374628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0417"
FT                   /product="integral membrane regulatory protein Wzg"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90492"
FT                   /protein_id="ADM90492.1"
FT                   /translation="MSRRFKKSGSQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAFR
FT                   YLNLVATAFVLLVALIGLLSIIYKKAEKFTIFLLVLSILVSSVSLFAVQQFVGLTNRLN
FT                   ATSNYSEYSLSVAVLADSEIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNIDLTVNQ
FT                   SSSYLSAYRSLIAGETKAIVLNSVFENIIESEYPDHASKIKKIYTKGFIKKVEAPKTSK
FT                   NQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADGGNNQK
FT                   DKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKLIDLLGGVDVYNDQEFTALA
FT                   NKKHYSIGNVHLDSEEALAFVRERYSLADGDRDRGRNQQKVIVAILQKLTSTEVLKNYS
FT                   TIIDSLQDSIQTNMPLETMINLVNAQLESGGTYKVNSQDLKGRGRTDLPSYAMPDSNLY
FT                   VMEINDSSLASVKTAIQDVLEGR"
FT   gene            374630..375361
FT                   /locus_tag="SP670_0418"
FT   CDS_pept        374630..375361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0418"
FT                   /product="tyrosine-protein phosphatase CpsB"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90493"
FT                   /protein_id="ADM90493.1"
FT                   /translation="MIDIHSHIVFDVDDGPKSREESKALLTEAYRQGVRTIVSTSHRRK
FT                   GMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLENNRIPTLNNSRY
FT                   ALIEFSMNTPYRDIHSALNKILMLGITPVIAHIERYDVLENNEKRVRELIDMGCYTQIN
FT                   SSHVLKSKLFGEPYKFMKKRAQYFLERDLVHIIASDMHNVDGRPPHMAEAYDLVSQKYG
FT                   EAKAQELFIDNPRKIVMDQLI"
FT   gene            375370..376062
FT                   /locus_tag="SP670_0419"
FT   CDS_pept        375370..376062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0419"
FT                   /product="Cps19aC"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90494"
FT                   /protein_id="ADM90494.1"
FT                   /translation="MKEQNTIEIDVFQVLKTLWKHKLIILLVALVTGAGAFAYSTFIVK
FT                   PEYTSTTRIYVVNRNQEGKSGLTNQDLQAGTYLVKDYREIILSQDVLEKVATNLKLDMP
FT                   AKALTSKVQVTVPTDTRIVSISVKDKEPEEASRIANSLREVAAGKIVAVTRVSDVTTLE
FT                   EARPATTPSSPNVRRNTLVGFLGGAVVTVITVLLIELLDTRVKRPEEVEEVLQVPLLGV
FT                   VPDLDKMK"
FT   gene            376072..376752
FT                   /locus_tag="SP670_0420"
FT   CDS_pept        376072..376752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0420"
FT                   /product="tyrosine-protein kinase CpsD"
FT                   /EC_number="2.7.10.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90495"
FT                   /protein_id="ADM90495.1"
FT                   /translation="MPTLEISQVKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKP
FT                   GEGKTTTSTNIARAFARAGYKTLLIDADMRNSVMSGVFKSRERITGLTEFLSGTTDLSQ
FT                   GLCDTNIENLFVIQAGSVSPNPTALLQSRNFSTMLETVRKYFDYIVVDTAPVGVVIDAA
FT                   IITQKCDASILVTKAGETKRRDIQKAKEQIEQTGKPCLGVVLNKFDTSVDEYGSYGSYG
FT                   KKKK"
FT   gene            376767..378134
FT                   /locus_tag="SP670_0421"
FT   CDS_pept        376767..378134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0421"
FT                   /product="galactosyl transferase CpsE"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90496"
FT                   /protein_id="ADM90496.1"
FT                   /translation="MNGKLVKPSLAIVQSFLVILLAYLLSTVRETEIVSTTAIVLYILH
FT                   YFAFYISDYGQDFFKRGYLIELVQTLKYILFFALAISISNFFLEDRFSISRRGMIYFLL
FT                   LHVFLVYVLNRFIKWYWKRAYPNFKGSKKILLLTATSRVEKVLDRLIESDDVVGELVAV
FT                   SVLDKPDFQHDYLKVVAEGEIVNFATHEVVDEVFINLPSEKYNIGELVSQFETMGVDVT
FT                   VNLNAFDCILAHNKQICEMAGLNVVTFSTTFYKTSHVIAKRVIDIIGSLVGLILCGLVS
FT                   IVLVPLIRKDGGSAIFAQTRIGKNGRHFTFYKFRSMCVDAEEKKRELMEQNTMQGGMFK
FT                   VDEDPRITKIGHFIRKTSLDELPQFYNVLKGDMSLVGTRPPTVDEYEHYTPEQKRRLSF
FT                   KPGITGLWQVSGRSEIKNFDEVVKLDVAYIDGWTIWKDIEILLKTVKVVLMKDGAK"
FT   gene            378263..379207
FT                   /locus_tag="SP670_0422"
FT   CDS_pept        378263..379207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0422"
FT                   /product="putative galactosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90497"
FT                   /protein_id="ADM90497.1"
FT                   /translation="MDIVYATDNNFVDVLSASIKSLYTTNSDLDLNLWIIADKVSDRNK
FT                   EKINRLSKQFAQREINWIENVEIPFKLHLDRGSISSFSRLFLGSVLPSSMSKVLYLDSD
FT                   IIVMDSLRSILDIDFKDKILYGVNDTFNKEYKQVLGIPIDKPMFNAGVMLINLELWRNN
FT                   NVEEKFLQVIQKFNGTILQGDLGVLNAVLYNSFGVLPPEYNYMTIFEDLTYEEMIVFKK
FT                   PINYYSKEEIKNARERIVLRHFTTCFLSLRPWQENSEVAHVEIFKKYYRGTYKQVSPSK
FT                   LSRIYKILPKKMSLYLLGFIQSKVRPKLYRILK"
FT   gene            379244..379801
FT                   /locus_tag="SP670_0423"
FT   CDS_pept        379244..379801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0423"
FT                   /product="Cps6bQ"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90498"
FT                   /protein_id="ADM90498.1"
FT                   /translation="MKVQEKLKLLKEFIKICSKNKMKYFASGGSLLEAARYKGFIPWND
FT                   DMALGLPRKHFEKFINEIDFEKYNKNYILESSEMNLGIFQYKLKSAILILGKSYDVCLN
FT                   LFLLDRMSELVIDGESGFKVPLYNLEVAVDRSRSIIENRELANELGSVAFQRVQSIFEI
FT                   KEKVSELENIFMSLGEDDNVNI"
FT   gene            379788..380507
FT                   /locus_tag="SP670_0424"
FT   CDS_pept        379788..380507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0424"
FT                   /product="WciO"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90499"
FT                   /protein_id="ADM90499.1"
FT                   /translation="MSIYKLYKDIERKTMSPAKKAMAKNDYFAFYVGRPLSYLLTVPFL
FT                   KTNITPNQVSYLSIAPLILGFLTMTFTTNFILLLLAWFLFFLWNLLDGVDGNLARYREQ
FT                   YSKDGSVVDAMAGYVAMVLTYFGAGIVATHLNGSDMYVILGALSGISLIFPRLVMHKYI
FT                   NTVARNESVNNIKDKSNFSTIKLLALNMTSITGIPQVLLLVTILTNQWEFFTLVYFTIN
FT                   FLLMIFSLYSLFKKENV"
FT   gene            380510..381496
FT                   /locus_tag="SP670_0425"
FT   CDS_pept        380510..381496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0425"
FT                   /product="rhamnosyl transferase Cps6bS"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90500"
FT                   /protein_id="ADM90500.1"
FT                   /translation="MGKSVAILMTTYNGERYLSQQIDSIRSQTFTNWTLFIRDDGSKDK
FT                   TVEVIQRYSKIDDRIRLVENPSKFHGAYYNFFNLIEYVKNNYQFDYYFFCDQDDIWKEH
FT                   KLEIQLLRFSKDEMPEMVYSDMSTIDANNKLIDISINNIMGIELPNINNLYFIHAYIWG
FT                   CTAGFNHALLEMVPSVDIDKDYLYIEKLSHDNYFAKFALEYGKVLFCPEQLVLYRRHGH
FT                   NVTTSHHFKLSPLNILRKAILGFNELALTHAGVYNQTLYMLKKASEKSPLSDRLLEIQE
FT                   VIKIGGLKGVRYFCQNRISRKQLVRTIGLYTIMLFGTYKKYIMKELS"
FT   gene            381496..382839
FT                   /locus_tag="SP670_0426"
FT   CDS_pept        381496..382839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0426"
FT                   /product="oligosaccharide repeat unit polymerase Wzy"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90501"
FT                   /protein_id="ADM90501.1"
FT                   /translation="MLLNFLFIFIFLLIIITFILFEGDLFQPAVILTLAYFISIASALV
FT                   NRNVWGTELHFKTFGLILLGVATFIIVSLLTKLSYKPKVEGISYKELKEINPSKIIYGI
FT                   LLILNLVMLFLYIHEIQKVVLFSGRGFSNITDLISNYRYLSYYSNEVEDRVSGMINQLA
FT                   KIIPATTFVSLYIFINNYFITKQIKKNFIYLIPIAIFFVYAIISGGRLPLIRLVIGTLL
FT                   ILYIYSVYGSHKSQLTRSFKMITRSLFAFLMLIVLFFLLKFVLGRSSQEDFISYITRYM
FT                   GGSIQLFDLFVIDPIRRNKELGAETFSGIYEMLAKLGFDNNIIKGLEWRISPNYYSLGN
FT                   VYTAIRRYYSDFGVIGIVICQSFTAWLYTLGYEKIRHHSLVTNGQRFRLILLAASFYPL
FT                   FLNSIEDVFYISMVTIGYGIQIVIFYLVFWVLLKVQVDFNKGKLRINR"
FT   gene            382973..384385
FT                   /locus_tag="SP670_0427"
FT   CDS_pept        382973..384385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0427"
FT                   /product="Wzx"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90502"
FT                   /protein_id="ADM90502.1"
FT                   /translation="MKLKFLITNLFHVLLSNLITILTSVIVVLILPKIMGVTEYSYWQL
FT                   YIFYLTYIGFFHLGWIDGIYLKYGGLEYQNLDKKQFYSQILQFSSFLILISFLLFGFNL
FT                   LTVTDQNAKYIYNMTIISMIVTNLRMLFVYILQMTNRLKDSSIILISDRVIYVILLFLF
FT                   IIFKWHEYKVMIWADVLGRTFSLLLSFWICKDIVFQSLSEFILDLRESFDNIRVGINLM
FT                   LSNIASSMIIGIVRMGIQWNWNIETFGKVSLTLSISNLLMTFINAIGLVVFPLLKRTKT
FT                   ENLSKIYSNLRNVLMLIMFAILLIYYPLKIVLDLWLPAYQDALIFMTLIFPMSVYEGKM
FT                   ALVINTYLKALRMERDILKINTLIMLFSMLVTLITTLLLNSLELTVVSIVVLLALRSVI
FT                   AELILSKKLDVSVKKDIVLEFLLTIVFISSSWYLPIWPAVIVYLLAYTLYLYLKRKDIK
FT                   MYIEYFRKKIFE"
FT   gene            384997..385743
FT                   /gene="rfbA"
FT                   /locus_tag="SP670_0428"
FT   CDS_pept        384997..385743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="SP670_0428"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90503"
FT                   /protein_id="ADM90503.1"
FT                   /translation="MLAGIKDILIISTPQDLPRFKDLLLDGSEFGIKLSYAEQPSPDGL
FT                   AQAFLIGEEFIGDDSVALILGDNIYHGPGLSKMLQKAAQKEKGATVFGYQVKDPERFGV
FT                   VEFDTDMNAISIEEKPENPRSNYAVTGLYFYDNDVVEIAKGIKPSARGELEITDINKAY
FT                   LNRGDLSVELMGRGFAWLDTGTHESLLEASQYIETVQRMQNVQVANLEEIAYRMGYISC
FT                   EDVLELAQPLKKNEYGQYLLRLIGEA"
FT   gene            385744..386340
FT                   /locus_tag="SP670_0429"
FT   CDS_pept        385744..386340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0429"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90504"
FT                   /protein_id="ADM90504.1"
FT                   /translation="MSDNFFGKTLAVRKIDAIPGLLEFDIPVHGDNRGWFKENFQKEKM
FT                   EPLGFPESFFAAGKLQNNVSFSRKNVLRGLHAEPWDKYISVADDGKVLGSWVDLREGET
FT                   FGNTYQTVIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPS
FT                   LGIEWENIAEAEVSEADKNHPLLKDVKPLKKEDLE"
FT   gene            386350..387399
FT                   /gene="rfbB"
FT                   /locus_tag="SP670_0430"
FT   CDS_pept        386350..387399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="SP670_0430"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90505"
FT                   /protein_id="ADM90505.1"
FT                   /translation="MTEYKNIIVTGGAGFIGSNFVHYVYENFPDVHVTVLDKLTYAGNR
FT                   ANIEEILGNRVELVVGDIADAELVDKLAAQADAIVHYAAESHNDNSLNDPSPFIHTNFI
FT                   GTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETKYNPSSPYSS
FT                   TKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILSGIKPKLYGEGK
FT                   NVRDWIHTNDHSSGVWTILTKGQIGETYLIGADGEKNNKEVLELILKEMGQAADAYDHV
FT                   TDRAGHDLRYAIDASKLRDELGWKPEFTNFEAGLKATIKWYTDNQEWWKAEKEAVEANY
FT                   AKTQEIITV"
FT   gene            387465..388316
FT                   /gene="rfbD"
FT                   /locus_tag="SP670_0431"
FT   CDS_pept        387465..388316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="SP670_0431"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90506"
FT                   /protein_id="ADM90506.1"
FT                   /translation="MILITGANGQLGTELRYLLDERNEEYVAVDVAKMDITNEEMVEKV
FT                   FEEVKPTLVYHCAAYTAVDAAEDEGKELDFAINVTGTKNVAKASEKHGATLVYISTDYV
FT                   FDGKKPVGQEWEVDDRPDPQTEYGRTKRMGEELVEKHVSNFYIIRTAWVFGNYGKNFVF
FT                   TMQNLAKTHKTLTVVNDQYGRPTWTRTLAEFMTYLAENRKEFGYYHLSNDATEDTTWYD
FT                   FAVEILKDTDVEVKPVDSSQFPAKAKRPLNSTMSLAKAKATGFVIPTWQDALQEFYKQE
FT                   VR"
FT   gene            388515..388826
FT                   /locus_tag="SP670_0432"
FT   CDS_pept        388515..388826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0432"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90507"
FT                   /protein_id="ADM90507.1"
FT                   /translation="MGLPITRKEISNWHIKASQYYLESLYNLLREKLLEQPLLHADETS
FT                   YRVLESDSHLTYYWTFLSGKAENQAITLYHHDQRRSGLVVQEFLGDYSGYVHCDMLRQ"
FT   gene            388899..389156
FT                   /locus_tag="SP670_0433"
FT   CDS_pept        388899..389156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0433"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90508"
FT                   /protein_id="ADM90508.1"
FT                   /translation="MVNCEPLEAYRQLEEAELVGCWAHVRRKFFEATPKQADKSSLGAK
FT                   GLAYCDQLFSLERDWEALPADERLQKRQEHLQPLMEDFFA"
FT   gene            389419..389577
FT                   /locus_tag="SP670_0434"
FT   CDS_pept        389419..389577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0434"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90509"
FT                   /protein_id="ADM90509.1"
FT                   /translation="MSLLETAKRHQLNSEKYLFYLLECLPNEETLVNKEVLEAYLPWTK
FT                   VVQEKCK"
FT   gene            389776..391758
FT                   /locus_tag="SP670_0435"
FT   CDS_pept        389776..391758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0435"
FT                   /product="oligopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90510"
FT                   /protein_id="ADM90510.1"
FT                   /translation="MKSSKLFALAGVTLLAATTLAACSGSGSSTKGEKTFSYIYETDPD
FT                   NLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKW
FT                   YTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIKA
FT                   LDDQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLLK
FT                   SIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSA
FT                   SFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQ
FT                   AIAFGFDRTAYASQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVTYGDEWKD
FT                   VNLADSQDGLYNPEKAKAEFAKAKSALQAEGVQFPIHLDMPVDQTATTKVQRVQSMKQS
FT                   LEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDII
FT                   KPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDETTDVAKRYDKYAAAQAWL
FT                   TDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQK
FT                   AQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            392059..397371
FT                   /locus_tag="SP670_0436"
FT   CDS_pept        392059..397371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0436"
FT                   /product="endo-alpha-N-acetylgalactosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90511"
FT                   /protein_id="ADM90511.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGRDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWQTVEKKEQKGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVDANGNATVDLTFKEDSEKGKSRFGVFLKFKDTKNNVFVGYDKDGWFWEYK
FT                   TPGNSTWYKGNRVAAPEPGSVNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGTYGNDRTVVSVKTDNQEGVKADDTPAQKETGPVVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYTLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKLRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISFLGNALVSV
FT                   SSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITE
FT                   DANADKKVDWQDGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDADNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLPTDKEKMYYFNTQ
FT                   TGATTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRDN
FT                   ATVDDTSYFQNMYAFFTTGSDVSNVTLTLSREAGDQATYFDEIRTFENNSSMYGDKHDT
FT                   GKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGKMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIEALKNALVQKKTALVADDFESLDAPAQPGEGLENAFDGNVSSLW
FT                   HTSWNGGDVGKPATMVLKEPTEITGLRYVPRGSGSNGNLRDVKLVVTDESGKEHTFTAT
FT                   DWPDNNKPKDIDFGKTIKVKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALAKAQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKPD
FT                   APIVEKPEFKLRSLASVQGKTPDYKQEIDRPDRPETPEQILPATGESQSDTALFLAGVS
FT                   LALSALFVVKTKKD"
FT   gene            complement(397538..399697)
FT                   /locus_tag="SP670_0437"
FT   CDS_pept        complement(397538..399697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0437"
FT                   /product="penicillin-binding protein 1a"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90512"
FT                   /protein_id="ADM90512.1"
FT                   /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSES
FT                   KLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDSI
FT                   RILGAFLRNLQSNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATK
FT                   QEILTYYINKVYMSNGNYGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVIN
FT                   QVEQETGYNLLTTGMDVYTNVDQEAQKHLWDIYNSDQYVSYPDDDLQVASTVVDVSNGK
FT                   VIAQLGARHQASNVSFGTNQAVETNRDWGSAMKPITDYAPAIEYGVYDSTATMVNDIPY
FT                   NYPGTSTPVYNWDRAYFGNITLQYALQQSRNVTAVETLNKVGLDRAKTFLNGLGIDYPS
FT                   MHYANAISSNTTESNKQYGASSEKMAAAYAAFANGGIYHKPMYINKVVFSDGSKKEFSD
FT                   VGTRAMKETTAYMMTEMMKTVLAYGTGRGAYLPWLAQAGKTGTSNYTDDEIEKHIKNTG
FT                   YVAPDEMFVGYTRKYSMAVWTGYSNRLTPIVGDGFLVAAKVYRSMITYLSEDTHPEDWT
FT                   MPDGLFRNGEFVFKNGARSTWNSPAPQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   DPNNNTQQSNTTPDQQNQNPQPAQP"
FT   gene            complement(399694..400290)
FT                   /gene="recU"
FT                   /locus_tag="SP670_0438"
FT   CDS_pept        complement(399694..400290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SP670_0438"
FT                   /product="recombination protein U"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90513"
FT                   /protein_id="ADM90513.1"
FT                   /translation="MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEAKETKQKR
FT                   AIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQKSMP
FT                   LGYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            400356..400883
FT                   /locus_tag="SP670_0439"
FT   CDS_pept        400356..400883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90514"
FT                   /protein_id="ADM90514.1"
FT                   /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSW
FT                   LVFTGSLGFEYWVLEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDFVK
FT                   YAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRLTFD
FT                   QLNELAENFSEN"
FT   gene            400953..401282
FT                   /locus_tag="SP670_0440"
FT   CDS_pept        400953..401282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0440"
FT                   /product="cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90515"
FT                   /protein_id="ADM90515.1"
FT                   /translation="MASIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAAL
FT                   VKSLRQEIADLKEELTRKPKPSPVQAEPLEAAITSSMTNFDILKRLNRLEKEVFGKQIL
FT                   DNSDF"
FT   gene            401768..402925
FT                   /locus_tag="SP670_0441"
FT   CDS_pept        401768..402925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0441"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90516"
FT                   /protein_id="ADM90516.1"
FT                   /translation="MKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVRA
FT                   IIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPG
FT                   LRRSFAFEEWNWISDRLIQEVRTEAAKKVERKLELDIMGCDIDARMVEIAKANAQAAGV
FT                   AGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLKTWSKF
FT                   ILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            402938..404332
FT                   /locus_tag="SP670_0442"
FT   CDS_pept        402938..404332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90517"
FT                   /protein_id="ADM90517.1"
FT                   /translation="MSKKRRNRQKKEGQEPQFDFDEAKELTVGQAIRKNEEVEAGVLPE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEVPS
FT                   SEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGFILT
FT                   VLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTDSNKTAL
FT                   KNSQFDKLSQLKTLLDKLEGSREHTLAKSKYDSLVTQIKVIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSSQASSNT
FT                   TSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            404408..405832
FT                   /gene="gnd"
FT                   /locus_tag="SP670_0443"
FT   CDS_pept        404408..405832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SP670_0443"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90518"
FT                   /protein_id="ADM90518.1"
FT                   /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIAC
FT                   HPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGNTF
FT                   YKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVSDVLEEISAKA
FT                   PEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAEIFTE
FT                   WNKGELDSYLIEITADILSRKDDEDQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPLS
FT                   LITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQG
FT                   FAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLD
FT                   VTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQ
FT                   RKDKEGTFHYSWYDEK"
FT   gene            405844..406533
FT                   /locus_tag="SP670_0444"
FT   CDS_pept        405844..406533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0444"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90519"
FT                   /protein_id="ADM90519.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VFIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            406632..407654
FT                   /locus_tag="SP670_0445"
FT   CDS_pept        406632..407654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0445"
FT                   /product="choline binding protein C"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90520"
FT                   /protein_id="ADM90520.1"
FT                   /translation="MKLLKKMMPIALAVFFFGLLATSTVFADTMGGRFVDKDNRKYYVK
FT                   DDHKAIYWHKIDGKTYYFGDIGEMVVGWQYLEIHGTGYRDDLFDNRPVFEIGLQEKWYY
FT                   FGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKKTYYFDNNYAVKTGWIYEDGN
FT                   WYYLNKLGNFGDDSYNPLPIGEVAKGWTQDFHVTIDIDRSKPAPWYYLDASGKMLTDWQ
FT                   KVNGKWYYFGSSGSMATGWKYVRGKWYYLDNKNGDMKTGWQYLGNKWYYLRSSGALVTG
FT                   WYQDGSTWYYLDAENGDMKIGWTKVNGKWYYLNSSGAMVTGSQTIDGKVYNFASSGEWI
FT                   "
FT   gene            407673..408671
FT                   /locus_tag="SP670_0446"
FT   CDS_pept        407673..408671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0446"
FT                   /product="choline binding protein J"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90521"
FT                   /protein_id="ADM90521.1"
FT                   /translation="MKLLKKTMQAGLTVIFFGLLATNTVFADNSEGWQFVQENGRTYYK
FT                   KGDLKETYWRVIDGKYYYFDSLSGEMVVGWQYIPFPSKGSTIGPYPNGIRLEGFPKSEW
FT                   YYFDKNGVLQEFVGWKTLEIKTKDSVGRKYGEKREDSEDKEEKRYYTNYYFNQNHSLET
FT                   GWLYDQSNWYYLAKTEINGENYLGGERRAGWINDASAWYYLDPTTGIMQTGWQHLGNKW
FT                   YYLRSSGAMATGWYQEGTTWYYLDQPNGDMKTGWQYLGNKWYYLCSSGAMVTGWYQDGL
FT                   TWYYLNAGNGDMKTGWFQVNGKWYYAYSSGALAVNTTVDGYYVNYNGEWVR"
FT   gene            complement(408789..410021)
FT                   /locus_tag="SP670_0447"
FT   CDS_pept        complement(408789..410021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0447"
FT                   /product="transporter, major facilitator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90522"
FT                   /protein_id="ADM90522.1"
FT                   /translation="MKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQYNFAPLAI
FT                   LLISISEMVPLLSQLFLGILGDFQENRVKHALWIAKIKILLYAILTVFLVLSPFSLVSV
FT                   IMIVIINLISDTLSYLSAYMMNALYISVIKDDLHDAMGFRQSLMRVVRIVANLAGAFLI
FT                   NVISIQTISLINTLTFVIAFLGLYVIRHTLYEVEKRIEMSHTALSFKKYFQHLKQSLAV
FT                   LLRLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLALLSIIMSCGAIL
FT                   GNMTSSNLFKNIRFTHLLVFCEISLLTLITSILCQAYIVIFMTSFISSTIIGILSPRLQ
FT                   AAVFAHIPSDKMGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLYLILIALIF
FT                   CQWLVKFNTHN"
FT   gene            complement(410064..410888)
FT                   /locus_tag="SP670_0448"
FT   CDS_pept        complement(410064..410888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90523"
FT                   /protein_id="ADM90523.1"
FT                   /translation="MTIRTTHTYKYQYSLLFGDAGYLWLLLHLFSISKNQYYLQLANVT
FT                   AKKLIENYDTLEEIDFALGKSGVLLSLIKYYQFTNDNTLKIFIHNSIGEIYHYFLQRDT
FT                   AKESILDYSFAHGYCGIAYALFAYSKVLEPSMFYNDLHTFHTELKKLLEKVTSNTENLG
FT                   NLQLSWCKGISGIILYLCMYDCDGNKDIISKYQEFVFNHHLKMMTGYCHGITSLLQTTV
FT                   YNQNKLLMKKIQQVILACSERDDHGLLMFQGDSGKADLFDFGIGSMGYIGVY"
FT   gene            412003..412881
FT                   /gene="mvk"
FT                   /locus_tag="SP670_0449"
FT   CDS_pept        412003..412881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="SP670_0449"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90524"
FT                   /protein_id="ADM90524.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPA
FT                   ESPWRLYEEDTLSMAVYASLEYLDITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSPEADFLVETTLSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            412863..413816
FT                   /gene="mvaD"
FT                   /locus_tag="SP670_0450"
FT   CDS_pept        412863..413816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SP670_0450"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90525"
FT                   /protein_id="ADM90525.1"
FT                   /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTE
FT                   TTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGL
FT                   SSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPV
FT                   ETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDF
FT                   AKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNV
FT                   KVFCQEKDLEHLSEIFGQRYRLIVSKTKDLSQDDCC"
FT   gene            413803..414810
FT                   /locus_tag="SP670_0451"
FT   CDS_pept        413803..414810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0451"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90526"
FT                   /protein_id="ADM90526.1"
FT                   /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLKICGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFFISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLSSSKETVVSLVEALEQGKAEKVIEQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQAVAKSSGAGGGDCGIALSFDAQSTETLKNRWADLGIELLYQERIGHDDKS"
FT   gene            414794..415804
FT                   /gene="fni"
FT                   /locus_tag="SP670_0452"
FT   CDS_pept        414794..415804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SP670_0452"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90527"
FT                   /protein_id="ADM90527.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAESCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYIKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEAKDQMKKA"
FT   gene            415882..416580
FT                   /locus_tag="SP670_0453"
FT   CDS_pept        415882..416580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90528"
FT                   /protein_id="ADM90528.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            416577..417572
FT                   /locus_tag="SP670_0454"
FT   CDS_pept        416577..417572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0454"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90529"
FT                   /protein_id="ADM90529.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSITCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVADPDLDASFKSLS
FT                   GKLNLLTEALQKAENHSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQIQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFRLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            417586..418218
FT                   /locus_tag="SP670_0455"
FT   CDS_pept        417586..418218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0455"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90530"
FT                   /protein_id="ADM90530.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF"
FT   gene            418219..418365
FT                   /locus_tag="SP670_0456"
FT   CDS_pept        418219..418365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0456"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90531"
FT                   /protein_id="ADM90531.1"
FT                   /translation="MSLADLLEELEAAKDSKKARSMEAYMRHQFSFLGIAVPERNKLYK
FT                   NIY"
FT   gene            418443..418697
FT                   /locus_tag="SP670_0457"
FT   CDS_pept        418443..418697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0457"
FT                   /product="DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90532"
FT                   /protein_id="ADM90532.1"
FT                   /translation="MAANYLKAMQSYLKETDLPKLEQLVVTKSWWDTVDILDRVVGSLV
FT                   YEHPELEEIILILFENLFKPRQLYLQPQNSVLSNLRLAS"
FT   gene            418812..418988
FT                   /locus_tag="SP670_0458"
FT   CDS_pept        418812..418988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0458"
FT                   /product="DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90533"
FT                   /protein_id="ADM90533.1"
FT                   /translation="MEKILLHNLNQTEFFINKAIGWTLRAYSKTNPTWVACFIDENKER
FT                   MAELSIKEASKYL"
FT   gene            419138..419377
FT                   /locus_tag="SP670_0459"
FT   CDS_pept        419138..419377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90534"
FT                   /protein_id="ADM90534.1"
FT                   /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   EKGPGSNDSSLSEISPTYGSYYQKQSEVLSVMMI"
FT   gene            419458..420283
FT                   /pseudo
FT                   /locus_tag="SP670_0461"
FT   CDS_pept        419458..420283
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0461"
FT                   /note="choline binding protein G, unverified frameshift"
FT   gene            420302..421324
FT                   /locus_tag="SP670_0462"
FT   CDS_pept        420302..421324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0462"
FT                   /product="choline binding protein F"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90535"
FT                   /protein_id="ADM90535.1"
FT                   /translation="MKLFKKMMQVVLATFFFGLLGTSTVCADDSEGWQFVQENGRTYYK
FT                   KGDLKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRQEIAFRPDWFYF
FT                   GQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSPAEKRVYYFEDQRSYHTLKTGWVYDD
FT                   GDWYYLQKDGGFDSRINRLTVGELARGWVKDYPLTYDEEKLKPAPWYYLDPATGIMQTG
FT                   WQHLGNKWYYLRSSGAMATGWYQDGSTWYYLDAENGDMKTGWQNLGNKWYYLRSSGAMA
FT                   TGWYQEGSTWYYLNASNGDMKTGWFQVNGNWYYAYDSGALAVNTTVGGYYLNYNGEWVK
FT                   "
FT   gene            complement(421454..422287)
FT                   /locus_tag="SP670_0463"
FT   CDS_pept        complement(421454..422287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0463"
FT                   /product="integrase core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90536"
FT                   /protein_id="ADM90536.1"
FT                   /translation="MTEFLLVLLLKSIKLARWTYYYHLKQLDKTDKDQELKAEIQSIFI
FT                   EHKGNYAYRRVHLELRNRAYLVNHKRVQGLIKVLNLQAKMRQKRKYSSHKGDVGKKAEN
FT                   LIQGQFEGSKTMEKCYTDVTEFAIPASTQKLYLPPVLDGFNSEIIAFNLSCSPNLEQVQ
FT                   TMLEQAFKEKHYENTILHSDQGWQYQHDSYHRFLESKGIQASMSRKGNSPDNGMMESFF
FT                   GILKSEMFYGYEKSFQSFKQLEQAIIDYIDYYNNKRIKVKLKGLIPVQYRTKSFG"
FT   gene            complement(422287..422454)
FT                   /locus_tag="SP670_0464"
FT   CDS_pept        complement(422287..422454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90537"
FT                   /protein_id="ADM90537.1"
FT                   /translation="MGRKPKTIPEERTELERLQAENEYLRAENAILKKLRELRLKEEKE
FT                   KEERQKLFKN"
FT   gene            complement(422590..422802)
FT                   /locus_tag="SP670_0465"
FT   CDS_pept        complement(422590..422802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0465"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90538"
FT                   /protein_id="ADM90538.1"
FT                   /translation="MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNLRYMIKLIDRY
FT                   GIEFGKKGKNRYYSPDLKQEMIYKV"
FT   gene            423011..424780
FT                   /locus_tag="SP670_0466"
FT   CDS_pept        423011..424780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0466"
FT                   /product="PTS system mannitol-specific EIIBC"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90539"
FT                   /protein_id="ADM90539.1"
FT                   /translation="MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYL
FT                   PNEQLATVVGPMLTYLLPILIGYTGGYMIHGQRGAVVGAIATVGAITGSSVPMFIGAMV
FT                   MGPLGGWTIKKFDEKFQEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTVAV
FT                   GNGVEAIVNARLLPMANIIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEAN
FT                   PGPGLGILLAYAVFGKGSAKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGIS
FT                   GTFTFQLLDAGLKSPASPGSIIAIMATAPKGVWPHLNVLLGVLVAAVVSFLVAALILHA
FT                   DKSTEDSLEAAQAATQAAKAQSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGAS
FT                   ILRDKVKKAGLEIPVSNQAISNLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLAS
FT                   PRYDEIVASLTGAFPIAEIEGDIPTSAPVDSQEIDLNHIDAVVVAYGKAQGTATMGCET
FT                   IRAIFRNKNIRIPVSTAKISELGEFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVT
FT                   TPEYDKMAARMYK"
FT   gene            424867..426759
FT                   /locus_tag="SP670_0467"
FT   CDS_pept        424867..426759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0467"
FT                   /product="putative transcriptional regulator MtlR"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90540"
FT                   /protein_id="ADM90540.1"
FT                   /translation="MQDMTEILQVSSRTIYRTLSDLTDSMEQYGIEITKHGKYYILTGE
FT                   LDDLPTELEVLVEYSPQERQELITYRLLTESGFVTNEALQECTKVSNVTIIQDISDIDK
FT                   RLLDFDLKIERQKGYRISGDSVGKRRFLAILLTNCISVADFSTGNFGSFDILEADRTRL
FT                   ASQIVNKQLSGFPDMDARMKMFFAILLSLIGQEQNIENSPNTSKQALEISQKIFQTYSK
FT                   QTAQFYSIQEIIYFASILDELIIKRQDNPLFTEKFDGEFFYNISNLIDTVSMYTKIDFF
FT                   KDKVLFNFLFHHIRLSLGVPILFQGENLPESVQILVERNKFLYTVISLLVNDIFPKYLH
FT                   TEYEYGMIALHFISSLGRSPEIYPVRVLLLTDERRVTRDLLVSKIKSVAPFVELIDIQS
FT                   LVDYHSIDLSQYDYILSTKPLTNQEIDVISSFPTVKELLELQERLQYVQAHRTIVARDA
FT                   IAPEKSYDLQDYLISSSQLLSQFELVQLENNQSFEHTVEQIIQYQKNVSDRDYLTRKLL
FT                   SHFQNSPMAIPNTGLVLLHSQSSKVTTNSFTMFELKLPISALSMKREEEEVKRCLLMLM
FT                   SKEASEEARDLMTAISQSIIENHLYTEIYKTGNQSIIYQMLNTIFNEKIKKLEN"
FT   gene            426761..427198
FT                   /locus_tag="SP670_0468"
FT   CDS_pept        426761..427198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0468"
FT                   /product="mannitol-specific phosphotransferase EIIA"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90541"
FT                   /protein_id="ADM90541.1"
FT                   /translation="MKLEKHLIKLNKQFSNKEEAICYCGQVLYEGGYVNEDYIEAMIER
FT                   DKELSVYMGNFIAIPHGTDAAKKDVLKSGITVVQVPRGVDFGNVSNPQVATVLFGIAGI
FT                   GNEHLEIIQKISIFCADVDNVLKLADAQSKEEVLRLFDAVE"
FT   gene            427260..428396
FT                   /locus_tag="SP670_0469"
FT   CDS_pept        427260..428396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0469"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90542"
FT                   /protein_id="ADM90542.1"
FT                   /translation="MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKG
FT                   KYEIEIAQKGQSRIEVTNVAGINSKEHPEQVIEAIQRTDIITTAIGPNILPFIAELLAK
FT                   GIEARRVAGNTQALDVMACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRI
FT                   VPAQSHEDSLFVVVEPFNEWVVETKRLKNPDLRLEDVHYEEDLEPFIERKLFSVNSGHA
FT                   TSAYIGAHYGAKTILEALQNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHKVIIER
FT                   FENPFIVDEVSRVARTPIRKLGYNERFIRPIRELKELSLSYKNLLKTVGYAFDYRDVND
FT                   EESIRLGELLAKQSVKDVVIQVTGLDDQELIEQIVEYI"
FT   gene            428554..428712
FT                   /locus_tag="SP670_0470"
FT   CDS_pept        428554..428712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90543"
FT                   /protein_id="ADM90543.1"
FT                   /translation="MSLIFVVIYKVKEAGQKVFKIGKRQPIGCSKILIGCPLLWKALLD
FT                   FLLRLSF"
FT   gene            428765..428878
FT                   /locus_tag="SP670_0471"
FT   CDS_pept        428765..428878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90544"
FT                   /protein_id="ADM90544.1"
FT                   /translation="MDSGKIVEKNNAHQFFSRPREERTKQFWNEFFRMRSI"
FT   gene            429182..430465
FT                   /gene="tig"
FT                   /locus_tag="SP670_0472"
FT   CDS_pept        429182..430465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SP670_0472"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90545"
FT                   /protein_id="ADM90545.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDQKFGEEALYQDAMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VITAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAENG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKELATAKE
FT                   EAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(430513..432879)
FT                   /locus_tag="SP670_0473"
FT   CDS_pept        complement(430513..432879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0473"
FT                   /product="helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90546"
FT                   /protein_id="ADM90546.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGITGLSAKNREAFVSTLRLNYGTEMVLSKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLIRILEKGKQKSHDLETIQKHITTIEEELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDLRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSEESTIVTLASQIRQGILP
FT                   ADFTKKKADRSYFEIASGHIPATIEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQ
FT                   LMQDLLNPPQKDQLSFEAPQCHYRKRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTES
FT                   KQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNL
FT                   IYTAITRAKSKLILLGELQAFDYATQHIGTARKTYLIERFSDLLENVEEKQQAVSETVT
FT                   SSASEQSYILTEENWDSIPAMIGITDTDLKEIFGK"
FT   gene            complement(433007..433507)
FT                   /gene="lepB"
FT                   /locus_tag="SP670_0474"
FT   CDS_pept        complement(433007..433507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="SP670_0474"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90547"
FT                   /protein_id="ADM90547.1"
FT                   /translation="MDPTLADGEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPG
FT                   DTIRYENDKLYINDKETDEPYLADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQ
FT                   AFTVDVNYNTNFSFTVPEGEYLLLGDDRLVSSDSRHVGTFKAKDITGEAKFRFWPITRI
FT                   GTF"
FT   gene            complement(433625..434506)
FT                   /gene="rnhC"
FT                   /locus_tag="SP670_0475"
FT   CDS_pept        complement(433625..434506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="SP670_0475"
FT                   /product="ribonuclease hiii"
FT                   /EC_number="3.1.26.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90548"
FT                   /protein_id="ADM90548.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQEANRFSNPISLEEKAEGKYLA
FT                   VAVSSVITRDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLSFCAKLHF
FT                   KNTEKAKKRLER"
FT   gene            434671..434895
FT                   /locus_tag="SP670_0476"
FT   CDS_pept        434671..434895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90549"
FT                   /protein_id="ADM90549.1"
FT                   /translation="MEEIAKVATEKYQAIKEQMPSADDETIALLLAVNCLSTQLSREIE
FT                   FDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            434892..435440
FT                   /gene="cvpA"
FT                   /locus_tag="SP670_0477"
FT   CDS_pept        434892..435440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="SP670_0477"
FT                   /product="CvpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90550"
FT                   /protein_id="ADM90550.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPITTSWLKQIWVTNLIG"
FT   gene            435547..436092
FT                   /locus_tag="SP670_0478"
FT   CDS_pept        435547..436092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0478"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90551"
FT                   /protein_id="ADM90551.1"
FT                   /translation="MIKQIKAHLNKSIQSIIGQKVEFVKQDEQAFTRKRRLSLETMIRT
FT                   ILGMGGKSLSKELLDARLTVSNSAFVQRRYQIKPEAFYALFKEFTAPIPLNTDFPIFAA
FT                   DGSDICIPRNPMDTETSIQTQTDVKSYNLIHINALYDLTTGVYRDVSIQDKHAQHERLA
FT                   LIQMMEASPFRESSCYHG"
FT   gene            436085..436837
FT                   /locus_tag="SP670_0479"
FT   CDS_pept        436085..436837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0479"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90552"
FT                   /protein_id="ADM90552.1"
FT                   /translation="MDRGYESYNLMAHFQEKGWLYIIRIRDGKQSMPSSFNLPNTECFD
FT                   QKVSLKLSRKQTNQLKKLYRDFPNDYHFIPHNSIFDFLPETSRKQDPVTLYELPFRMVR
FT                   LEVEEGKYETLVTNTDYSVQELKNLYASRWGIETSFRDLKYSIGLVNFHAKKKGGILQE
FT                   IFARFTNFNFCRWVTSQVAIDSSHKKQRYKVCFSDAAYACRLFFNGSLSSLQLKNYLKK
FT                   QLSIIRPNRKYSRKIKAQSVVDFIYRVT"
FT   gene            437063..439399
FT                   /locus_tag="SP670_0480"
FT   CDS_pept        437063..439399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0480"
FT                   /product="MutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90553"
FT                   /protein_id="ADM90553.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLTSRELQS
FT                   FYANLENVSLEELALWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVYFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRVLKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDAFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            439742..441064
FT                   /locus_tag="SP670_0481"
FT   CDS_pept        439742..441064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0481"
FT                   /product="D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90554"
FT                   /protein_id="ADM90554.1"
FT                   /translation="MLELLKSIDDFAWGPPLLILLVGTGIYLTMRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSITESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYILGTL
FT                   TVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFST
FT                   VFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFI
FT                   ELDMVWIIADIVNALMALPNLIALLVLSPVVIAETKKYFDK"
FT   gene            441282..441830
FT                   /locus_tag="SP670_0482"
FT   CDS_pept        441282..441830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0482"
FT                   /product="macrophage infectivity potentiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90555"
FT                   /protein_id="ADM90555.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   EAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            441940..442839
FT                   /locus_tag="SP670_0483"
FT   CDS_pept        441940..442839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0483"
FT                   /product="exfoliative toxin A"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90556"
FT                   /protein_id="ADM90556.1"
FT                   /translation="MKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLWIYFL
FT                   ILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFSFLLD
FT                   LTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGFLLTF
FT                   YLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMILASQS
FT                   FFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLTETIICL
FT                   TILFFVLGAYLIWLRKKV"
FT   gene            complement(442920..444138)
FT                   /pseudo
FT                   /locus_tag="SP670_0484"
FT   CDS_pept        complement(442920..444138)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0484"
FT                   /note="seryl-tRNA synthetase, unverified frameshift"
FT   gene            complement(444352..444723)
FT                   /locus_tag="SP670_0486"
FT   CDS_pept        complement(444352..444723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0486"
FT                   /product="ManO"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90557"
FT                   /protein_id="ADM90557.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGCKISRHFEVFTDKGKFLFASKDSGAILKIARDKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(444726..446090)
FT                   /locus_tag="SP670_0487"
FT   CDS_pept        complement(444726..446090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0487"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90558"
FT                   /protein_id="ADM90558.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHTLATLP
FT                   IEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREIGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   gene            complement(446268..446423)
FT                   /locus_tag="SP670_0488"
FT   CDS_pept        complement(446268..446423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90559"
FT                   /protein_id="ADM90559.1"
FT                   /translation="MFHQGSFLFYKQFILFENLFKPRQLPSATSKQYFELTSASFLVCS
FT                   LIFIEC"
FT   gene            446415..447200
FT                   /locus_tag="SP670_0489"
FT   CDS_pept        446415..447200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0489"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90560"
FT                   /protein_id="ADM90560.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTGK"
FT   gene            447294..447728
FT                   /locus_tag="SP670_0490"
FT   CDS_pept        447294..447728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0490"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90561"
FT                   /protein_id="ADM90561.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            447728..448702
FT                   /locus_tag="SP670_0491"
FT   CDS_pept        447728..448702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0491"
FT                   /product="beta-ketoacyl-acyl carrier protein synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90562"
FT                   /protein_id="ADM90562.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGEELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            448762..448986
FT                   /locus_tag="SP670_0492"
FT   CDS_pept        448762..448986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0492"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90563"
FT                   /protein_id="ADM90563.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            449105..450079
FT                   /locus_tag="SP670_0493"
FT   CDS_pept        449105..450079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0493"
FT                   /product="putative enoyl-(acyl-carrier-protein) reductase
FT                   II"
FT                   /EC_number="1.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90564"
FT                   /protein_id="ADM90564.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVDGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGVVRND"
FT   gene            450072..450992
FT                   /gene="fabD"
FT                   /locus_tag="SP670_0494"
FT   CDS_pept        450072..450992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SP670_0494"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90565"
FT                   /protein_id="ADM90565.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            451026..451757
FT                   /gene="fabG"
FT                   /locus_tag="SP670_0495"
FT   CDS_pept        451026..451757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SP670_0495"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90566"
FT                   /protein_id="ADM90566.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   AEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVVAIDGGLSM"
FT   gene            451779..453014
FT                   /gene="fabF"
FT                   /locus_tag="SP670_0496"
FT   CDS_pept        451779..453014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SP670_0496"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90567"
FT                   /protein_id="ADM90567.1"
FT                   /translation="MKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHSD
FT                   FDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRFGVI
FT                   VASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTA
FT                   CSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRASIPF
FT                   DKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIK
FT                   AIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLG
FT                   AAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGH
FT                   NAVLAFKRWENR"
FT   gene            453017..453502
FT                   /gene="accB"
FT                   /locus_tag="SP670_0497"
FT   CDS_pept        453017..453502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SP670_0497"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90568"
FT                   /protein_id="ADM90568.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVASEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            453499..453921
FT                   /gene="fabZ"
FT                   /locus_tag="SP670_0498"
FT   CDS_pept        453499..453921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SP670_0498"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90569"
FT                   /protein_id="ADM90569.1"
FT                   /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGTLTFAIGN"
FT   gene            453933..455300
FT                   /gene="accC"
FT                   /locus_tag="SP670_0499"
FT   CDS_pept        453933..455300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SP670_0499"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90570"
FT                   /protein_id="ADM90570.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            455337..456203
FT                   /gene="accD"
FT                   /locus_tag="SP670_0500"
FT   CDS_pept        455337..456203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SP670_0500"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90571"
FT                   /protein_id="ADM90571.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            456200..456967
FT                   /gene="accA"
FT                   /locus_tag="SP670_0501"
FT   CDS_pept        456200..456967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SP670_0501"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90572"
FT                   /protein_id="ADM90572.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEVGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            457230..457415
FT                   /locus_tag="SP670_0502"
FT   CDS_pept        457230..457415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90573"
FT                   /protein_id="ADM90573.1"
FT                   /translation="MTGTETFTVISTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQG
FT                   ALNSYIDAWKYGFRTG"
FT   gene            457433..458221
FT                   /locus_tag="SP670_0503"
FT   CDS_pept        457433..458221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0503"
FT                   /product="caax amino protease family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90574"
FT                   /protein_id="ADM90574.1"
FT                   /translation="MRNTKKLRQFGIFLLIILLSTYLPQTIRLYVTIILGLGADVYSLI
FT                   LTMGLVGSFLLLIWRLKKKKMLFIFEKKSWNWSFVFYLFATYVVYQILGNFWARYAHLI
FT                   NHRNIHDEYFTVVLSNGQPTFLSTILSFVLPVIIDPVFEETLDRGYFMNTFFPKSKYYL
FT                   DVILSGLIFGLSHLILSHRDPISLLYYSLIGFFFALVYRSTDNLRLTILCHSFLTFSIM
FT                   QNLSGFLFTIISIIIFLDSGRQRKKCLISIKHFFFLLLAL"
FT   gene            458335..459117
FT                   /locus_tag="SP670_0504"
FT   CDS_pept        458335..459117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0504"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90575"
FT                   /protein_id="ADM90575.1"
FT                   /translation="MEQLHFITKLLDIKDPNIQILDIINKDTHKEIIAKLDYEAPSCPE
FT                   CGSQMKKYYFQKPSKIPYLETTGMPTRILLRKRRFKCYHCSKIMVAETSIVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLSISTSTVIRKLNDFHFKHDFSCLSEIMSWDEYAFTK
FT                   GKMSFIAQDFNKLNIITVLEGRTQAIIRNHFLRYDRVVRCRVKIITMDMFSPYYDLAKQ
FT                   LRFQISRLRLKQSPRLFHSRMLKSCWIAFTLYNILAVL"
FT   gene            459072..459641
FT                   /locus_tag="SP670_0505"
FT   CDS_pept        459072..459641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0505"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90576"
FT                   /protein_id="ADM90576.1"
FT                   /translation="MLDRFHIVQHLSRAMSRVRVQIMNQFHRKSHEYKAIKRYWKLIQQ
FT                   DSRKLSDKRFYRPTFRMHLTNKEILDKLLSYSQDLKHHYQLYQLLLFHFQNKEPEKFFG
FT                   LIEDNLKQAHPLFQTVFKTFLKDKEKIVNALQLHYSNAKLEATNNLIKLIKRNAFGFRN
FT                   FENFKKRIFIALNIKKERTKFVLSRA"
FT   gene            complement(459676..460098)
FT                   /gene="nusB"
FT                   /locus_tag="SP670_0506"
FT   CDS_pept        complement(459676..460098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SP670_0506"
FT                   /product="transcription antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90577"
FT                   /protein_id="ADM90577.1"
FT                   /translation="MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDREYTD
FT                   VQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSFDTP
FT                   QLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(460091..460480)
FT                   /locus_tag="SP670_0507"
FT   CDS_pept        complement(460091..460480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0507"
FT                   /product="general stress protein, Gls24 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90578"
FT                   /protein_id="ADM90578.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(460502..461062)
FT                   /gene="efp"
FT                   /locus_tag="SP670_0508"
FT   CDS_pept        complement(460502..461062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SP670_0508"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90579"
FT                   /protein_id="ADM90579.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            461230..461415
FT                   /locus_tag="SP670_0509"
FT   CDS_pept        461230..461415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0509"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90580"
FT                   /protein_id="ADM90580.1"
FT                   /translation="MEIKEQTRKLAAGCSKHCFEVVDRTDEVSNHIYGNVTLTWFEEIF
FT                   EEYYISKGRSKFTPTC"
FT   gene            complement(461440..462474)
FT                   /locus_tag="SP670_0510"
FT   CDS_pept        complement(461440..462474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0510"
FT                   /product="L-iditol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90581"
FT                   /protein_id="ADM90581.1"
FT                   /translation="MKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLHEFL
FT                   DGPIFIPTDEHVYSGQKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNNLVG
FT                   DYNLDPNLNFVGLAADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSS
FT                   LKAGDTAVVFGLGPIGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGET
FT                   AVEAIHRLTNGGVDVSYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQ
FT                   EKTLKGIIAYRHIFPKVLELMEQGYFSAEKLVTKKIKLENIVEEGFIELTQDKSQIKIL
FT                   VEPE"
FT   gene            complement(462594..464036)
FT                   /locus_tag="SP670_0511"
FT   CDS_pept        complement(462594..464036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0511"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90582"
FT                   /protein_id="ADM90582.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEVQRQAEILRSGGQIRQETRRYDEANKTTILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMITIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(464036..465502)
FT                   /locus_tag="SP670_0512"
FT   CDS_pept        complement(464036..465502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0512"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90583"
FT                   /protein_id="ADM90583.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSYYGATKNAWDHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGSFAPTVKENA
FT                   LLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKETILNA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKY
FT                   SEETIYQAAAAFEATTDYHKQQPVIFGGDN"
FT   gene            complement(465502..465804)
FT                   /gene="gatC"
FT                   /locus_tag="SP670_0513"
FT   CDS_pept        complement(465502..465804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SP670_0513"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90584"
FT                   /protein_id="ADM90584.1"
FT                   /translation="MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVD
FT                   TTGVAPTTTMADRKTVLRPDVAEEGTNRDRLFKNVPEKDNYYIKVPAILDDGGDA"
FT   gene            466017..467561
FT                   /gene="prfC"
FT                   /locus_tag="SP670_0514"
FT   CDS_pept        466017..467561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SP670_0514"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90585"
FT                   /protein_id="ADM90585.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLELLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGDIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVTNAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMSPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            467989..468186
FT                   /locus_tag="SP670_0515"
FT   CDS_pept        467989..468186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0515"
FT                   /product="glycosyl transferase, family 8"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90586"
FT                   /protein_id="ADM90586.1"
FT                   /translation="MKEEKKAIVLGADNAYMDKVETTIKSLCVHHYNLKFYVFNDDLPR
FT                   EWFQLMEKRLETLNSEIVNV"
FT   gene            468589..468777
FT                   /gene="rpmB"
FT                   /locus_tag="SP670_0516"
FT   CDS_pept        468589..468777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SP670_0516"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90587"
FT                   /protein_id="ADM90587.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            468934..469299
FT                   /locus_tag="SP670_0517"
FT   CDS_pept        468934..469299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0517"
FT                   /product="alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90588"
FT                   /protein_id="ADM90588.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            469302..470969
FT                   /locus_tag="SP670_0518"
FT   CDS_pept        469302..470969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0518"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90589"
FT                   /protein_id="ADM90589.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDAVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            471170..472870
FT                   /gene="ilvB"
FT                   /locus_tag="SP670_0519"
FT   CDS_pept        471170..472870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SP670_0519"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90590"
FT                   /protein_id="ADM90590.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA"
FT   gene            472872..473339
FT                   /gene="ilvN"
FT                   /locus_tag="SP670_0520"
FT   CDS_pept        472872..473339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SP670_0520"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90591"
FT                   /protein_id="ADM90591.1"
FT                   /translation="MLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGATEDPNVSRITI
FT                   IIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPAEKRAEILAIIQ
FT                   PFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGFTRD"
FT   gene            473405..474427
FT                   /gene="ilvC"
FT                   /locus_tag="SP670_0521"
FT   CDS_pept        473405..474427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SP670_0521"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90592"
FT                   /protein_id="ADM90592.1"
FT                   /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVI
FT                   IGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAV
FT                   GFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKN
FT                   IAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPE
FT                   LAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLAD
FT                   IQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN
FT                   "
FT   gene            474630..474770
FT                   /locus_tag="SP670_0522"
FT   CDS_pept        474630..474770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90593"
FT                   /protein_id="ADM90593.1"
FT                   /translation="MTFEQFFKLAQIAREEGLEIHSPFERAGATKSARYIAKWILRNKK
FT                   H"
FT   gene            475008..475364
FT                   /locus_tag="SP670_0523"
FT   CDS_pept        475008..475364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90594"
FT                   /protein_id="ADM90594.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEVFGDE"
FT   gene            475414..476664
FT                   /gene="ilvA"
FT                   /locus_tag="SP670_0524"
FT   CDS_pept        475414..476664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SP670_0524"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90595"
FT                   /protein_id="ADM90595.1"
FT                   /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIKTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   gene            476806..476994
FT                   /locus_tag="SP670_0525"
FT   CDS_pept        476806..476994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90596"
FT                   /protein_id="ADM90596.1"
FT                   /translation="MAQISILHFDFLSIDKHSHTVFNTLRKSLQTTLALSATSKQCFEQ
FT                   LAASFLVCSLIFIEYKV"
FT   gene            477535..477750
FT                   /locus_tag="SP670_0526"
FT   CDS_pept        477535..477750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90597"
FT                   /protein_id="ADM90597.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNYEKFED"
FT   gene            complement(477859..478599)
FT                   /locus_tag="SP670_0527"
FT   CDS_pept        complement(477859..478599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0527"
FT                   /product="L-cystine import ATP-binding protein TcyN"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90598"
FT                   /protein_id="ADM90598.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(478599..480164)
FT                   /locus_tag="SP670_0528"
FT   CDS_pept        complement(478599..480164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0528"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90599"
FT                   /protein_id="ADM90599.1"
FT                   /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDD
FT                   DSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAG
FT                   MSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYASAKSLDDFNGAKITSQQGVYLYDLIA
FT                   QIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGFKTGE
FT                   EDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSSSFFSQ
FT                   VAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKAIYGLQKLVG
FT                   WVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYMTEIVRGG
FT                   ILAVDKGQFEAATALGMTHNQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTYTTGANQMQT
FT                   EDLK"
FT   gene            480302..482191
FT                   /locus_tag="SP670_0529"
FT   CDS_pept        480302..482191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90600"
FT                   /protein_id="ADM90600.1"
FT                   /translation="MKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEFR
FT                   QKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKVQAAKNGAELADVTSEVTEEADGY
FT                   TVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDKG
FT                   AEKLFFHTGKLFREGTIEKSNLDYTIRLDNLPAKRGVELHAYWSRTDFASARDQGLKGN
FT                   RLEEFNKIEDSIVREKDQSKQLVTWVLPSILSISLLLSVCFYFIYRRKTTPSVKYAKNH
FT                   RLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRGNVSIIS
FT                   EGDAVGLRLVKEDGLSRFERDCLNLAFSGKKEATLSNLFADYKVSDSLYRRAKVSDEKR
FT                   IQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGLEKTLQVGMGVLTILPLF
FT                   IGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLWT
FT                   SFENMLREIARLDKAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLYV
FT                   AYGWHSMFYHSSAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(482188..482358)
FT                   /locus_tag="SP670_0530"
FT   CDS_pept        complement(482188..482358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0530"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90601"
FT                   /protein_id="ADM90601.1"
FT                   /translation="MKKWTFSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFFYLPL
FT                   YHTFSVYGSSL"
FT   gene            complement(482390..483040)
FT                   /locus_tag="SP670_0531"
FT   CDS_pept        complement(482390..483040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0531"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90602"
FT                   /protein_id="ADM90602.1"
FT                   /translation="MDKIVGKHSEYTYQLLTRYPNPQKRLEAGFDKLIEIKRLTASKIQ
FT                   DILSVAPRSIGTTSPAREFEIIEIIKHYKRLIDKAETCVNDLMAEFNSVITTVTGIGGR
FT                   LGAVILAEIRNIHAFDNPAQLQAFAGLDSSIYQSGQIDLAGRMIKRGSPHLRWALIQAA
FT                   KACARFSPAFKVYLKTKLEQGKHYNVAIIHLAKKLIRTLFYILKKSCHLTNKK"
FT   gene            complement(483238..483360)
FT                   /locus_tag="SP670_0532"
FT   CDS_pept        complement(483238..483360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0532"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90603"
FT                   /protein_id="ADM90603.1"
FT                   /translation="MLYVGIDVAKNKHDVTALNVSGKLFLNHSLFQIIKLVLNS"
FT   gene            483616..484461
FT                   /locus_tag="SP670_0533"
FT   CDS_pept        483616..484461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0533"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90604"
FT                   /protein_id="ADM90604.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   gene            484454..484582
FT                   /locus_tag="SP670_0534"
FT   CDS_pept        484454..484582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90605"
FT                   /protein_id="ADM90605.1"
FT                   /translation="MYKKNLEGVTLQGFILLENLFKPRQLYLQPQNSVLSSLRLAS"
FT   gene            complement(484608..485669)
FT                   /locus_tag="SP670_0535"
FT   CDS_pept        complement(484608..485669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0535"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90606"
FT                   /protein_id="ADM90606.1"
FT                   /translation="MLIFPLLNDLSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDP
FT                   RQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLRIRAIFK
FT                   RYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWKELHLTASAGVSYNKFLAK
FT                   MASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEV
FT                   TLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIKKELTLLSE
FT                   KVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQISQIALQLYEELSEKE
FT                   RGVRLLGITLTGF"
FT   gene            complement(485714..485836)
FT                   /locus_tag="SP670_0536"
FT   CDS_pept        complement(485714..485836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0536"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90607"
FT                   /protein_id="ADM90607.1"
FT                   /translation="MEIEKQTRKLAAGCSKHCFEVVNRTDEVSSKYCFEVADGS"
FT   gene            486064..488388
FT                   /gene="pflB"
FT                   /locus_tag="SP670_0537"
FT   CDS_pept        486064..488388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="SP670_0537"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90608"
FT                   /protein_id="ADM90608.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDRYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   gene            complement(488446..489708)
FT                   /locus_tag="SP670_0538"
FT   CDS_pept        complement(488446..489708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0538"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90609"
FT                   /protein_id="ADM90609.1"
FT                   /translation="MEHINHTTLLIGIKDKNITLNKAIQHDTHIEVFATLDYHPPKCKH
FT                   CKGKQIKYDFQKPSKIPFIEIGGFPSLIHLKKRRFQCKSCRKVTVAETTLVQKNCQISE
FT                   MVRQKIAQLLLNREALTHIASKLAISTSTSTVYRKLKQFHFQEDYTTLPEILSWDEFSY
FT                   QKGKLAFIAQDFNTKKIMTILDNRRQTTIRNHFFKYSKEARKKVKVVTVDMSGSYIPLI
FT                   KKLFPNAKIVLDRFHIVQHMSRALNQTRINIMKQFDDKSLEYRALKYYWKFILKDSRKL
FT                   SLKPFYARTFRETLTPRECLKKIFTLVPELKDYYDLYQLLLFHLQEKNTDQFWGLIQDT
FT                   LPHLNRTFKTTLSTFICYKNYITNAIELPYSNAKLEATNKLIKDIKRNAFGFRNFENFK
FT                   KRIFIALNIKKERTKFVLSRA"
FT   gene            complement(489973..491502)
FT                   /locus_tag="SP670_0539"
FT   CDS_pept        complement(489973..491502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0539"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90610"
FT                   /protein_id="ADM90610.1"
FT                   /translation="MLNKYIEKRITDKITILNILLDIRSIELDELSTLTSLQSKSLLSI
FT                   LQELQETFEEELTFNLDTQQVQLIEHHSHQTNYYFHQLYNQSTILKILRFFLLQGNQSF
FT                   NEFTQKEYISIATGYRVRQKCGLLLRSVGLDLVKNQVVGPEYRIRFLIALLQFHFGIEI
FT                   YDLNDGSMDWVTHMIVQSNSQLSHELLEITPDEYVHFSILVALTWKRREFPLEFPESKE
FT                   FEKLKNLFMYPILMEHCQTYLEPHANMTFTQEELDYIFLVYCSANSSFSKDKWNQEKKT
FT                   HTIQLILQHTRGKHLLSKFKNILGNDISNSLSFLTALTFLTRTFLFGLQNLVPYYNYYE
FT                   HYGIESDKPLYHISKAIVQEWMTEQKIEGVIDQHRLYLFSLYLTETIFSSLPAIPIFII
FT                   LNNQADVNLIKSIILRNFTDKVASVTGYNILISPPPSEEHLTEPLIIITTKEYLPYVKK
FT                   QYPKGKHHFLTIALDLHVSQQRLIYQTIVDIRKEAFDKRVAMIAKKAHYLL"
FT   gene            492018..494669
FT                   /locus_tag="SP670_0540"
FT   CDS_pept        492018..494669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0540"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90611"
FT                   /protein_id="ADM90611.1"
FT                   /translation="MKKVRKIFQKAVAGLCCISQLTAFSSIVALAETPETSPAIGKVVI
FT                   KETGEGGALLGDAVFELKNNTDGTTVSQRTEAQTGEAIFSNIKPGTYTLTEAQPPVGYK
FT                   PSTKQWTVEVEKNGRTTVQGEQVENREEALSDQYPQTGTYPDVQTPYQIIKVDGSEKNG
FT                   QHKALNPNPYERVIPEGTLSKRIYQVNNLDDNQYGIELTVSGKTTVETKEASTPLDVVI
FT                   LLDNSNSMSNIRHNHAHRAEKAGEATRALVDKITSNPDNRVALVTYGSTIFDGSEATVE
FT                   KGVADANGKILNDSALWTFDRTTFTAKTYNYSFLNLTSDPTDIQTIKDRIPSDAEELNK
FT                   DKLMYQFGATFTQKALMTADDILTKQARPNSKKVIFHITDGVPTMSYPINFKYTGTTQS
FT                   YRTQLNNFKAKTPNSSGILLEDFVTWSADGEHKIVRGDGESYQMFTKKPVTDQYGVHQI
FT                   LSITSMEQRAKLVSAGYRFYGTDLYLYWRDSILAYPFNSSTDWITNHGDPTTWYYNGNM
FT                   AQDGYDVFTVGVGVNGDPGTDEATATRFMQSISSSPDNYTNVADPSQILQELNRYFYTI
FT                   VNEKKSIENGTITDPMGELIDFQLGADGRFDPADYTLTANDGSSLVNNVPTGGPQNDGG
FT                   LLKNAKVFYDTTEKRIRVTGLYLGTGEKVTLTYNVRLNDQFVSNKFYDTNGRTTLHPKE
FT                   VEKNTVRDFPIPKIRDVRKYPEITIPKEKKLGEIEFIKINKNDKKPLRDAVFSLQKQHP
FT                   DYPDIYGAIDQNGTYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKPVQNKPIVAFQ
FT                   IVNGEVRDVTSIVPQDIPAGYEFTNDKHYITNEPIPPKREYPRTGGIGMLPFYLIGCMM
FT                   MGGVLLYTRKHP"
FT   gene            494902..496836
FT                   /locus_tag="SP670_0541"
FT   CDS_pept        494902..496836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0541"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90612"
FT                   /protein_id="ADM90612.1"
FT                   /translation="MKSINKFLTMLAALLLTASSLFSAATVFAADNVSTAPDAVTKTLT
FT                   IHKLLLSEDDLKTWDTNGPKGYDGTQSSLKDLTGVVAEEIPNVYFELQKYNLTDGKEKE
FT                   NLKDDSKWTTVHGGLTTKDGLKIETSTLKGVYRIREDRTKTTYVGPNGQVLTGSKAVPA
FT                   LVTLPLVNNNGTVIDAHVFPKNSYNKPVVDKRIADTLNYNDQNGLSIGTKIPYVVNTTI
FT                   PSNATFATSFWSDEMTEGLTYNEDVTITLNNVAMDQADYEVTKGNNGFNLKLTEAGLAK
FT                   INGKDADQKIQITYSATLNSLAVADIPESNDITYHYGNHQDHGNTPKPTKPNNGQITVT
FT                   KTWDSQPAPEGVKATVQLVNAKTGEKVGAPVELSENNWTYTWSGLDNSIEYKVEEEYNG
FT                   YSAEYTVESKGKLGVKNWKDNNPAPINPEEPRVKTYGKKFVKVDQKDTRLENAQFVVKK
FT                   ADSNKYIAFKSTAQQAADEKAAATAKQKLDAAVAAYTNAADKQAAQALVDQAQQEYNVA
FT                   YKEAKFGYVEVAGKDEAMVLTSNTDGQFQISGLAAGTYKLEEIKAPEGFAKIDDVEFVV
FT                   GAGSWNQGEFNYLKDVQKNDATKVVNKKITIPQTGGIGTIIFAVAGAAIMGIAVYAYVK
FT                   NNKDEDQLA"
FT   gene            complement(496802..497104)
FT                   /locus_tag="SP670_0542"
FT   CDS_pept        complement(496802..497104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90613"
FT                   /protein_id="ADM90613.1"
FT                   /translation="MQVSYNLHPIIIGIRIIQLPYLQPMTITRWQLTNHLLIVLQLQDQ
FT                   RVIFLRLDCMCTPYKRKTQSHNKEDTTNHFLHFLHCHQWLLSLLLKQVDPHLCCF"
FT   gene            497153..498064
FT                   /locus_tag="SP670_0543"
FT   CDS_pept        497153..498064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0543"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90614"
FT                   /protein_id="ADM90614.1"
FT                   /translation="MTFLENQIEVSHIPNGLYYVRSIIQTDAVSYPAEFLFEMTDQTVE
FT                   PLVIVAKKTDTMTTKVKLIKVDQDHNRLEGVGFKLVSVARDGSEKEVPLIGEYRYSSSG
FT                   QVGRTLYTDKNGEIFVTNLPLGNYRFKEVEPLAGYAVTTLDTDVQLVDHQLVTITVVNQ
FT                   KLPRGNVDFMKVDGRTNTSLQGAMFKVMKEESGHYTPVLQNGKEVVVTSGKDGRFRVEG
FT                   LEYGTYYLWELQAPTGYVQLTSPVSFTIGKDTRKELVTVVKNNKRPRIDVPDTGEETLY
FT                   ILMLVAILLFGSGYYLTKKPNN"
FT   gene            498402..499304
FT                   /locus_tag="SP670_0544"
FT   CDS_pept        498402..499304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0544"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90615"
FT                   /protein_id="ADM90615.1"
FT                   /translation="MVKTKKQKRNNLLLGVVFFIGMAVMAYPLVSRLYYRVESNQQIAD
FT                   FDKEKATLDEADIDERMKLAQAFNDSLNNVVSGDPWSEEMKKKGRAEYARMLEIHERMG
FT                   HVEIPVIDVDLPVYAGTAEEVLQQGAGHLEGTSLPIGGNSTHAVITAHTGLPTAKMFTD
FT                   LTKLKVGDKFYVHNIKEVMAYQVDQVKVIEPTNFDDLLIVPGHDYVTLLTCTPYMINTH
FT                   RLLVRGHRIPYVAEVEEEFIAANKLSHLYRYLFYVAVGLIVILLWIIRRLRKKKKQPEK
FT                   ALKALKAARKEVKVEDGQQ"
FT   gene            499396..500184
FT                   /locus_tag="SP670_0545"
FT   CDS_pept        499396..500184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0545"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90616"
FT                   /protein_id="ADM90616.1"
FT                   /translation="MVSRYYYRIESNEVIKEFDETVSQMDKAELEERWRLAQAFNATLK
FT                   PSEILDPFTEQEKKKGVSEYANMLKVHERIGYVEIPAIDQEIPMYVGTSEEILQKGAGL
FT                   LEGASLPVGGENTHTVVTAHRGLPTAELFSQLDKMKKGDVFYLHVLDQVLAYQVDQILT
FT                   VEPNDFEPVLIQHGEDYATLLTCTPYMINSHRLLVRGKRIPYTAPIAERNRAVRERGQF
FT                   WLWLLLAALVMILVLSYGVYRHRRIVKGLEKQLEEHHVKG"
FT   gene            500171..501022
FT                   /locus_tag="SP670_0546"
FT   CDS_pept        500171..501022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0546"
FT                   /product="sortase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90617"
FT                   /protein_id="ADM90617.1"
FT                   /translation="MSKAKLQKLLGYLLMLVALVIPVYCFGQMVLQSLGQVKGHEIFSE
FT                   SVTADSYQEQLQRSLDYNQRLDSQNRIVDPFLAEGYEVNYQVSDDPDAVYGYLSIPSLE
FT                   IMEPVYLGADYHHLAMGLAHVDGTPLPVEGKGIRSVIAGHRAEPSHVFFRHLDQLKVGD
FT                   ALYYDNGQEIVEYQMMDTEIILPSEWEKLESVSSKNIMTLITCDPIPTFNKRLLVNFER
FT                   VAVYQKSDPQTAAVARVAFTKEGQSVSRVATSQWLYRGLVVLAFLGILFVLWKLARLLR
FT                   GK"
FT   gene            complement(501095..501856)
FT                   /locus_tag="SP670_0547"
FT   CDS_pept        complement(501095..501856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0547"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90618"
FT                   /protein_id="ADM90618.1"
FT                   /translation="MSFIAQDFEKLDIITVLEGRTQAVIRDHFLKYDRAVRCRVKIITM
FT                   DMFSPYYDLARQLFPCAKIVLDRFHIVQHLSRAMSRVHVQIMNQFHRKSHEYKAIKRYW
FT                   KLIQQDSCKLSDKRFYRPIFRMHLTNKEILNKLLSYSEDLKHHYQLYQLLLFHFQNKEP
FT                   EKFFGLIEDNLKQVHPIFQTVFKTFLKDKEKIINALQLHYSNAKLEATNNLIKLIKRNA
FT                   FGFRNFENFKKRIFIALNIKKERTKFVLSRA"
FT   gene            complement(501853..502371)
FT                   /locus_tag="SP670_0548"
FT   CDS_pept        complement(501853..502371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0548"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90619"
FT                   /protein_id="ADM90619.1"
FT                   /translation="MEQLHFITKLLDIKDPNIQILDIINKDTHKEIIAKLDYDAPSCPE
FT                   CGNQLKKYDFQKPSKIPYLETTGMPSRILLRKRRFKCYHCSKMMVAETSIVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLAISTSTVIRKLNDSHFEHDFSRLPEIMSWDVETVRG
FT                   VTVSIGRWR"
FT   gene            complement(502486..502635)
FT                   /locus_tag="SP670_0549"
FT   CDS_pept        complement(502486..502635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90620"
FT                   /protein_id="ADM90620.1"
FT                   /translation="MDKMKPVFQALNKELIQENLTLTIICVGGYVLEYHGLRATQDVDA
FT                   FMAL"
FT   gene            complement(502628..502912)
FT                   /locus_tag="SP670_0550"
FT   CDS_pept        complement(502628..502912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90621"
FT                   /protein_id="ADM90621.1"
FT                   /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            503304..503477
FT                   /locus_tag="SP670_0551"
FT   CDS_pept        503304..503477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90622"
FT                   /protein_id="ADM90622.1"
FT                   /translation="MLIINRFFSLFVLDWYRTELWINTLVSYPVPKYVGRKMKQLLRVS
FT                   VLEKILSIEFFK"
FT   gene            complement(504346..505569)
FT                   /locus_tag="SP670_0552"
FT   CDS_pept        complement(504346..505569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0552"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90623"
FT                   /protein_id="ADM90623.1"
FT                   /translation="MITKQSAFLQNRATILEFLYRNPATSRTDIVNETGLTPATTTNII
FT                   KELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQGK
FT                   TLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYYKDSGSIITN
FT                   NPIWESFNLLNVIKRFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIYTSFF
FT                   TKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFKNSQLT
FT                   VLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPADKIYINS
FT                   QLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVAFFIEHSN
FT                   VLQDIISP"
FT   gene            505737..507059
FT                   /locus_tag="SP670_0553"
FT   CDS_pept        505737..507059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0553"
FT                   /product="lichenan permease EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90624"
FT                   /protein_id="ADM90624.1"
FT                   /translation="MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSLF
FT                   LILISWPQEAFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSAG
FT                   IIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIYR
FT                   MFIQRGITIKMPSGVPDVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAGGLNGLLGAI
FT                   VGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEAVAAGQ
FT                   TLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAIL
FT                   FTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATGA
FT                   SWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
FT   gene            507061..508947
FT                   /locus_tag="SP670_0554"
FT   CDS_pept        507061..508947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90625"
FT                   /protein_id="ADM90625.1"
FT                   /translation="MVIRVFDQQKNTYSSFALEELSYYMNRVFKTNIELVEEKEADIFV
FT                   GLVNKEDRKDHVLISLDKGKGRIESNTIVGLLIGIYRMFHEFGVVYTRPGRRHDFVPEL
FT                   RFEDFLDKELSIDETASYYHRGVCIEGADSFENILDFIDWLPKIGMNSFFIQFENPYSF
FT                   LKRWYEHEFNPYLNKEKFSNELVQELSDRLDKELQKRGLIHHRVGHGWTGEVLGYSSKF
FT                   GWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPDVADKMVEIIKDYAKKRPD
FT                   VNYLHVWLSDARNNICECENCRQELVSDQYIRILNQLDRALTSEGLDTKICFLLYHELL
FT                   WAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTPKPYLRNKIILPNSLEENL
FT                   SYLFEWQKTFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRDVSYLSNLHLNGYISCQEL
FT                   RAGFPHNFPNYVMGEMLWKKTRSYEELIEEYFSALYGENWQSVVEYLEKLSSYSSCDYF
FT                   NAIGSRQNDVLANHYYIAYNLADNFLPIIEENISKLLNSQKDEWKQLSYHREYVVKMAK
FT                   ALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVIEVAKNYAGFHL"
FT   gene            509115..509459
FT                   /locus_tag="SP670_0555"
FT   CDS_pept        509115..509459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0555"
FT                   /product="lactose-specific phosphotransferase EIIA"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90626"
FT                   /protein_id="ADM90626.1"
FT                   /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVE
FT                   SANDSIVSAHREQTNLLAEEASGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERI
FT                   RKIEEHIGLQ"
FT   gene            509469..510881
FT                   /locus_tag="SP670_0556"
FT   CDS_pept        509469..510881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0556"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90627"
FT                   /protein_id="ADM90627.1"
FT                   /translation="MENLQFKALPKEFLLGAATAAYQVEGATRVDGKGINMWDVYLQEN
FT                   SPFLPDPASDFYYRYEEDIALAAEHGLQALRLSISWVRIFPDIDGDANILAVRYYHRVF
FT                   QSCLKHNVIPFVSLHHFDSPQKMLETGDWLDRENIDHFIRYARFCFQEFTEVKHWFTIN
FT                   ELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVLEFHQLGIEGEIGCIHAL
FT                   KPGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSSFIIED
FT                   GDLEIMKRAAPLNTMFGMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNALGEFVKK
FT                   TGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGENDIIDDSK
FT                   RIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDYETQKRYIK
FT                   KSALWVKGLKRN"
FT   gene            510950..512629
FT                   /locus_tag="SP670_0557"
FT   CDS_pept        510950..512629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0557"
FT                   /product="pts system lactose-specific EIIBC"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90628"
FT                   /protein_id="ADM90628.1"
FT                   /translation="MDKLVAAIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLM
FT                   IIIMIPKNFGVELPSPAIVWMRKVYMLTMGVLGIIVSGTVGKSLVGNVNRKMPHGKVIN
FT                   DTSAMLAAICSYLVLTVTLVVDEKTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK
FT                   RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLLTPIF
FT                   KGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQFPYHSL
FT                   TPNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVI
FT                   LNPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWAFPGPLGLLIGTNFQPISFVL
FT                   LSLMLVVDILIYLPFCRAYDRQLLMKEDVASSNDIILEEDTSEIMPGEIDVIKSKELKV
FT                   LVLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYR
FT                   EMKVDAERLGIQIVATRGMEYIHLTKSPSKSLQFVLEHYQAV"
FT   gene            complement(512754..514193)
FT                   /locus_tag="SP670_0558"
FT   CDS_pept        complement(512754..514193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0558"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90629"
FT                   /protein_id="ADM90629.1"
FT                   /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTI
FT                   GILVLLGGSGSLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSVIDAFFE
FT                   ISSGFTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKA
FT                   EVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGF
FT                   TVYNDGIAHYGSSLITYLVSIGVLIFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLV
FT                   STGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMTIG
FT                   GSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNKTVIDKDTQHKILKYFVI
FT                   YAMILLSLIFIVSLDSNDFLIVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMI
FT                   AGRLEIYPILLLFMKRTWSKR"
FT   gene            complement(514197..515546)
FT                   /locus_tag="SP670_0559"
FT   CDS_pept        complement(514197..515546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0559"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90630"
FT                   /protein_id="ADM90630.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIEREHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            515735..516583
FT                   /locus_tag="SP670_0560"
FT   CDS_pept        515735..516583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90631"
FT                   /protein_id="ADM90631.1"
FT                   /translation="MNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIHHLTHDITPY
FT                   NIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTPDNGTLSFIK
FT                   KHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEVGPELSVEQI
FT                   VELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFEVTIYHADML
FT                   VYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSSWTIEIKKIE
FT                   G"
FT   gene            516598..517146
FT                   /locus_tag="SP670_0561"
FT   CDS_pept        516598..517146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0561"
FT                   /product="protein YdcD"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90632"
FT                   /protein_id="ADM90632.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINSVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   gene            517153..517410
FT                   /locus_tag="SP670_0562"
FT   CDS_pept        517153..517410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90633"
FT                   /protein_id="ADM90633.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEVVDETDEVSSKQCFEVVDETDEVSN
FT                   HTYGKAKLTWFEEIFEEYKMMGKAGQLVFFDVYRLVRKVS"
FT   gene            517512..519194
FT                   /locus_tag="SP670_0563"
FT   CDS_pept        517512..519194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0563"
FT                   /product="cobalt import ATP-binding protein CbiO"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90634"
FT                   /protein_id="ADM90634.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGQTYGEFLIKGQTAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIILIND
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLANLDNMSISKGQVQ
FT                   LQNELAKETPELQSLFKLEDVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   AISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALGLRLRG
FT                   VDEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIADTVPASLLS
FT                   DPELLVKANLKETSIFNLAKKLDVDPLDLTAFYKERREGCKLN"
FT   gene            519179..520009
FT                   /locus_tag="SP670_0564"
FT   CDS_pept        519179..520009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0564"
FT                   /product="cobalt transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90635"
FT                   /protein_id="ADM90635.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLLL
FT                   IAIFSVFLLYLSEIRFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            520202..520705
FT                   /gene="cspR"
FT                   /locus_tag="SP670_0565"
FT   CDS_pept        520202..520705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="SP670_0565"
FT                   /product="CspR"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90636"
FT                   /protein_id="ADM90636.1"
FT                   /translation="MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKM
FT                   KRAGLDYWDKLEIYFYESLEDFISQMKGKLYLISKFAEKVYSEVDLSTDEDHYFLFGRE
FT                   DKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHTYEV
FT                   DKLK"
FT   gene            521158..521721
FT                   /locus_tag="SP670_0566"
FT   CDS_pept        521158..521721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0566"
FT                   /product="riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90637"
FT                   /protein_id="ADM90637.1"
FT                   /translation="MTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSILPVLV
FT                   GLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWKKERTT
FT                   LRFLLGSLAGTVGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLPFNLIE
FT                   GVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            521735..522361
FT                   /locus_tag="SP670_0567"
FT   CDS_pept        521735..522361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0567"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90638"
FT                   /protein_id="ADM90638.1"
FT                   /translation="MKGSFALLLFVILGYMVKFYPEMLVNFDQSIQTAIRGDLPDYLTI
FT                   LFRSLTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTFKNIYQRPR
FT                   PAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKDPVWRKIVQIVLGLYLVSVLV
FT                   SRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            522389..522778
FT                   /locus_tag="SP670_0568"
FT   CDS_pept        522389..522778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90639"
FT                   /protein_id="ADM90639.1"
FT                   /translation="MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            522783..523232
FT                   /locus_tag="SP670_0569"
FT   CDS_pept        522783..523232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90640"
FT                   /protein_id="ADM90640.1"
FT                   /translation="MCFVPYYKVNYCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYS
FT                   YLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELAR
FT                   VKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGRSFILELV"
FT   gene            523360..523947
FT                   /gene="rpoE"
FT                   /locus_tag="SP670_0570"
FT   CDS_pept        523360..523947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SP670_0570"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90641"
FT                   /protein_id="ADM90641.1"
FT                   /translation="MELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVNEIQNY
FT                   LGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEENDDDEV
FT                   APKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVEAYDAE
FT                   INEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   gene            524337..525944
FT                   /gene="pyrG"
FT                   /locus_tag="SP670_0571"
FT   CDS_pept        524337..525944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SP670_0571"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90642"
FT                   /protein_id="ADM90642.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(526503..528134)
FT                   /locus_tag="SP670_0572"
FT   CDS_pept        complement(526503..528134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0572"
FT                   /product="sodium-dependent phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90643"
FT                   /protein_id="ADM90643.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGVGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            528495..533363
FT                   /locus_tag="SP670_0573"
FT   CDS_pept        528495..533363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0573"
FT                   /product="endo-beta-N-acetylglucosaminidase D"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90644"
FT                   /protein_id="ADM90644.1"
FT                   /translation="MIGAVLFAGPALAEETAVPENSGANTELVSGESEHSTNEADKQNE
FT                   GEHTRENKLEKAEGVATASETAEAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPE
FT                   ATNQGDESKPAAEANKTEKEVQPDVPKNTEKTLKPKEIKFNSWEELLKWEPGAREDDAI
FT                   NRGSVVLASRRTGHLVNEKASKEAKVQALSNTNSKAKDHASVGGEEFKAYAFDYWQYLD
FT                   SMVFWEGLVPTPDVIDAGHRNGVPVYGTLFFNWSNSIADQERFAEALKQDADGSFPIAR
FT                   KLVDMAKYYGYDGYFINQETTGDLVKPLGEKMRQFMLYSKEYAAKVNHPIKYSWYDAMT
FT                   YNYGRYHQDGLGEYNYQFMQPEGDKVPADNFFANFNWDKAKNDYTIATANWIGRNPYDV
FT                   FAGLELQQGGSYKTKVKWNDILDENGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFT
FT                   GYQGDPTGQKPGDKDWYGIANLVADRTPAVGNTFTTSFNTGHGKKWFVDGKVSKDSEWN
FT                   YRSVSGVLPTWRWWQTSTGEKLRAEYDFTDAYNGGNSLKFSGDVAGKTDQDVRLYSTKL
FT                   EVTEKTKLRVAHKGGKGSKVYMAFSTTSDYKFDDADAWKELTLSDNWTNEEFDLSSLAG
FT                   KTIYAVKLFFEHEGAVKDYQFNLGQLTISDNHQEPQSPTSFSVVKQSLKNAQEAEAVVQ
FT                   FKGNKDADFYEVYEKDGDSWKLLTGSSSTTIYLPKVSRSASAQGTTQELKVVAVGKNGV
FT                   RSEAATTTFDWGMTVKDTSLPKPLAENIVPGATVIDSTFPKTEGGEGIEGMLNGTITSL
FT                   SDKWSSAQLSGSVDIRLTKPRTVVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEW
FT                   KLAKEVRGNKAHVTDITLDKPITAQDWRLNVVTSDNGTPWKAIRIYNWKMYEKLDTESV
FT                   NIPMAKAAARSLGNNKVQVGFADVQAGATITVYDNPNSQTPLATLKSEVGGDLASAPLD
FT                   LTNQSGLLYYRTQLPGKEISNVLAVSVPKDDRRIKSVSLETGPKKTSYAEGEDLDLRGG
FT                   VLRVQYEGGTEDELIRLTHAGVSVSGFDTHHKGEQNLTLQYLGQPVNANLSVTVTGQDE
FT                   ASPKTILGIEVSQEPKKDYLVGDSLDLSEGRFAVAYSNDTMEEHSFTDEGVEISGYDAQ
FT                   KTGRQTLTLRYQGHEFNFDVLVSPKAALNDEYLKQKLAEVEAAKNKVVYNFASPEVKAA
FT                   FLKAIEAAEQVLKDHETSTQDQVNDRLNKLTEAHKALNGQEKFKEEKTELDRLTGEVQE
FT                   LLAAKPNHPSGSALAPLLEKNKALVEKVDLSPEELATAKQSLKDLVALLKEDKPAVFSD
FT                   SKTGVEVHFSNKEKTVIKGLKVERVQASAEEKKYFAGEDAHVFEIEGLDEKGQDVDLSY
FT                   ASIVKIPIEKDKKVKKVFFLPEGKEAVELAFEQTDSHVIFTAPHFTHYAFVYESAEKPQ
FT                   PAKPAPQNKVLPKPTYQPASDQQKAPKLEVQEEKVAFHRQEHENTEMLVGEQRVIIQGR
FT                   DGLLRHVFEVDENGQRRLRSTEVIQEAIPEIVEIGTKVKTVPAVVATQEKPAQNTAVKS
FT                   EEASKQLPNTGTADANEALIAGLASLGLASLALTLRRKREDKD"
FT   gene            533453..534649
FT                   /gene="pgk"
FT                   /locus_tag="SP670_0574"
FT   CDS_pept        533453..534649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SP670_0574"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90645"
FT                   /protein_id="ADM90645.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            534785..535312
FT                   /locus_tag="SP670_0575"
FT   CDS_pept        534785..535312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90646"
FT                   /protein_id="ADM90646.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETILYVFVRVLETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            535389..535745
FT                   /locus_tag="SP670_0576"
FT   CDS_pept        535389..535745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0576"
FT                   /product="HTH-type transcriptional regulator GlnR"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90647"
FT                   /protein_id="ADM90647.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            535782..537128
FT                   /gene="glnA"
FT                   /locus_tag="SP670_0577"
FT   CDS_pept        535782..537128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SP670_0577"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90648"
FT                   /protein_id="ADM90648.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYVAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   gene            537601..537738
FT                   /locus_tag="SP670_0578"
FT   CDS_pept        537601..537738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90649"
FT                   /protein_id="ADM90649.1"
FT                   /translation="MNPDRAEEYFCRGCQGENPEDIEFYDEQLQAEKVEVLNIRLEVKN
FT                   "
FT   gene            538206..539180
FT                   /locus_tag="SP670_0579"
FT   CDS_pept        538206..539180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0579"
FT                   /product="type I restriction enzyme EcoKI specificity
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90650"
FT                   /protein_id="ADM90650.1"
FT                   /translation="MKYYLLSDNFINRVNNKSTGTSYPAINDYNFNLLLIALPPLSEQQ
FT                   RIVEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEV
FT                   LLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYGNIPMNWVVIKIKDIFSMNTGL
FT                   SYKKGDLSINNKGVRIIRGGNIKPLEFSLLDNDYYIDTQFISSEQVYLKHNQLITPVST
FT                   SLEHIGKFARIDKDYDGVVAGGFIFQLTPFESSEIISKFLLFNLSSPLFYKQLKAITKL
FT                   SGQALYNIPKTTLSELLIPLAPFEEQELITQKVEKLFEKVNQL"
FT   gene            complement(539134..539742)
FT                   /locus_tag="SP670_0580"
FT   CDS_pept        complement(539134..539742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0580"
FT                   /product="type I restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90651"
FT                   /protein_id="ADM90651.1"
FT                   /translation="MVKLTTCYFCDYGSYYGNKDETTSYPIYKIPEAWRYIKFASLVNF
FT                   RIGKTPPRSEATFWGTEIPWVSISDMPISGYVTNTRESISKLALKSKKIDISPKGTLLM
FT                   SFKLSIGKVAILDIPATHNEAIISIFPYANKENIIRDYLMIFLPLISTLGDSKDAIKGK
FT                   TLNSTSISELLIPISNHEEMKRIIFKVDLLFQKVSQLFE"
FT   gene            complement(539753..540550)
FT                   /locus_tag="SP670_0581"
FT   CDS_pept        complement(539753..540550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0581"
FT                   /product="integrase/recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90652"
FT                   /protein_id="ADM90652.1"
FT                   /translation="MKDFELHLKKAGLAENTVRSYLYGVRFFLENYELKMEDLFEYKGY
FT                   LLDNFKPKTVNLRLQGVNKYLAFIGHDDLKLKFVKVQQKPFLEDVISHADYLFLKRSLK
FT                   KDGILKWHFVVWFLGATGARVSELIKLKVEHVEIGYFDIYSKGGKIRRLYIPKKLRNSC
FT                   LSWLESENRRSGYLFLNKFNEPITARGVAQQLKNYADKYKMNPKVIYPHSFRHLFAKNF
FT                   LAKYNDIALLADLMGHESIETTRIYLRKTATEQQNIVDKIVNW"
FT   gene            complement(540607..542175)
FT                   /locus_tag="SP670_0582"
FT   CDS_pept        complement(540607..542175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0582"
FT                   /product="type I site-specific deoxyribonuclease chain S"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90653"
FT                   /protein_id="ADM90653.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRFSTLVEIVRGGS
FT                   PRPIKDYLTSEVDGINWIKIGDTEKGEKYINNVKEKIKKSGLNKTRFVKKGTFLLTNSM
FT                   SFGRPYILNVDGAIHDGWLAISNYENSLNKDYLFYILSSNVVYSQFLSLISGAVVKNLN
FT                   SDKVASILIPLPPLSEQQRIIEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQY
FT                   AMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYEEVP
FT                   CEIPESWEWVRLNDITSYIQRGKSPKYSNIPIYPVIAQKCNQWSGFSIDLARFIDPETV
FT                   HSYQKERLLRDGDLMWNSTGLGTLGRLAIYHENKNPYGWAVADSHVTVIRVLSGVINCH
FT                   FIYNFLSSPIVQSVIEEKASGSTKQKELLTKTIKEYLIPLPPLPEQSRIVDKIEQFFAH
FT                   IDALI"
FT   gene            complement(542175..543638)
FT                   /locus_tag="SP670_0583"
FT   CDS_pept        complement(542175..543638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0583"
FT                   /product="type I restriction enzyme EcoEI M protein"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90654"
FT                   /protein_id="ADM90654.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLDPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEEEILNPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(543651..545984)
FT                   /locus_tag="SP670_0584"
FT   CDS_pept        complement(543651..545984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0584"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90655"
FT                   /protein_id="ADM90655.1"
FT                   /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTDG
FT                   RIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDVPF
FT                   VYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYYTDA
FT                   FSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLAKRVL
FT                   FLADRNILVDQTMAEDFRPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGEDGTET
FT                   HYQKFDKDFFDLIVIDEAHRGSAKENSNWRKIIDYFSSATQIGMTATPKETKNASNTEY
FT                   FGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDANGQLIEDRYYGRKD
FT                   FDKTIVIDDRTQRVAKFVSDYMKQNNARFDKTIVFCVDIDHAERMRAALVKENLDLVQE
FT                   DYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS
FT                   MTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADPDFDGDPVKVLETGAKTVSGST
FT                   PGFVGEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRKNILGSYATLND
FT                   FITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTE
FT                   RINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLPEFQIYGGTFKIIN
FT                   TYFGDKKRYLQAIKELEQELFTVA"
FT   gene            complement(546334..546462)
FT                   /locus_tag="SP670_0585"
FT   CDS_pept        complement(546334..546462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90656"
FT                   /protein_id="ADM90656.1"
FT                   /translation="MKVKNTSQLKELPPVTNFEKNGSRAKKRSKIGSIRIVKILLA"
FT   gene            546591..547100
FT                   /locus_tag="SP670_0586"
FT   CDS_pept        546591..547100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90657"
FT                   /protein_id="ADM90657.1"
FT                   /translation="MNSRVEFRIFTIVDLDKEEEYLHEMHLKGWRYRTSRFGLFYFDQC
FT                   QPDDVIYRIYDSRFLKKYKHELQDFRDRGWELIGAGSCSILRKSSSDLLPEDQVYMSKG
FT                   LKWEVMRSRLRSCTTTFLGGLVVCTSLFREDLSMSFFLIFVLYAFLISYLIHGYFRLKR
FT                   KYRVDE"
FT   gene            547264..548298
FT                   /gene="hrcA"
FT                   /locus_tag="SP670_0587"
FT   CDS_pept        547264..548298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SP670_0587"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90658"
FT                   /protein_id="ADM90658.1"
FT                   /translation="MVTERQQDILNLIIDIFTKTHEPVGSKALQESINSSSATIRNDMA
FT                   ELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDI
FT                   LQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLI
FT                   PRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVIDLFEHIFK
FT                   EMFNENIVMAGKVNLLNFANLAAYQFFDQPQKVALEIREGLREDQMQNVRVADGQESCL
FT                   ADLAVISSKFLIPYRGVGILAITGPVNLDYQQLINQVNVVNRVLTMKLTDFYRYLSSNH
FT                   YEVH"
FT   gene            548325..548849
FT                   /gene="grpE"
FT                   /locus_tag="SP670_0588"
FT   CDS_pept        548325..548849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SP670_0588"
FT                   /product="co-chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90659"
FT                   /protein_id="ADM90659.1"
FT                   /translation="MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFENK
FT                   YLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLG
FT                   MVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKLHDR
FT                   ILRPAMVVVYN"
FT   gene            549329..551152
FT                   /gene="dnaK"
FT                   /locus_tag="SP670_0589"
FT   CDS_pept        549329..551152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SP670_0589"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90660"
FT                   /protein_id="ADM90660.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAESDKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKAKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            551912..553048
FT                   /gene="dnaJ"
FT                   /locus_tag="SP670_0590"
FT   CDS_pept        551912..553048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SP670_0590"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90661"
FT                   /protein_id="ADM90661.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSFFG
FT                   GGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPV
FT                   TCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAHSVHV
FT                   KIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQ
FT                   AALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTG
FT                   LNDRQKVALKEFAAAGGLKVNPKKKGFFDHIKDAFDGE"
FT   gene            complement(553077..553253)
FT                   /locus_tag="SP670_0591"
FT   CDS_pept        complement(553077..553253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0591"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90662"
FT                   /protein_id="ADM90662.1"
FT                   /translation="MHHNLGNSYSIKIKKQTRKLGTDCSKHRFKVVDRTDEVSSKHCFE
FT                   VVDTTHIYTTRQR"
FT   gene            complement(553415..553702)
FT                   /locus_tag="SP670_0592"
FT   CDS_pept        complement(553415..553702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90663"
FT                   /protein_id="ADM90663.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(553712..554122)
FT                   /locus_tag="SP670_0593"
FT   CDS_pept        complement(553712..554122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0593"
FT                   /product="protein hit"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90664"
FT                   /protein_id="ADM90664.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMNATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            554190..554921
FT                   /locus_tag="SP670_0594"
FT   CDS_pept        554190..554921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0594"
FT                   /product="ABC-type transporter ATP-binding protein EcsA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90665"
FT                   /protein_id="ADM90665.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRAKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            554918..555967
FT                   /locus_tag="SP670_0595"
FT   CDS_pept        554918..555967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0595"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90666"
FT                   /protein_id="ADM90666.1"
FT                   /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGIATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFRQKASKFFTETGLDW
FT                   DYLISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNLYLRS
FT                   YLRNGDLFALSLRLLLLSVLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPLDKGQKEKGLQEVVRGLTSFVLLVEVVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   gene            complement(556135..556464)
FT                   /locus_tag="SP670_0596"
FT   CDS_pept        complement(556135..556464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0596"
FT                   /product="BlpT protein, fusion"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90667"
FT                   /protein_id="ADM90667.1"
FT                   /translation="MTDTDPIKRAQTLITDLNKAYQACKQATADDVRFQEQLNSILGFL
FT                   AKAETVDNRFLIELEKFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            556741..557079
FT                   /locus_tag="SP670_0597"
FT   CDS_pept        556741..557079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0597"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90668"
FT                   /protein_id="ADM90668.1"
FT                   /translation="MKHMIIQTQKTVYKVNVDDVYYIQTHPTKAHTVKIVTEEASFNMV
FT                   QNLSNLENQYGETLMRCHRNCLVNLDKVKSIDFQERILFLGEEGQYAVKYARRRYREIR
FT                   QKWLKEGE"
FT   gene            557084..557821
FT                   /locus_tag="SP670_0598"
FT   CDS_pept        557084..557821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0598"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90669"
FT                   /protein_id="ADM90669.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKEHHITLSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIRDRDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANGQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   STRPHRVILYTKTDRLEFTASLEEVLKQEPRFLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINNLH"
FT   gene            557835..559175
FT                   /locus_tag="SP670_0599"
FT   CDS_pept        557835..559175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0599"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90670"
FT                   /protein_id="ADM90670.1"
FT                   /translation="MNVAWILLYTLVTHGLKIVIFFKVDGISLTFERIFKAFLFKILLA
FT                   VVFGMLGYMVGNVYLSYFMEPLYGIGLSFLLLRELPKKLLLFYGLFPMILVNLFYRGVS
FT                   YFVLPFLGQGQVYDDYSFIWLCIIIFNFFISLAFLKWLDYDFTSLRKGILDKDFQKSLT
FT                   QINWIMGAYYLVIQNLSYFEYEQGIQSTTVRHLILVFYLLFFMGIIKKLDTYLKDKLHE
FT                   RLNQEQDLRYREMERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIKEIYDS
FT                   VLKDSSEKLQDNKYDLGRLVNVRDRALKSLLAGKFIKARDKNIVFNVEVPEEIQVEGVS
FT                   LLDFLTVVSILCDNAIEASVEACQPHVSIAFFKNGAQETFIIENSIKEEGIDISEIFSF
FT                   GASSKGEERGVGLYTVMKIVESHPNTSLNTTCQDHVFRQVLTVIHIE"
FT   gene            complement(559219..559374)
FT                   /locus_tag="SP670_0600"
FT   CDS_pept        complement(559219..559374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0600"
FT                   /product="double glycine cleavage site bacteriolysin
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90671"
FT                   /protein_id="ADM90671.1"
FT                   /translation="MDKKQNLTSFQELTTTELNQIIGGGWWEDFLYRFNIIEQKNTKGF
FT                   YQPIQL"
FT   gene            complement(559431..560792)
FT                   /locus_tag="SP670_0601"
FT   CDS_pept        complement(559431..560792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0601"
FT                   /product="BlpC ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90672"
FT                   /protein_id="ADM90672.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVFIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEIAPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALAT
FT                   QLQRLEKQKEGLGILKQSLEKATDLFSSEDEFGYHNTFMNFTKQSHDIELGISKTNTEV
FT                   SNQANLTNSSSSAIEQEITKVQQQIGEYQELRDAIINNRARLPTGNPHQSILNRYLIAS
FT                   QGQTQGTAEEPFLSQINQSIAGLESSIASLKIQQAGIGSVATYDNSLATKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLENNTLTAPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQSIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTTKKTYFDYFKDKILTHSD"
FT   gene            complement(560803..562956)
FT                   /locus_tag="SP670_0602"
FT   CDS_pept        complement(560803..562956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0602"
FT                   /product="transport/processing ATP-binding protein ComA"
FT                   /EC_number="3.4.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90673"
FT                   /protein_id="ADM90673.1"
FT                   /translation="MTSYKRTFVPQIDARDCGVAALASIAKFYGSDFSLAHLRELAKTN
FT                   KEGTTALGIVKAADEMGFETRPVQADKTLFDMSDVPYPFIVHVNKEGKLQHYYVVYQTK
FT                   KDYLIIGDPDPSVKITKMSKERFFSEWTGVAIFLAPKPSYQPHKDKKNGLLSFLPLIFK
FT                   QKSLIAYIVLSSLLVTIINIGGSYYLQGILDEYIPNQMKSTLGIISVGLVITYILQQVM
FT                   SFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANSIIDALAS
FT                   TILSLFLDVSILILVGGVLLAQNPNLFLLSLLSIPIYMFIIFSFMKPFEKMNHDVMQSN
FT                   SMVSSAIIEDINGIETIKSLTSEENRYQNIDSEFVDYLEKSFKLSKYSILQTSLKQGTK
FT                   LVLNILILWFGAQLVMSSKISIGQLITFNTLFSYFTTPMENIINLQTKLQSAKVANNRL
FT                   NEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYGFGRDTLTDINLTIKQGDKVSLVG
FT                   VSGSGKTTLAKMIVNFFEPYKGHISINYQDIKNIDKKVLRRHINYLPQQAYIFNGSILE
FT                   NLTLGGNHMISQEDILRACELAEIRQDIERMPMGYQTQLSDGAGLSGGQKQRIALARAL
FT                   LTKAPVLILDEATSGLDVLTEKKVIDNLISLTDKTILFVAHRLSIAERTNRVIVLDQGK
FT                   IIEVGSHQELMQAQGFYHHLFNK"
FT   gene            563237..563440
FT                   /locus_tag="SP670_0603"
FT   CDS_pept        563237..563440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90674"
FT                   /protein_id="ADM90674.1"
FT                   /translation="MNTKMMEQFSVMDNEMLDRIEGGIFGVDDALFWAGLGYVAGSIVD
FT                   TAIDDFTNQCRKNPHQWFCVRV"
FT   gene            563758..563961
FT                   /locus_tag="SP670_0604"
FT   CDS_pept        563758..563961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90675"
FT                   /protein_id="ADM90675.1"
FT                   /translation="MEKIDYITLNEVELETISGGDDCFIGDIGCIGWGLLKSIGGMIKP
FT                   APYVPPVCIPKSSWNPAPPVPC"
FT   gene            564535..564699
FT                   /locus_tag="SP670_0605"
FT   CDS_pept        564535..564699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90676"
FT                   /protein_id="ADM90676.1"
FT                   /translation="MKKKILIIFILYLIMSIFLYPLRESIWYQLFYTIAYVIAVMIYFA
FT                   LTKKKGAKK"
FT   gene            564964..565152
FT                   /locus_tag="SP670_0606"
FT   CDS_pept        564964..565152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0606"
FT                   /product="mobile genetic element"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90677"
FT                   /protein_id="ADM90677.1"
FT                   /translation="MNYEGSKQLTDARFKCLVGVQRTTFEEMLAVLKTAYQLKHAKGGR
FT                   KPKLSLEDLLMGTLQYV"
FT   gene            565304..565849
FT                   /locus_tag="SP670_0607"
FT   CDS_pept        565304..565849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0607"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90678"
FT                   /protein_id="ADM90678.1"
FT                   /translation="MMRRKYKSIALKKELANYSGKKKCHAMKAQAIVTSQGRIVSLDIT
FT                   VNYCHDMKLFKMSRRNIGQAGKILTDSDYQGPMKIYPQAQTPRKASKLKPLTAEDKACN
FT                   HALSKDRSKVENILAKVKTFKMFSTTYRNHRKRFGLRMNLIAGIINHELGFWFRRKSNV
FT                   IFAIQDVSMTIQDLDEKF"
FT   gene            565921..566175
FT                   /locus_tag="SP670_0608"
FT   CDS_pept        565921..566175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0608"
FT                   /product="BlpM"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90679"
FT                   /protein_id="ADM90679.1"
FT                   /translation="MDTKIMEQFHEMDITMLSSIEGGKNNWQTNVLEGGGAAFGGWGLG
FT                   TAICAASGVGAPFMGACGYIGAKFGVALWAGVTGATSGF"
FT   gene            566191..566394
FT                   /locus_tag="SP670_0609"
FT   CDS_pept        566191..566394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0609"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90680"
FT                   /protein_id="ADM90680.1"
FT                   /translation="MNTYCNINETMLSEVYGGNSGGAAVVAALGCAAGGVKYGRLLGPW
FT                   GAAIGGIGGAVVCGYLAYTATS"
FT   gene            566638..566871
FT                   /locus_tag="SP670_0610"
FT   CDS_pept        566638..566871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90681"
FT                   /protein_id="ADM90681.1"
FT                   /translation="MDTKMMSQFSVMDNEMLVRTEDGDVSDIYRGYANQRSPFASYPSI
FT                   LKNSGPFPVSGYCLRGYHDRGYIGAGFHLCGI"
FT   gene            566903..567592
FT                   /locus_tag="SP670_0611"
FT   CDS_pept        566903..567592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0611"
FT                   /product="BlpY protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90682"
FT                   /protein_id="ADM90682.1"
FT                   /translation="MKKYQLLFKISAVFSYLFFVFGLSQLTLIVQNYWQFSSQIGNFVW
FT                   IQNILSLLFSGVMIWILVKTGHGYLFRIPRKKWLWYSILTVLVVVLHISFNVQTAKHVQ
FT                   STAEGWNVLIGYSGTNFAELGIYVTLFFLTPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFLSLPSLLDIFVFATFGIIFAGLTRYTKSIYPSYAVHVINNIVATFPFLLT
FT                   FLHRVLG"
FT   gene            568018..568629
FT                   /locus_tag="SP670_0612"
FT   CDS_pept        568018..568629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0612"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90683"
FT                   /protein_id="ADM90683.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGLAYKKSQNLWVSTLVHMFYNSWPLLYYL"
FT   gene            568790..569584
FT                   /locus_tag="SP670_0613"
FT   CDS_pept        568790..569584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0613"
FT                   /product="phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90684"
FT                   /protein_id="ADM90684.1"
FT                   /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGLA
FT                   REQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLS
FT                   RLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHS
FT                   NWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKL
FT                   YWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
FT   gene            569581..570216
FT                   /gene="trmB"
FT                   /locus_tag="SP670_0614"
FT   CDS_pept        569581..570216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="SP670_0614"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90685"
FT                   /protein_id="ADM90685.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            570342..570821
FT                   /locus_tag="SP670_0615"
FT   CDS_pept        570342..570821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90686"
FT                   /protein_id="ADM90686.1"
FT                   /translation="MDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDK
FT                   PEGITLNDTADLTEIISPVLDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYI
FT                   HVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVRIPYSLVSKARLAVKL"
FT   gene            570865..572001
FT                   /gene="nusA"
FT                   /locus_tag="SP670_0616"
FT   CDS_pept        570865..572001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SP670_0616"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90687"
FT                   /protein_id="ADM90687.1"
FT                   /translation="MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSV
FT                   AIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGR
FT                   VAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSK
FT                   QDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEI
FT                   MSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIE
FT                   ENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            572023..572316
FT                   /locus_tag="SP670_0617"
FT   CDS_pept        572023..572316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90688"
FT                   /protein_id="ADM90688.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            572309..572608
FT                   /locus_tag="SP670_0618"
FT   CDS_pept        572309..572608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0618"
FT                   /product="ribosomal protein HS6-type"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90689"
FT                   /protein_id="ADM90689.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   PNLAKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            572625..575417
FT                   /locus_tag="SP670_0619"
FT   CDS_pept        572625..575417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0619"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90690"
FT                   /protein_id="ADM90690.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAEPVAPKTEKVAAK
FT                   PQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNRRFN
FT                   DQAKKQQGQQKRRNERRQQEDKRSNQVAPRIDFKARAAALKAEQNAEYARSSEERFKQY
FT                   QAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKKQARPD
FT                   KNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTPKPVTER
FT                   KFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVD
FT                   YGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSR
FT                   VATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDG
FT                   VMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEI
FT                   SAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLN
FT                   VQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSAR
FT                   AAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADVQGSVEALSASLQK
FT                   IDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHS
FT                   IIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKV
FT                   RVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAYVMEEIKR
FT                   "
FT   gene            575668..576018
FT                   /gene="rbfA"
FT                   /locus_tag="SP670_0620"
FT   CDS_pept        575668..576018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SP670_0620"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90691"
FT                   /protein_id="ADM90691.1"
FT                   /translation="MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDL
FT                   SVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGN
FT                   KIDEMLRNLDKN"
FT   gene            576297..577076
FT                   /locus_tag="SP670_0621"
FT   CDS_pept        576297..577076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90692"
FT                   /protein_id="ADM90692.1"
FT                   /translation="MAEQDLAMQVLQQVVKLPVVKVDSSKFLVDKFSKELGPQDIPTLL
FT                   EQGPTSLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITIPADVAQFYAFSL
FT                   KLAQELGYIYGYEDLWVSREELSEDAQNTLLLYLGVMLGVNGTAALLRAGGITIAKQVM
FT                   KTVPNKALTKTLWYPILKKVLKIFGVNLTKGGLAKGMGKFIPILGGIISGGLTFATMKP
FT                   MGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIEGE"
FT   gene            577078..577260
FT                   /locus_tag="SP670_0622"
FT   CDS_pept        577078..577260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90693"
FT                   /protein_id="ADM90693.1"
FT                   /translation="MGLIKTLAKIYGNYFLTVQGVKVMKTIKKADHVVVGLGKLFIADK
FT                   LMDTARWLIKPEERE"
FT   gene            complement(577525..577722)
FT                   /locus_tag="SP670_0623"
FT   CDS_pept        complement(577525..577722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0623"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90694"
FT                   /protein_id="ADM90694.1"
FT                   /translation="MKIKEQTRKLAAGCLKQCFEVVDRTDEVSSKHRFEVVDRTDEVSS
FT                   KHRFEVVDRTDEVSNIYTAR"
FT   gene            577753..577986
FT                   /locus_tag="SP670_0624"
FT   CDS_pept        577753..577986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90695"
FT                   /protein_id="ADM90695.1"
FT                   /translation="MDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRK
FT                   VSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            577986..579320
FT                   /locus_tag="SP670_0625"
FT   CDS_pept        577986..579320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0625"
FT                   /product="hemerythrin HHE cation binding domain subfamily,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90696"
FT                   /protein_id="ADM90696.1"
FT                   /translation="MTDERIHVLRDILLELHNGASPESVQDRFDATFTGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVSDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYESMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESILLMIL
FT                   LESFTQDDWLQIAEESDAYGYAIIRPSEKWVPERQIFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKEDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKAIMKGLREGTKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDENGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            579330..579584
FT                   /locus_tag="SP670_0626"
FT   CDS_pept        579330..579584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90697"
FT                   /protein_id="ADM90697.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKVGKGFHDLPEGLFGERNY"
FT   gene            579680..580075
FT                   /locus_tag="SP670_0627"
FT   CDS_pept        579680..580075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90698"
FT                   /protein_id="ADM90698.1"
FT                   /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQSASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASDFKNW
FT                   TEKELLALKGIGPATIKKLKENGIKFK"
FT   gene            580488..580937
FT                   /locus_tag="SP670_0628"
FT   CDS_pept        580488..580937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0628"
FT                   /product="conserved protein/domain typically associated
FT                   with flavoprotein oxygenase, Dim6/ntab family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90699"
FT                   /protein_id="ADM90699.1"
FT                   /translation="MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKL
FT                   ERLGVHYEISERTQISILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPEFLDEKG
FT                   HFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN"
FT   gene            580924..581481
FT                   /locus_tag="SP670_0629"
FT   CDS_pept        580924..581481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0629"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90700"
FT                   /protein_id="ADM90700.1"
FT                   /translation="MARTELSDKIETERLVLRVRTVADAEDIHAYASLPEVAYPAGFPP
FT                   VKTLEDEIYYLEHILPERNQKENLPAGYGIVVKGTDKIAGSVDFNHRYGDDVLELGYTL
FT                   HSDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSKRVAEKLGFTLEARIRDR
FT                   KDAQGNCCDDLRYALLKSEWEE"
FT   gene            581483..582445
FT                   /locus_tag="SP670_0630"
FT   CDS_pept        581483..582445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90701"
FT                   /protein_id="ADM90701.1"
FT                   /translation="MSDVKEEVSSLSEKQLRQIDVEYAELNDSDIIERLAYLEINNNEK
FT                   RIVISDIEPTKEIMSVSDQIFEIQKNFQKIKNMFELFISDVSDFLSIKNKLESKELEIE
FT                   EADVNRFMIHLLSSGKLFVDFNENQIKQKYSKDSEEFDCIHGFASYQYDINFTYRFCHS
FT                   LRNYSQHTDLPINEVKAVSPDDETVIIDFYIDLDYLLNSNFKWKKLKGELIKLNQETSK
FT                   IDAIALVKEYFNALTELYGNYNKLFLKLNHNTLVDIKSKLESLKLKHSRYYISKISKYD
FT                   LKYNPGNYTMSPLAAFAEIEEIYIELSKIGLVKIVNKSN"
FT   gene            582457..585108
FT                   /gene="valS"
FT                   /locus_tag="SP670_0631"
FT   CDS_pept        582457..585108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SP670_0631"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90702"
FT                   /protein_id="ADM90702.1"
FT                   /translation="MSKELSSKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIS
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQ
FT                   GRKMSKSLGNGIDPMDVIDKYGTDSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVT
FT                   EEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKNLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADL
FT                   LNVEEELARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDAT
FT                   VARIDEMKKLVK"
FT   gene            585178..585933
FT                   /locus_tag="SP670_0632"
FT   CDS_pept        585178..585933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90703"
FT                   /protein_id="ADM90703.1"
FT                   /translation="MSKHPHYELLNLIGYGLAKFDKLFIKEFQCSSKSEFYRYVVSLGI
FT                   AETTGVVKNRMDLFDPYFDNNRKGWWQKAEVYRFRKDLIDMMFGNEDVHSYAEIVKMLL
FT                   ASEGKKTGITIVEKPIVRTKFKRLQETGMEAENYFILHFDKEEKFQGGQLTDARLYGDG
FT                   YDFQVDVQEYSYLAEVKGIRKSKGRVRLTAKEFEKVKEFQSDFILSLVTNLDDIPKLVL
FT                   IDNPLKHFEFKKNIIKNEIIEYRSVEDLY"
FT   gene            586218..587021
FT                   /locus_tag="SP670_0633"
FT   CDS_pept        586218..587021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0633"
FT                   /product="Fic protein family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90704"
FT                   /protein_id="ADM90704.1"
FT                   /translation="MQPTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAEK
FT                   QSRGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPATLLAIHKEL
FT                   FQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYATLT
FT                   QADVVKQIQHFISGIWQIHPFREGNTRTVTVFLIQYLREFGFDIDNTPFQQHSKYFRDA
FT                   LVLDNAKILQRRSEFLTAFFENLLLGGQNDLSSEKMYLDLDLDFS"
FT   gene            complement(587137..587355)
FT                   /locus_tag="SP670_0634"
FT   CDS_pept        complement(587137..587355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90705"
FT                   /protein_id="ADM90705.1"
FT                   /translation="MSRKGNSQDNGMMESFFGILKSEMFYGYEKTFKSLNQLEQAIVDY
FT                   IDYYNNKRIKVKLKGLSLVQYRTKSFG"
FT   gene            complement(587319..587624)
FT                   /locus_tag="SP670_0635"
FT   CDS_pept        complement(587319..587624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0635"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90706"
FT                   /protein_id="ADM90706.1"
FT                   /translation="MEKCYTDVTEFAIPASTQKLYLSPVLDGFNSEIIAYNLSTSPNLE
FT                   QVQTMLEQAFTEKYYENTILHSDQGWQYRHDSYHRFLRVREFKHLCHARETAKTTV"
FT   gene            complement(587686..587958)
FT                   /locus_tag="SP670_0636"
FT   CDS_pept        complement(587686..587958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90707"
FT                   /protein_id="ADM90707.1"
FT                   /translation="MTEFSLDLLLKAIKLARSTYYYHLKQLDKPDKDQELKAEIQSIFI
FT                   EHKGNYAYRCIHLELRNRGYLVNHKRVQGLMKVLNLQAKMRQKRK"
FT   gene            complement(588184..588396)
FT                   /locus_tag="SP670_0637"
FT   CDS_pept        complement(588184..588396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0637"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90708"
FT                   /protein_id="ADM90708.1"
FT                   /translation="MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNIRYMIKLIDRY
FT                   GIEFVKKGKNRYYSPDLKQEMINKV"
FT   gene            588643..589908
FT                   /locus_tag="SP670_0638"
FT   CDS_pept        588643..589908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90709"
FT                   /protein_id="ADM90709.1"
FT                   /translation="MAVFVSLDGIVVEVLDVFSSFNGDSEFFLCKRLKDKSQFVMERSQ
FT                   FEEMFQLQSSRLTTQEKLQLFTSVFAGRYDVYAKSFINDQGKIQYFPSYDCGWKQLLPE
FT                   KRSFQTLTDSVLKSHFRGETAIGIFPMHLDDSCHFLVLDFDEGDWKEAGLTIRRIARER
FT                   QMEAHLEISRSGHGLHIWFFFEEAIPSREARLFGKKLIELAMQESMQLSFDSFDRMFPN
FT                   QDVLPKGGFGNLIALPFQGEAYHQVRTVFVDEHFQPYGDQWRYLQGIQKISTAKVALLI
FT                   QEELGKQELDKELKVVLSNMIQLKKSSVTPKTLFFLKNMASFSNPEFYLKQAMRQPTYQ
FT                   IPERMYLFGESDYYLWLPRGLLYPLQDKFKQVVVEDRRKVQRSIRVAFKGELTLEQELA
FT                   LSDMNSKENGLLHAGQVLERAF"
FT   gene            590124..591320
FT                   /locus_tag="SP670_0639"
FT   CDS_pept        590124..591320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90710"
FT                   /protein_id="ADM90710.1"
FT                   /translation="MIQSLFKLENSQSLLDEYEMMIVDECHHISALMFEKVVAQLRGKY
FT                   LYGLTATPERKNGHEPIVFQRIGEILHTADKRETDFKRQLQLRFTSFGHLEIEKTKASN
FT                   FIQLSDWIATDSARNQLILKDILAQVAEGRNILGLVNRIQQIDVFEKLLKEKEVDDCYI
FT                   ISGKTKVRERTSLLETLEQLDKGFVLLSTGKYIGEDFDLPQLDTLILAAPFSWKNNLIQ
FT                   YAGRIHRNYKDKSLVRIFDYVDIHVPYLEKMFQKRQVAYRKMDYRVIEGEEKQFVYVDS
FT                   RYEKVLREDLAGERQECLLILPYVHQTKLMNFLKEFRISQIEICIPETVANKAWLDQLK
FT                   SQKIKVSFTQSKIVTPILLVNKTIVWYGAMPLLGKVDEMTILRLESASIVSELVAGLR"
FT   gene            591620..592459
FT                   /locus_tag="SP670_0640"
FT   CDS_pept        591620..592459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0640"
FT                   /product="transcription antiterminator LicT"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90711"
FT                   /protein_id="ADM90711.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKTGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGIIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            592477..594315
FT                   /locus_tag="SP670_0641"
FT   CDS_pept        592477..594315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0641"
FT                   /product="PTS system beta-glucoside-specific EIIABC"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90712"
FT                   /protein_id="ADM90712.1"
FT                   /translation="MSYKDTVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVVQGHKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGAPVTPASYGSSVVPILIMVWLMK
FT                   YIEKMIAKLTPAVTKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYGVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDVPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVKA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            594328..595743
FT                   /locus_tag="SP670_0642"
FT   CDS_pept        594328..595743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0642"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90713"
FT                   /protein_id="ADM90713.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLIGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWVDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKENDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGSGTLNRYKKMSFTWY
FT                   KEVIESNGESLFK"
FT   gene            596225..597271
FT                   /gene="pheS"
FT                   /locus_tag="SP670_0643"
FT   CDS_pept        596225..597271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SP670_0643"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90714"
FT                   /protein_id="ADM90714.1"
FT                   /translation="MSTIEEQLKALREETLASLKQITAGNEKEMQDLRVSVLGKKGSLT
FT                   EILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKKVAAQLASESIDVTLPG
FT                   RPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDT
FT                   FYITEEILLRTHTSPVQARAMDAHDFSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGL
FT                   VVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEVDVSCFKCGGEGCNI
FT                   CKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAMLRYGINDIRGFYQGD
FT                   VRFSEQFK"
FT   gene            597271..597780
FT                   /locus_tag="SP670_0644"
FT   CDS_pept        597271..597780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0644"
FT                   /product="protease synthase and sporulation negative
FT                   regulatory protein PAI 1"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90715"
FT                   /protein_id="ADM90715.1"
FT                   /translation="MIIKVEMADVEVLAKIAKQTFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGL
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            597857..600259
FT                   /gene="pheT"
FT                   /locus_tag="SP670_0645"
FT   CDS_pept        597857..600259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SP670_0645"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90716"
FT                   /protein_id="ADM90716.1"
FT                   /translation="MLISYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESPAAGLSKI
FT                   VVGEVLSCEDVPETHLHVCQVNVGEEERQIVCGAPNVRAGIKVMVALPGARIADNYKIK
FT                   KGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDDEIIE
FT                   LSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETNEAAADALSVSIETDKAPYYA
FT                   ARILDNVTITPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDNFEGTDI
FT                   RVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKSSRVVLEA
FT                   AVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASLIAELAGATVRKGIVS
FT                   AGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVRVPRRRWD
FT                   ITIEADLFEEIARIYGYDRLPTSLPKDDGTAGELTATQKLRRQVRTIAEGAGLTEIITY
FT                   TLTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALYE
FT                   IGKVFEQTGNPKEELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYAKGILEALFTRLG
FT                   LQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAIE
FT                   AALQPATPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSGE
FT                   KLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR"
FT   gene            complement(600327..601328)
FT                   /locus_tag="SP670_0646"
FT   CDS_pept        complement(600327..601328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0646"
FT                   /product="endonuclease/exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90717"
FT                   /protein_id="ADM90717.1"
FT                   /translation="MIKTFLSALSVILFSIPIITYSFFPSSNLNIWLSTQPILAQIYAF
FT                   PLATATMAAILSFLFFFLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNALPP
FT                   FERGTWNSQSPKLFNATIDHILLPKNHYYVKDLDIVSFQNSDHRCIFTEITF"
FT   gene            601484..601978
FT                   /locus_tag="SP670_0647"
FT   CDS_pept        601484..601978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0647"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90718"
FT                   /protein_id="ADM90718.1"
FT                   /translation="MQDNYTTKGKHLTIDSRRLIERWKKEGKSNREIASLLGKAPQTIH
FT                   TEIKYGTVRKCLGKGRFKEVYSADYAQQSYENNRKHSVKRSSLTKELKEKILHYHNQKF
FT                   LPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPRKGKSVKKQVSPNFKPADQSIE
FT                   S"
FT   gene            602057..602323
FT                   /locus_tag="SP670_0648"
FT   CDS_pept        602057..602323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0648"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90719"
FT                   /protein_id="ADM90719.1"
FT                   /translation="MEGCLSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEEVS
FT                   GVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLEQGKS"
FT   gene            602584..604833
FT                   /gene="metE"
FT                   /locus_tag="SP670_0649"
FT   CDS_pept        602584..604833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SP670_0649"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90720"
FT                   /protein_id="ADM90720.1"
FT                   /translation="MSTTIVGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAKH
FT                   WNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGEK
FT                   GDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKEIGLNTRPVLVGPFT
FT                   FLQLSDFEEGVKADDFVDSLVAAYQEVFAKLAELGATCIQLDEAALVKDLTAEEKALFL
FT                   NLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGFDFVEGKKTLELVKGGFPA
FT                   DKTLYAGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPALL
FT                   NHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAGLTDTDYT
FT                   RLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAET
FT                   IDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIW
FT                   GDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIK
FT                   DEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHT
FT                   HMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDELKAKNFQTEVGPGVYDIHSPRVP
FT                   NEGEIDNTIEAILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            604897..605763
FT                   /gene="metF"
FT                   /locus_tag="SP670_0650"
FT   CDS_pept        604897..605763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SP670_0650"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90721"
FT                   /protein_id="ADM90721.1"
FT                   /translation="MSRQTPSLSFEVFPPNPAVGNGNIISALQDMQELAPHFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIEFIKEQTPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            606448..608661
FT                   /locus_tag="SP670_0651"
FT   CDS_pept        606448..608661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0651"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90722"
FT                   /protein_id="ADM90722.1"
FT                   /translation="MAKQVFQTTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAVM
FT                   SKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINP
FT                   SQEQAEQSLLELTVAGTKHAVNMVESGAKELSEEIMLEALLKGHEAVKELIAFQEEIVA
FT                   AVGKEKAEVELLHVDAELQAEIIAAYNSDLQKAVQVEEKLAREAATQVVKDQVTAVYEE
FT                   KYADHEEFDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRV
FT                   HGSGLFTRGQTQALSVLTLAPMGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAP
FT                   GRREIGHGALGERALAQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGNNYTVLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGI
FT                   TAEILTEALAQAKKARFEILDVIEATIPEVRLELAPTAPKIDTIKIDVDKIKIVIGKGG
FT                   ETIDKIIAETGVKIDIDEEGNVSIYSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKA
FT                   LLPRPPKPEHDEKGEKSERPHRPRHHKDHKPKKEFTETPKDSE"
FT   gene            608677..609294
FT                   /gene="cysE"
FT                   /locus_tag="SP670_0652"
FT   CDS_pept        608677..609294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SP670_0652"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90723"
FT                   /protein_id="ADM90723.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   YDFKLLARMHSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHEVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            609306..610190
FT                   /locus_tag="SP670_0653"
FT   CDS_pept        609306..610190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0653"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90724"
FT                   /protein_id="ADM90724.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGELVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFERETASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYQLAKLSNLEVLLADSSYQEQ
FT                   ISQLKFQAFSGEHESREVVDRYVAEALKDPESRLYILLKDGQVIGTCTVDLSSDTNYFY
FT                   GLAISEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            610277..611620
FT                   /gene="cysS"
FT                   /locus_tag="SP670_0654"
FT   CDS_pept        610277..611620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SP670_0654"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90725"
FT                   /protein_id="ADM90725.1"
FT                   /translation="MIKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTV
FT                   AFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALG
FT                   VKPATRHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLE
FT                   LGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHD
FT                   ALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQN
FT                   FKDKFVAAMDEDFNAANGITVVFEMAKWINSGNYDASVKQALADMLEIFGIVFVEEVLD
FT                   AEIEDLIQKRQEARANRDFATADQIRDQLVTQGIKLLDTKDGVRWTRD"
FT   gene            611613..611999
FT                   /locus_tag="SP670_0655"
FT   CDS_pept        611613..611999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0655"
FT                   /product="ribonuclease III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90726"
FT                   /protein_id="ADM90726.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            612003..612887
FT                   /locus_tag="SP670_0656"
FT   CDS_pept        612003..612887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0656"
FT                   /product="leucine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90727"
FT                   /protein_id="ADM90727.1"
FT                   /translation="MRAKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLASWLD
FT                   MMRTLFPNCQTVLQVGAQDYVFVLQQDKYTSVRDILSDTIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            613024..613623
FT                   /locus_tag="SP670_0657"
FT   CDS_pept        613024..613623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90728"
FT                   /protein_id="ADM90728.1"
FT                   /translation="MQILCYFTITVVANPNNSGEVHLDVSIEDNQGGSGYNFSSVSSSS
FT                   QTAKYEGAGYNNNSSLYITIDKTSDATALLKLKLNNVNNQPATEVPSSGITVKLNAKDN
FT                   AGNWTSASNKKEVTVKIVSAKPTYPDKILVKNPDNIKDTEKNAIIEKLKEANKNHPAGA
FT                   PTFAKGEGEHANDIVATYSDGTTYYVPLNDVTKYAR"
FT   gene            613769..613939
FT                   /locus_tag="SP670_0658"
FT   CDS_pept        613769..613939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0658"
FT                   /product="GBSi1, group II intron, maturase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90729"
FT                   /protein_id="ADM90729.1"
FT                   /translation="MKSIVTSIDERLRTRLRVIIWKQWKKKSRRLWGLLKLGVPKWIAD
FT                   KVSGWGDHYQL"
FT   gene            614295..615572
FT                   /locus_tag="SP670_0659"
FT   CDS_pept        614295..615572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0659"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90730"
FT                   /protein_id="ADM90730.1"
FT                   /translation="MNPIQRSWAYVSRKRLRSFILFLILLVLLAGISACLTLMKSNKTV
FT                   ESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLENVSPELETVAKLKDKEAVTGE
FT                   QSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLKEGRHLQKGDSKKILIHEELAK
FT                   KNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQEKFTGLSSDFSENQVFTDYES
FT                   SQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALENQGYQVEKENKAFEQIKDSVA
FT                   TFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGILLALGKGKSSIFLQFCLEVVL
FT                   VSLGALLPAFVAGNGITTYLLQTLLASGDQASLQDTLAKASSLSTSILSFAESYVFLVL
FT                   LSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            615585..616232
FT                   /locus_tag="SP670_0660"
FT   CDS_pept        615585..616232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0660"
FT                   /product="ABC transporter, ATP-binding protein Vexp2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90731"
FT                   /protein_id="ADM90731.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQIDYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIRLV
FT                   NKKASKNTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            616284..617663
FT                   /locus_tag="SP670_0661"
FT   CDS_pept        616284..617663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0661"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90732"
FT                   /protein_id="ADM90732.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFITESILIAIPALVSAYFLANYTARAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            617975..618631
FT                   /locus_tag="SP670_0662"
FT   CDS_pept        617975..618631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0662"
FT                   /product="VncR, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90733"
FT                   /protein_id="ADM90733.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASIAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCILTVRNVGYKLERK"
FT   gene            618628..619956
FT                   /locus_tag="SP670_0663"
FT   CDS_pept        618628..619956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0663"
FT                   /product="VncS, histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90734"
FT                   /protein_id="ADM90734.1"
FT                   /translation="MKRTGLFAKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQSIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGGTMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMDLDSQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKDRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTQNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENRLTFFIDFPKVAQD"
FT   gene            620097..620978
FT                   /gene="fba"
FT                   /locus_tag="SP670_0664"
FT   CDS_pept        620097..620978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SP670_0664"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90735"
FT                   /protein_id="ADM90735.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(621299..622489)
FT                   /locus_tag="SP670_0665"
FT   CDS_pept        complement(621299..622489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0665"
FT                   /product="NAD-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90736"
FT                   /protein_id="ADM90736.1"
FT                   /translation="MKSVKGLLFIIASFILTLLTWMNTSPQFMIPGLALTSLSLTFILA
FT                   TRLPLLESWFHGLEKVYTVHKFTAFLSIILLIFHNFSMGGLWGSRLAAQFGNLAIYIFA
FT                   SIILVAYLGKYIQYEAWRWIHRLVYLAYILGLFHIYMIMGNRLLTFNLLSFLVGSYALL
FT                   GLLAGFYIIFLYQKISFPYLGKITHLKRLNHDTREIQIHLSRPFNYQSGQFAFLKIFQE
FT                   GFESAPHPFSISGGHGQTLYFTVKNSGDHTKNIYDNLQAGSKVTLDRAYGHMIIEEGRE
FT                   NQVWIAGGIGITPFISYIREHPILDKRVHFYYSFRGEENAVYLDLLRDYAQKNPNFELH
FT                   LIDSTKDGYLNFEQKEVPEHATVYMCGPISMMKALAKQIKKQNPKTELIYEGFKFK"
FT   gene            complement(622633..623292)
FT                   /locus_tag="SP670_0666"
FT   CDS_pept        complement(622633..623292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0666"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90737"
FT                   /protein_id="ADM90737.1"
FT                   /translation="MESILEILTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMR
FT                   NGKNPILRIISSIYIEFVRNVPNLLWIFTIFLVFKMKSTPAGITAFTLFTSAALAEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISNLSHMLAKRWQQAAE"
FT   gene            complement(623302..623979)
FT                   /locus_tag="SP670_0667"
FT   CDS_pept        complement(623302..623979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0667"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90738"
FT                   /protein_id="ADM90738.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAIGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKA
FT                   YSL"
FT   gene            complement(623976..624785)
FT                   /locus_tag="SP670_0668"
FT   CDS_pept        complement(623976..624785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0668"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90739"
FT                   /protein_id="ADM90739.1"
FT                   /translation="MKKKFFLSALLISLFGLAAAKPVQADTSIADIQKRGELVVGVKQD
FT                   VPNFGYKDPKTGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATF
FT                   TITDERKKLYNFTSPYYTDASGFLVNKSAKIKKIEDLNGKTIGVAQGSITQRLITELGK
FT                   KKGLKFKFVELGSYPELITSLHAHRIDAFSVDHSILSGYTSKRTALLDDSFKPSDYSIV
FT                   TKKSNTELNDYLDNLVTKWSRMVVCRNFMTVTSSNHLVIPQIKEDTL"
FT   gene            complement(624796..625554)
FT                   /locus_tag="SP670_0669"
FT   CDS_pept        complement(624796..625554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0669"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90740"
FT                   /protein_id="ADM90740.1"
FT                   /translation="MALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSGKSTL
FT                   IRTINGLETVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNIYPHKTVLENVTLA
FT                   PIKVLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAMLSGGQKQRIAIARGLAMHPELLLF
FT                   DEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTT
FT                   DVDNFFDNPSKPRAQQFLSKIINHESDKVK"
FT   gene            625819..628053
FT                   /gene="recJ"
FT                   /locus_tag="SP670_0670"
FT   CDS_pept        625819..628053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="SP670_0670"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90741"
FT                   /protein_id="ADM90741.1"
FT                   /translation="MDVFLITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGI
FT                   QDQESLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASI
FT                   VKESLEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALA
FT                   QSMGVDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQV
FT                   ELLDLVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIAANEVTEETV
FT                   GFQIAPRLNALGRLDDPNPAIDLLTGFDDEEAHEIALMIHQKNEERKEIVQSIYEEAKT
FT                   MVDPEKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIF
FT                   EALDPHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEEL
FT                   DLEALSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASF
FT                   EVVAFGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNA
FT                   VLPEGVPVLDFPGELPNLAASEAIVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYY
FT                   LTGYGTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIK
FT                   DGVMTVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            628271..629890
FT                   /locus_tag="SP670_0671"
FT   CDS_pept        628271..629890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0671"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90742"
FT                   /protein_id="ADM90742.1"
FT                   /translation="MEKICTLLKLESPIFVLNVGLKYPENEQLGVDVVIPNMDYLFENS
FT                   DRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVKGNDAVKKFNDFHVI
FT                   DENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKFDQTASESYATDFAR
FT                   LAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGRIIVAAVSSNLSRIQ
FT                   QIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPKDMSRFEDHELIILE
FT                   TGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVARVENMIYQAGGVVK
FT                   LITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKAAMAVGMLPERIFIP
FT                   KKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVLSEDGIFIVAITVNR
FT                   REKKIVARARVHTRGFVYLKKSRDILRESSELINQTVEDYLQGDDFDWADLKGKVRDNL
FT                   TKYLFDQTKRRPAILPVVMEAK"
FT   gene            629959..630738
FT                   /locus_tag="SP670_0672"
FT   CDS_pept        629959..630738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0672"
FT                   /product="tributyrin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90743"
FT                   /protein_id="ADM90743.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGMNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYTALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALATNRFSHAASFSGALSFQNFSPESQNLGSPA
FT                   YWRGVFGEIRDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            630850..632070
FT                   /locus_tag="SP670_0673"
FT   CDS_pept        630850..632070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0673"
FT                   /product="serine/alanine-adding enzyme MurM"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90744"
FT                   /protein_id="ADM90744.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRAVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRTSKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMVWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            632075..633307
FT                   /locus_tag="SP670_0674"
FT   CDS_pept        632075..633307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0674"
FT                   /product="alanine-adding enzyme MurN"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90745"
FT                   /protein_id="ADM90745.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQGLTDLGYQFDGLTTGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSEYMSKLQGEQSKLEEKLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            633396..634097
FT                   /locus_tag="SP670_0675"
FT   CDS_pept        633396..634097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0675"
FT                   /product="proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90746"
FT                   /protein_id="ADM90746.1"
FT                   /translation="MRWLFRLIGAFFSFVWRLFWRLVWIVVLLCVLAFGLLWYLNGDFQ
FT                   GALKQAERSVKIGQQSIDQWEKTGQLPKLSQTDSHQHSEGRWPQASARIYLDPQMDSRF
FT                   QEAYLEAIQNWNQTGAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNLLTGQFLS
FT                   VTVRLNHYYLSNPYYGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFYGIQEEDV
FT                   ANLRKIYETSE"
FT   gene            634137..635981
FT                   /gene="uvrC"
FT                   /locus_tag="SP670_0676"
FT   CDS_pept        634137..635981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="SP670_0676"
FT                   /product="excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90747"
FT                   /protein_id="ADM90747.1"
FT                   /translation="MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHNTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNERYPRLIITRQVKKDGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGV
FT                   PRVVAEAVQRKLNPQGEALPQVAEERVDYQTEGNHNEP"
FT   gene            635971..636804
FT                   /locus_tag="SP670_0677"
FT   CDS_pept        635971..636804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0677"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90748"
FT                   /protein_id="ADM90748.1"
FT                   /translation="MNHKIAILSDVHGNATALEAVIADAKNQGASEYWLLGDIFLPGPG
FT                   ANDLVALLKDLPITASVRGNWDDRVLEVLDGEYGLEYPKEIQSMRMTQFLMERMDPATI
FT                   VWLRSLPLLEKKEIDGLRFSISHNLPDKNYGGDLLVENDTEKFDQLLDAETDVAVYGHV
FT                   HKQLLRYGSQGQQIINPGSIGMPYFNWEALKNHRAQYAVIEVEDGELVNILFRKVAYDY
FT                   EAELEFAKSKGLPFIEMYEELRREDNYQRHNLELLASLIEKHRYVEDVKNFFDFL"
FT   gene            complement(636986..637786)
FT                   /locus_tag="SP670_0678"
FT   CDS_pept        complement(636986..637786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0678"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90749"
FT                   /protein_id="ADM90749.1"
FT                   /translation="MKKFSLLLAILPFLVACENQATPKETSAQKTIVLATAGDVPPFDY
FT                   EDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERA
FT                   EKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKHTDNPA
FT                   TINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPSNYIIF
FT                   SSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            637957..638562
FT                   /locus_tag="SP670_0679"
FT   CDS_pept        637957..638562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0679"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90750"
FT                   /protein_id="ADM90750.1"
FT                   /translation="MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIKDRFRPELLITVGYTDEKLEPSYRLPVDEIIEKR"
FT   gene            638575..639975
FT                   /gene="pepV"
FT                   /locus_tag="SP670_0680"
FT   CDS_pept        638575..639975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="SP670_0680"
FT                   /product="dipeptidase PepV"
FT                   /EC_number="3.4.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90751"
FT                   /protein_id="ADM90751.1"
FT                   /translation="MTAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTSKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGVARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFHFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVVSVSLSEHGHTPHYVPMEDPLVQTLLNIY
FT                   EKQTGFKGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            640029..640607
FT                   /locus_tag="SP670_0681"
FT   CDS_pept        640029..640607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0681"
FT                   /product="uracil DNA glycosylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90752"
FT                   /protein_id="ADM90752.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIEPLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQVLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKDYLPAYFPLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   gene            640767..640919
FT                   /locus_tag="SP670_0682"
FT   CDS_pept        640767..640919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90753"
FT                   /protein_id="ADM90753.1"
FT                   /translation="MKEIAFDAFYQLYQNDQLSLVDVREVDEFAALHLEGAHNLPLSQL
FT                   ADSYD"
FT   gene            640935..641054
FT                   /locus_tag="SP670_0683"
FT   CDS_pept        640935..641054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0683"
FT                   /product="molybdopterin biosynthesis MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90754"
FT                   /protein_id="ADM90754.1"
FT                   /translation="MHYIICKSGMRSARACQFLLEQGYNVINVQGGMLAFEEL"
FT   gene            641225..642550
FT                   /gene="brnQ"
FT                   /locus_tag="SP670_0684"
FT   CDS_pept        641225..642550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SP670_0684"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90755"
FT                   /protein_id="ADM90755.1"
FT                   /translation="MAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAIAGFVF
FT                   SGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTATTAYE
FT                   VGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIVILVVL
FT                   GAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGFSSKKE
FT                   YISTIWVVGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEIFGSTA
FT                   QLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLGLDAII
FT                   KYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIASVLGSSFKVEFL
FT                   ANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   gene            642648..643685
FT                   /locus_tag="SP670_0685"
FT   CDS_pept        642648..643685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0685"
FT                   /product="peptidase, M42"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90756"
FT                   /protein_id="ADM90756.1"
FT                   /translation="MNQTVEYIKELTAIASPTGFTREISNYLVKTLEGFGYQPVRTAKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKLDRIGGFPWNMIEGENCTVHV
FT                   ASTGQKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDVKVSNEKETRALGIEVGDFI
FT                   SFDPRTVVTDTGFIKSRHLDDKVSAAILLNLLRIYKKEKIELPVTTHFAFSVFEEVGHG
FT                   ANSNIPEEVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVALAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVVATERMVDAYLK
FT                   SEAVS"
FT   gene            643687..644157
FT                   /locus_tag="SP670_0686"
FT   CDS_pept        643687..644157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0686"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90757"
FT                   /protein_id="ADM90757.1"
FT                   /translation="MCLICQRIELIKAGQNPYFVKELETGYLVIGDHQYFAGYSLFLAK
FT                   EHVTELHHLKKETRLRFLEEMSLVQEAVAKAFAAEKMNIELLGNGDAHLHWHLFPRRRG
FT                   DMNGHGLKGRGPVWWVPFEEMTAETCQVKPEEIKRLVECLSSEVDKLLEIKE"
FT   gene            644160..644876
FT                   /locus_tag="SP670_0687"
FT   CDS_pept        644160..644876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0687"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90758"
FT                   /protein_id="ADM90758.1"
FT                   /translation="MKKRYLVLTALLALSLAACSQEKAKNEDGEAKTEQTAKADGTVGS
FT                   KSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKA
FT                   MQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKAAADRYSARPGYSEHQTGLAFDVIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAESG
FT                   LSLEEYYGFEGGDYVD"
FT   gene            complement(644873..645064)
FT                   /locus_tag="SP670_0688"
FT   CDS_pept        complement(644873..645064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0688"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90759"
FT                   /protein_id="ADM90759.1"
FT                   /translation="MKINEQTRKLAAGYSKYSFEVANKTDEVSSKHCFEIVDRTDEVSN
FT                   HTHGKATLTWFEEIFEEY"
FT   gene            645196..645621
FT                   /gene="rplK"
FT                   /locus_tag="SP670_0689"
FT   CDS_pept        645196..645621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SP670_0689"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90760"
FT                   /protein_id="ADM90760.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFITKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            645828..646517
FT                   /gene="rplA"
FT                   /locus_tag="SP670_0690"
FT   CDS_pept        645828..646517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SP670_0690"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90761"
FT                   /protein_id="ADM90761.1"
FT                   /translation="MAKKSKQLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   gene            complement(647163..647444)
FT                   /locus_tag="SP670_0691"
FT   CDS_pept        complement(647163..647444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0691"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90762"
FT                   /protein_id="ADM90762.1"
FT                   /translation="MKTKEQTRKLASGCSKHCFKVVDGTDEVSSKHCFEVVDRTDEVSS
FT                   KHCFEVVDRTDEVSSKHCFEVVDRTDEVSNHTHGKATLTWFEEIFEEY"
FT   gene            647458..647820
FT                   /locus_tag="SP670_0692"
FT   CDS_pept        647458..647820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90763"
FT                   /protein_id="ADM90763.1"
FT                   /translation="MLEVGLNFLISLFTFTFDILYPIVKVGHTDDYSHGAVKLSVSLVD
FT                   KDAMKKISVTVIGYFEINIDENITDILYVNGTAILYHYLRSIVSIVSAIDSSEAMLLPT
FT                   INVLELLDKSQPFEEE"
FT   gene            648865..649857
FT                   /locus_tag="SP670_0693"
FT   CDS_pept        648865..649857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0693"
FT                   /product="ABC transporter ATP-binding protein-role in
FT                   polysaccharide efflux"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90764"
FT                   /protein_id="ADM90764.1"
FT                   /translation="MAMIEVEHLQKNFVKTVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPNSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQEIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYEGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            649859..650677
FT                   /locus_tag="SP670_0694"
FT   CDS_pept        649859..650677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0694"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90765"
FT                   /protein_id="ADM90765.1"
FT                   /translation="MIKLWRRYKPFINAGVQELITYRVNFILYRIGDVMGAFVAFYLWK
FT                   AVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGLTVLYLFSLTLAYLI
FT                   NFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKVVSDILSFLPFSSLI
FT                   YTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFITIQGG"
FT   gene            650679..651464
FT                   /locus_tag="SP670_0695"
FT   CDS_pept        650679..651464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0695"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90766"
FT                   /protein_id="ADM90766.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS"
FT   gene            651503..651781
FT                   /locus_tag="SP670_0696"
FT   CDS_pept        651503..651781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0696"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90767"
FT                   /protein_id="ADM90767.1"
FT                   /translation="MFVIEEVKDENQKKAVVAEVLKDLPEWFGIPESTQAYIEGTTTLQ
FT                   VWTAYQESDLTRFVSLSYSSEDCAEIDCLGVKKLIKVEKLGANCLLL"
FT   gene            651766..651963
FT                   /locus_tag="SP670_0697"
FT   CDS_pept        651766..651963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0697"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90768"
FT                   /protein_id="ADM90768.1"
FT                   /translation="MLATLESEARKKVGYLQVKTVAEGSNKDYDRTNDFYRGLGFKKLE
FT                   IFPQLWNPQNPCQILIKKLE"
FT   gene            complement(652281..652418)
FT                   /locus_tag="SP670_0698"
FT   CDS_pept        complement(652281..652418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0698"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90769"
FT                   /protein_id="ADM90769.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSNHTHGKATLTWFEEIF
FT                   "
FT   gene            652651..659082
FT                   /locus_tag="SP670_0699"
FT   CDS_pept        652651..659082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0699"
FT                   /product="serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90770"
FT                   /protein_id="ADM90770.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPNEVVLADTSSSEDALNISDKEKVV
FT                   LDKETENKEKHEDIHNAIETSQDFKEKKTAVIEGKEFVSKNPVTDNNTSNEEARIKEDS
FT                   NQSQGDHTDSFVNKNTENPKKEDKVVYIAEFKDKESGEKAIKQLSNLKNTKVLYTYDRI
FT                   FNGSAIETTPDNLDKIKQIEGISSVERAQKVQPMMNHARKEIGVEEAIDYLKSINAPFG
FT                   KNFDGRGMVISNIDTGTDYRHKAMRIDDDAKASMRFKKEDLKGTDKNFWLSDKIPHAFN
FT                   YYNGGKITVEKYDDGRDYFDPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYKM
FT                   YSDAGSGFAGDETMFHAIEDSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIPM
FT                   VVATGNYATSASSSSWDLVANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVNI
FT                   GGQSFKYRNIGAFFDKNKITTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMDR
FT                   IYTKDLKNAFKKAMDKGARAIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISGD
FT                   DGVKLWNMINPDKKTEVKRNNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFAP
FT                   DTDKELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGTS
FT                   MATPIVAASTVLIRPKLKEMLEKPVLKNLKGDDKIDLTSLTKIALQNTARPMMDATSWK
FT                   EKSQYFASPRQQGAGLINVANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYFT
FT                   IKLHNTSNRPLTFKVSASAVTTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGAN
FT                   ITFEHDTFTIGANSSFDLNAVINVGEAKNKNKFVESFIHFESVEEMEALSSNGKKTDFQ
FT                   PSLSMPLMGFAGNWNHEPILDKWAWEEGSKSKTMEGYDDDGKPKIPGTLNKGIGGEHGI
FT                   DKFNPAGVIQNRKDKNRTSLDQDPDLFAFNNQGVHAESTSGSKIANIYPLDSNGNPQDA
FT                   QLERGLTPSPLVLRSAEEGLISIVNTNKEGENQKDLKVVSREHFIRGILNSKGNDAKGI
FT                   KSSKLKVWGDLKWDGLIYNPRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKYR
FT                   LTKDYPWQVSYIPVKIDNTAPKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARDQ
FT                   KEHPEKFDEIANEVWYAGAALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEISG
FT                   AGDLRGKIIEVIALDGASNFTKIHRIKFANQADEKGMISYYLVDPDQDSSKYQKLGEIP
FT                   ESKFKNLKNVKDDSLNKETAEVENNLLVDNQSIEGKSLFNIHKTISTIRDFENKDLKKL
FT                   IKKKYKQEDDFVNGGTRTVERDYKYDDKGNIIAYDDGTDLEYETEKLDEIKSKIYGVLS
FT                   PSKDGHFEILGKISNVSKNAKVYYGNNYKSIEIKATKYDFHSKTMTFDLYANINDIVDG
FT                   LAFAGDMRLFVKDNDQKKAEIKIRMPEKIKETKSEYPYVSSYGNVIELGEGDLSKNKPD
FT                   NLTKMESGKIYSDSEKQQYLLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIAK
FT                   IQKANPNLRALSETTIYADSRNVEDGRSTQAVLMSALDGFNIIRYQVFTFKMNDKGEAI
FT                   DKDGNLVTDSSKLVLFGKDDKEYTGEDKSNVEAIKEDGSMLFIDTKPVNLSMDKNYFNP
FT                   SKSNKIYVRNPEFYLRGKISDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLNV
FT                   KDGDIMDWGMKDYKANGFPDKVTDMDGNVYLQTGYSNLNAKAVGVHYQFLYDNVKPEVN
FT                   IDPKGNTSIEYADGKSVVFNINDKRNNGFDGEIQEQHIYINGKEYTSFNDIKQIIDKTL
FT                   NIKIVVKDFARNTTVKEFILNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILPV
FT                   YKGELEKGYQFDGWEISGFEGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDVS
FT                   KKKDNPQVNHSQLNESHRKEDLQREDHSQKSDSTKDVTATVLDKNNISSKSTTNNPNKL
FT                   PKTGTASGAQTLLAAGIMFIVGIFLGLKKKNQD"
FT   gene            659709..660185
FT                   /locus_tag="SP670_0700"
FT   CDS_pept        659709..660185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0700"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90771"
FT                   /protein_id="ADM90771.1"
FT                   /translation="MVLDYFFDKNLVFCLEADNQEQLFDQVATLLEEREIVTPTYREAL
FT                   ITREKSFPTGLDMEFLGKDLPNVAIPHTDIVHNLAEKVVVVRLEKPVTFHNMIAPDKEV
FT                   EVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEKLYAYIAEATA"
FT   gene            660223..660528
FT                   /locus_tag="SP670_0701"
FT   CDS_pept        660223..660528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0701"
FT                   /product="PTS system, galactose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90772"
FT                   /protein_id="ADM90772.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIESAIKEHGLS"
FT   gene            660576..662051
FT                   /locus_tag="SP670_0702"
FT   CDS_pept        660576..662051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0702"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90773"
FT                   /protein_id="ADM90773.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNGAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNVVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLFIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLQGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVAFLVFYIGIFAWYRKQMIKRNEEYAAKAK"
FT   gene            662077..662268
FT                   /locus_tag="SP670_0703"
FT   CDS_pept        662077..662268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0703"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90774"
FT                   /protein_id="ADM90774.1"
FT                   /translation="MKIKEQTRKLAAGCSKHSFEVVDKTDEVSSKHGFEVVDETDEVSN
FT                   HIYGKATLTKFELDFRRV"
FT   gene            662356..669057
FT                   /locus_tag="SP670_0704"
FT   CDS_pept        662356..669057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0704"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90775"
FT                   /protein_id="ADM90775.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKPEEKAPRIESQASSQEKPLKEDAKAVTNEEVNQMIEDRKVDFNQNWYFKLN
FT                   ANSKEAIKPDADVSTWKKLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLA
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSHGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSNQVTVFTGKKEGQEKT
FT                   VLGTEVPKVQTIIGEAPEMPTTVPFVYSDGSRAERPVTWSSVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTDLNSVDKSVSYVLTDGSVEEYEVDKWEIAEEDKA
FT                   KLAIPGSRIQATGYLEGQPIHATLVVEEGNPAAPAVPTVTVGGEAVTGLTSQKPMQYRT
FT                   LAYGAKLPEVTASAKNAAVTVLQASAANGMRASIFIQPKDGGPLQTYAIQFLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLNAEYEGAKGQVELTIQANTEKKIAQSIRPVNVVTDLHQEPSLPATVTVEYDK
FT                   GFPKTHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEARAKVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAVRIRMVRADNKLGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVPAVTASVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKDLSVEWEEVPAENLTKAGQFTVRGHVLGSDLVAEVTVRVTDKLG
FT                   EALSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVAQAKLHFFADSGTDAPTKLVLERYVGPEFEVPTYYSNYQAYD
FT                   ADHPFNNPENWEAVPYRADKDIAAGDEINVTFKAVKAKAMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSLPVLVRLVSESGKQVKEYRIHLTKEKPVSEKTVAAVQEDLPKLEFVEKDLAYKTV
FT                   EKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRIVLVGTKPVA
FT                   QEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAASQAAVAAGLALLGLSAGLVVTK
FT                   GKKED"
FT   gene            complement(669305..669916)
FT                   /locus_tag="SP670_0705"
FT   CDS_pept        complement(669305..669916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90776"
FT                   /protein_id="ADM90776.1"
FT                   /translation="MTLDCLFIDGTKIEANANKYSFVWKKTTEKFSAKLQEQIQVYFQE
FT                   EITPLLIKYAMFDKEQKRGYKQSARNLANWHYNDKEDSYTHPDGWCYRFHHTKYQKTQT
FT                   DFQQEIKVYYADEPESAPQKGLYMNERYQNLKAKECQALLSPQGRQIFAQRKIDVEPVF
FT                   GQIKASLGYKRCNLRGKCQVRIDMGLVLMANNLLKYSEMK"
FT   gene            complement(669916..670161)
FT                   /locus_tag="SP670_0706"
FT   CDS_pept        complement(669916..670161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0706"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90777"
FT                   /protein_id="ADM90777.1"
FT                   /translation="MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTLEDCHFHAFY
FT                   HAFDRPSYHPKMLVSTLLFAYSQGIFSGRKIEKWKS"
FT   gene            complement(670372..670731)
FT                   /locus_tag="SP670_0707"
FT   CDS_pept        complement(670372..670731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0707"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90778"
FT                   /protein_id="ADM90778.1"
FT                   /translation="MGMILMKLASILLLILTLVVCIILTKLFRLKKLGRNFADLAFPVL
FT                   VFEYYLITAKTFTHNFLPRLGLALSFLAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLT
FT                   LIMYIEMIVELFLMK"
FT   gene            670823..671779
FT                   /pseudo
FT                   /locus_tag="SP670_0710"
FT   CDS_pept        670823..671779
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0710"
FT                   /note="radical SAM superfamily protein, degenerate"
FT   gene            671763..672320
FT                   /locus_tag="SP670_0711"
FT   CDS_pept        671763..672320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0711"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90779"
FT                   /protein_id="ADM90779.1"
FT                   /translation="MKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQVYA
FT                   FDIQKQALEKTQERLHQADLTNAQLILQGHETLDQFVIKAKAGIFNLGYLPSADKSVIT
FT                   RPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIYRT
FT                   LNQVNNPPFLVMIEKLERYRHG"
FT   gene            672313..672567
FT                   /locus_tag="SP670_0712"
FT   CDS_pept        672313..672567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0712"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90780"
FT                   /protein_id="ADM90780.1"
FT                   /translation="MDKQYLHEKLDAMRQNFVESTHHERAVGVLDQAHMSKKMLKIKKK
FT                   LVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            672579..674633
FT                   /locus_tag="SP670_0713"
FT   CDS_pept        672579..674633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0713"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90781"
FT                   /protein_id="ADM90781.1"
FT                   /translation="MELLIYLILFLLVLIVSSTTNKLLPFLPLPLVQILLGIVIGLFLP
FT                   NTDFHLNTELFLALVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAH
FT                   LLWFSLPLAACLAVGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQ
FT                   VALTAWTTGAFSLGQASSSLIFSILGGFLIGFLTAMTNRFLHTFLLSVRATDIASELLL
FT                   ELSLPLVTFFLAEEVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFML
FT                   NGSVFVILGMELEMIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRR
FT                   LKKKLNKYMKDMFLLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGL
FT                   LVLPHLSDEEEESKDYLMHIAILNEVTLELEKELEDTRNKLPLYAAIDNYHGRIENLIL
FT                   SQENQDDQEDWAALKLLILSIESDGLEQAYEEGNISNRVYRVYQRYLKNIEQGINRKLA
FT                   SRLTYYFLVSLRILRFLLHEVFTLGKTFRSWKNKEQSRLRALDYDQIAELYLANTEMII
FT                   ESLENLKGVYSRSLISFMQESRLRETTIISSGAFVERVINRVKPNNINEMLRGYYLERK
FT                   LIFEYEEKRLITTKYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   gene            complement(674666..674779)
FT                   /locus_tag="SP670_0714"
FT   CDS_pept        complement(674666..674779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0714"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90782"
FT                   /protein_id="ADM90782.1"
FT                   /translation="MKIKEQTRKLAASCSKHCFEVVDKTDEVSHIHTVRRR"
FT   gene            674812..675672
FT                   /locus_tag="SP670_0715"
FT   CDS_pept        674812..675672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0715"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90783"
FT                   /protein_id="ADM90783.1"
FT                   /translation="MKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLISIFPLL
FT                   LVVVNILPYFQIPVGEFLGFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVLSALWS
FT                   FSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQILFAFALFLILFGQMILALL
FT                   AHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNLSNRKISYTLPGSAFVLLVI
FT                   LGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQSLKDP
FT                   VFKKD"
FT   gene            675883..676593
FT                   /locus_tag="SP670_0716"
FT   CDS_pept        675883..676593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0716"
FT                   /product="cytochrome c-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90784"
FT                   /protein_id="ADM90784.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKELYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGLL
FT                   VLFGNASILSQLFE"
FT   gene            676613..677179
FT                   /locus_tag="SP670_0717"
FT   CDS_pept        676613..677179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0717"
FT                   /product="thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90785"
FT                   /protein_id="ADM90785.1"
FT                   /translation="MKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMKTEQTASKTS
FT                   AAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDD
FT                   YVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDK
FT                   EGKLVKTHPGFMEKDAILQTLKELA"
FT   gene            677190..678302
FT                   /locus_tag="SP670_0718"
FT   CDS_pept        677190..678302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0718"
FT                   /product="peptide methionine sulfoxide reductase MsrA/msrB"
FT                   /EC_number="1.8.4.11"
FT                   /EC_number="1.8.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90786"
FT                   /protein_id="ADM90786.1"
FT                   /translation="MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQG
FT                   GKAVKKTEISKDADLHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   gene            678525..679262
FT                   /locus_tag="SP670_0719"
FT   CDS_pept        678525..679262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0719"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90787"
FT                   /protein_id="ADM90787.1"
FT                   /translation="MTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELI
FT                   QKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYL
FT                   LKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQFSLKSL
FT                   ASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKVGFEDMN
FT                   YFTQRFKQIAGVTPRQFKKGEDR"
FT   gene            679259..680950
FT                   /locus_tag="SP670_0720"
FT   CDS_pept        679259..680950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0720"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90788"
FT                   /protein_id="ADM90788.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIDTGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLDQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVTFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYQMKIDSRPQKGTKVEIYINRIETS"
FT   gene            681066..681629
FT                   /locus_tag="SP670_0721"
FT   CDS_pept        681066..681629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90789"
FT                   /protein_id="ADM90789.1"
FT                   /translation="MNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGQIGK
FT                   ESSQEIGELIVETILGILSSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIVSVHPTLH
FT                   AGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVT
FT                   ALASRPKLIGGARAHYPQDAIRKS"
FT   gene            681651..687560
FT                   /gene="zmpB"
FT                   /locus_tag="SP670_0722"
FT   CDS_pept        681651..687560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="SP670_0722"
FT                   /product="zinc metalloprotease ZmpB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90790"
FT                   /protein_id="ADM90790.1"
FT                   /translation="MFKKDRFSIRKIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIIS
FT                   QEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIA
FT                   SVFLVGAMGLVVLPSAGAVDPVATLALASREGVVEMEGYRYVGYLSGDILKTLGLDTVL
FT                   EETSAKPGEVTVVEVETPQSTTNQEQARTENQVVETEEAPKTEESPKEEPKSEIKPTDD
FT                   TLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPPVEQAK
FT                   GPEQPVQPTQAEQPRIPKDSSQPEDPKEDRGAEDTPKQEDTPKQEDTQPEVVETKDEAA
FT                   NQPVEEPKVETPAVEKQTEPKVEQVGEPVEPSEDEKAPVSPEKQPEAPEEKAVEETPKP
FT                   EDKIKGIGTKEPVDKSELNNQIDKASSVSPTDYSTASYNALGPVLETAKGVYASEPVKQ
FT                   PEVNSETNKLKTAIDALNVDKSELQEQLRVAEQKQQADYSAKTWREFKIAELQAKEINN
FT                   QTTPLPKQSEIDAATKALQDALQALAVDKTVLQNAINTANSKREEEYTAQTWKALEDAL
FT                   TAVNPVNEDETATQSKVDEATRNLEEAINNLVLLTEKPVLTFIETDKKALEREVVAKYS
FT                   LENQNKTKIKSITATLKKGETVVSTVELIGDDVTNETITSAFKNLEYYKEYTLSTTMVY
FT                   DRGDGDVTEILDNQPIQLDLKKVELKNIKRTDLIKYENGKETNESLITTVPDDKRNYYL
FT                   KITSKNQKTTLLAVKNIEETTVNGTPVYKVTAIADNLVSRTADNKFEEEYVHYIEKPKV
FT                   HEDNVYYNFKELVEAIQNDPSKEYRLGQSMSARNVVPNGKSYITKEFTGKLLSSEGKQF
FT                   AITELEHPLFNVITNATINNVNFENVEIERSGQDNIASLANTMKGSSVITNVKITGTLS
FT                   GRNNVAGFVNNMNDGTRIENVAFFGKLHSTSGNGSHTGGIAGTNYRGIVRKAYVDATIT
FT                   GNKTRASLLVPKVDYGLTLDHLIGTKALLTESVVKGKIDVSNPVEVGAIASKTWPVGTV
FT                   SNSVSYAKIIRGEELFGSNDVDDSDYASAHIKDLYAVEGYSSGNRSFRKSKTFTKLTKE
FT                   QADAKVTTFNITADKLESDLSPLAKLNEEKAYSSIQDYNAEYNQAYKNLEKLIPFYNKD
FT                   YIVYQGNKLNKEHHLNTKEVLSVTAMNNNEFITNLDEANKIIVHYADGTKDYFNLSSSS
FT                   EGLSNVKEYTITDLGIKYTPNIVQKDNTTLVNDIKSILESVELQSQTMYQHLNRLGDYR
FT                   VNAIKDLYLEESFTDVKENLTNLITKLVQNEEHQLNDSPAARQMIRDKVEKNKAALLLG
FT                   LTYLNRYYGVKFGDVNIKELMLFKPDFYGEKVSVLDRLIEIGSKENNIKGSRTFDAFGQ
FT                   VLAKYTKSGNLDAFLNYNRQLFTNIDNMNDWFIDATEDHVYIAERASEVEEIKNSKHRA
FT                   FDNLKRSHLRNTILPLLNIDKAHLYLISNYNAIAFGSAERLGKKSLEDIKDIVNKAADG
FT                   YRNYYDFWYRLASDNVKQRLLRDAVIPIWEGYNAPGGWVEKYGRYNTDKVYTPLREFFG
FT                   PMDKYYNYNGTGAYAAIYPNSDDIRTDVKYVHLEMVGEYGISVYTHETTHVNDRAIYLG
FT                   GFGHREGTDAEAYAQGMLQTPVTGSGFDEFGSLGINMVFKRKNDGNQWYITDPKTLKTR
FT                   EDINRYMKGYNDTLTLLDEIEAESVISQQNKDLNSAWFKKIDREYRDNNKLNQWDKIRN
FT                   LSQEEKNELNIQSVNDLVDQQLMTNRNPGNGIYKPEAISYNDQSPYVGVRMMTGIYGGN
FT                   TSKGAPGAVSFKHNAFRLWGYYGYENGFLGYASNKYKQQSKTDGESVLSDEYIIKKISN
FT                   NTFNTIEEFKKAYFKEVKDKATKGLTTFEVNGSSVSSYDDLLTLFKEAVKKDAETLKQE
FT                   ANGNKTVSMNNTVKLKEAVYKKLLQQTDSFKTSIFK"
FT   gene            687621..689342
FT                   /locus_tag="SP670_0723"
FT   CDS_pept        687621..689342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0723"
FT                   /product="chorismate binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90791"
FT                   /protein_id="ADM90791.1"
FT                   /translation="MHRKTVIDFRTLGERYTFTKPIKELKTRNVEEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLAVHKDPLLGEYLLYFTVHDSVETSSIPLTYEDIDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQKLNANPFAIYNRMVVEQEAGYN
FT                   AYVEHDEMAVISMSPELFFEQNDRELTTRPMKGTTQRGVTDQEDLEQASWLEQDPKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLREDVDLVEIFRS
FT                   LFPCGSITGAPKIATMEIIKDLEPQPRGVYCGTIGLLLPNGRRIFNVAIRTIQLHKGQA
FT                   IYGVGGGITWDSTWESEYREVHQKAAVLYRKQARFQLITTGEISQKNLLFEDQHLERLR
FT                   KASRYFAFPFDAEDLGHKIEEECQDCEANRDYRLRISLSKSGEIEVNRQVLTPLSTSFC
FT                   QAQVCLQEAALNQSFTYFKTTHRPHLSLGEQEKIYHNKSGELLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQYLLETGQVEEKVLTLADLAQAEAIYGCNAVRGLYELQVIGL"
FT   gene            689462..690988
FT                   /locus_tag="SP670_0724"
FT   CDS_pept        689462..690988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0724"
FT                   /product="pneumococcal surface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90792"
FT                   /protein_id="ADM90792.1"
FT                   /translation="MKSKIVLGASLAIATLSLVSLVEIEGLSPFLIENVSANTHSANKV
FT                   INHKVSIYLENADEGKGLTVNFSTDSVSPNLFDEFEKKSGITITTMLVNAKTGEVVEKR
FT                   LTPSVFLRSNDLTSGTISSFIFSEYPDGEYKYVVSKGDFIDPKTQFKHQYRGESPVFRI
FT                   RNRKYVELGTTDKKLDERRDNSVYKDGVVEHKVNLSLTSYQGGNGVTAIFSTDSVNSNL
FT                   LNSFGEKAKKVLIRSKLINVKTGEVIDETFSPKVSLTSKILKSGSTAVFYFIDLTDGEY
FT                   KYVAYESQQYTDPQTTLTHQYRGESPIFSIKDGKFSGLVSASKPDENPKPTPKPDEKPK
FT                   PSAPQQEKPKPTVQSGWVGSSYYQNGKKVTSKWIFDKKYNSYFYLDASGNYVQNAWVGN
FT                   YYLKSGGYMAKSEWIYDKNYGSYYYLTSEGSYARNTWSGNYYLKSNGKMAKSEWVYDSN
FT                   YKSYYYLTSEGSYARNTWVGNYYLKSNGKMAVNERTPDGYRVDGSGKWVK"
FT   gene            complement(690993..691136)
FT                   /locus_tag="SP670_0725"
FT   CDS_pept        complement(690993..691136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90793"
FT                   /protein_id="ADM90793.1"
FT                   /translation="MSACTVCAEKGRTPDLSIVDNVPIVENAKAHENNFFYSSDITYYP
FT                   IF"
FT   gene            691153..692001
FT                   /locus_tag="SP670_0726"
FT   CDS_pept        691153..692001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0726"
FT                   /product="pneumococcal surface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90794"
FT                   /protein_id="ADM90794.1"
FT                   /translation="MAKYYIILPKDAEIYKTWRGTVNIPIIDATKTTPELSYFKEDHRN
FT                   YIANENKSGANYIEWKGTVEEFKEAIKKLTDKKSTTATPKKDEKPTPKPDEKPKPTPTV
FT                   QSGWVGSSYYQDGKKVISKWIFDKKYNSYFYLDASGNYVQNAWVGNYYLKSGGYMAKGE
FT                   WVYDATYQAWYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEGQ
FT                   ASTVSSSNDSNSEYSAALGKAKSYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDHLD
FT                   N"
FT   gene            692128..693087
FT                   /locus_tag="SP670_0727"
FT   CDS_pept        692128..693087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0727"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90795"
FT                   /protein_id="ADM90795.1"
FT                   /translation="MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVD
FT                   DMIESIQHRLDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKA
FT                   LGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGE
FT                   LGHITVDFDQPISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVT
FT                   AKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGV
FT                   QKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            693184..694023
FT                   /gene="thyA"
FT                   /locus_tag="SP670_0728"
FT   CDS_pept        693184..694023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SP670_0728"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90796"
FT                   /protein_id="ADM90796.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RVDGEIYLDATLIQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(694071..694241)
FT                   /locus_tag="SP670_0729"
FT   CDS_pept        complement(694071..694241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0729"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90797"
FT                   /protein_id="ADM90797.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            694362..695246
FT                   /gene="miaA"
FT                   /locus_tag="SP670_0730"
FT   CDS_pept        694362..695246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SP670_0730"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90798"
FT                   /protein_id="ADM90798.1"
FT                   /translation="MKTKIIVIVGPTAVGKTALAIEVAKRFNGEVVSGDSQQVYRGLDI
FT                   GTAKASPEEQAAVPHHLIDVREITESYSAFDFVSEAKMTIEGIHNRGKLAIIAGGTGLY
FT                   IQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVEQAGLEIPQFNRRRAMRALEI
FT                   AHFGQDLENQEILYEPLIICLDDERSQLYERINHRVDLMFEAGLLDEAKWLFDHSPNVQ
FT                   AAKGIGYKELFPYFRGEQTFEEARESLKQATRRFAKRQLTWFRNRMQVTFYQIGESGVQ
FT                   DRILSQIEEFLDD"
FT   gene            695239..696477
FT                   /gene="hflX"
FT                   /locus_tag="SP670_0731"
FT   CDS_pept        695239..696477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="SP670_0731"
FT                   /product="GTP-binding proten HflX"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90799"
FT                   /protein_id="ADM90799.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQFKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            696470..697093
FT                   /locus_tag="SP670_0732"
FT   CDS_pept        696470..697093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0732"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90800"
FT                   /protein_id="ADM90800.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTDQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKPFIRLNLSGKSFGFCYES
FT                   DGLGRIFFENEEKISDDLLFEIAQIFPHQLVFEESGKIYMKPVEDEEVISLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            697108..698037
FT                   /gene="rnz"
FT                   /locus_tag="SP670_0733"
FT   CDS_pept        697108..698037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="SP670_0733"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90801"
FT                   /protein_id="ADM90801.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTDA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            698058..698813
FT                   /locus_tag="SP670_0734"
FT   CDS_pept        698058..698813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0734"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90802"
FT                   /protein_id="ADM90802.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEADAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(698867..699835)
FT                   /locus_tag="SP670_0735"
FT   CDS_pept        complement(698867..699835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0735"
FT                   /product="regulatory function on capsule expression"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90803"
FT                   /protein_id="ADM90803.1"
FT                   /translation="MLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVETGSMNEAAKQL
FT                   FITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQTQLLEERYKN
FT                   PVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDDVKNFRSEVGV
FT                   LFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIFVSKTNPLAKKDKVKLSDLENFPYLSY
FT                   DQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGILNSNLNGDNIV
FT                   SIPLDIDDPIELVYIQHEKTSLSKMGERFIDYLLEEVQFDS"
FT   gene            699887..700108
FT                   /locus_tag="SP670_0736"
FT   CDS_pept        699887..700108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0736"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90804"
FT                   /protein_id="ADM90804.1"
FT                   /translation="MKTFYDVQQFLKRFGIIVYMGKRLYDIELMKLELSRIYDAGLMDK
FT                   LDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            700108..700488
FT                   /locus_tag="SP670_0737"
FT   CDS_pept        700108..700488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0737"
FT                   /product="rhodanese family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90805"
FT                   /protein_id="ADM90805.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            700607..700804
FT                   /locus_tag="SP670_0738"
FT   CDS_pept        700607..700804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0738"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90806"
FT                   /protein_id="ADM90806.1"
FT                   /translation="MGILSIILGLLFPIVGLILGIIGLVLAISYQKESQLDYKIEKILN
FT                   ILGIVISVVNWIVAIALIFR"
FT   gene            complement(700844..701569)
FT                   /locus_tag="SP670_0739"
FT   CDS_pept        complement(700844..701569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0739"
FT                   /product="ribosomal small subunit pseudouridine synthase A,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90807"
FT                   /protein_id="ADM90807.1"
FT                   /translation="MRLDNLLAQEKISRKAMKQALLRGEILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRD
FT                   TTGLLLLTDNGPLGFQLLHPQYHVDKTYQVQVNGLLTPDHIQTFQKGIVFLDGTICKPA
FT                   RLEILSASPSFSQASITISEGKFHQIKKMFLSVGVKVTSLKRIQFGDFTLNPDLAESNY
FT                   RPLNQKELQIIKNYLEMSR"
FT   gene            701710..703572
FT                   /gene="typA"
FT                   /locus_tag="SP670_0740"
FT   CDS_pept        701710..703572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="SP670_0740"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90808"
FT                   /protein_id="ADM90808.1"
FT                   /translation="MNIIEEIMTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDAR
FT                   TELAERAMDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDG
FT                   VVLVVDAYEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGA
FT                   DDDQLDFPVVYASAINGTSSLSDDPADQEATMAPIFDTIIDHIPAPVDNSDEPLQFQVS
FT                   LLDYNDFVGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAK
FT                   AGDLIAVSGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTS
FT                   RKVEERLQAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEV
FT                   IVKEIDGVKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPAR
FT                   GLIGYSTEFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIE
FT                   ERGTIFVNPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILT
FT                   LEESLEFLNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            703592..703846
FT                   /locus_tag="SP670_0741"
FT   CDS_pept        703592..703846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90809"
FT                   /protein_id="ADM90809.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            704212..704511
FT                   /locus_tag="SP670_0742"
FT   CDS_pept        704212..704511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0742"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90810"
FT                   /protein_id="ADM90810.1"
FT                   /translation="MKTKKHRLLALALISSFTLLGAASAAVQYPDGGVWTYGEGSGGGW
FT                   AFSNYYHGKKYHYSSLVSRWNSHSDKGEAPAGKTSYAWIWTKWGEQVAFYCDYD"
FT   gene            704582..706603
FT                   /locus_tag="SP670_0743"
FT   CDS_pept        704582..706603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0743"
FT                   /product="bacteriocin-associated integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90811"
FT                   /protein_id="ADM90811.1"
FT                   /translation="MKKLFILLSTFFLSFFLAWIIVLRAPQYLYASYDSVSLLRVKKDT
FT                   QEPTREVFEQELENFANSEQSLIARRIVEPSKDGTTHFTYATYGQGTLPKEFQEASQES
FT                   RERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILISLA
FT                   IFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGHSLSTDIKWLLLSALLSFLGGGV
FT                   VLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLSYKALVPVIKGRLPLKR
FT                   LMILTLLCQLVAVFTVGYAVKTGLMSYQRLKELEISKQAWQDRADYYQISFGLGDRGKD
FT                   TENQSKWYAFAKEAIEEEQALYVKDNLLHFANPQGKNEQGETLDTYSPDANTLYVSPSY
FT                   LDKEKVVVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYGKSGEEASA
FT                   PLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSFISLSSWSI
FT                   NAGKQLFIKGYESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGI
FT                   ASSLLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR
FT                   DLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            706605..707246
FT                   /locus_tag="SP670_0744"
FT   CDS_pept        706605..707246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0744"
FT                   /product="ABC transporter ATP-binding protein-sodium
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90812"
FT                   /protein_id="ADM90812.1"
FT                   /translation="MIELKNISKKFGSRQLFSDTNLHFEGGKIYALIGTSGCGKTTFLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSVFFRDYLGYLFQDFGLIENQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNRVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   ASLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            707350..708702
FT                   /gene="murD"
FT                   /locus_tag="SP670_0745"
FT   CDS_pept        707350..708702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SP670_0745"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90813"
FT                   /protein_id="ADM90813.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQSLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKGIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGQHGLLSGNIGYPASQVAQTASDKDT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGSFSEYVAAKWNIQNKMTAADFLVL
FT                   NFNQDLAKDLTSKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRGVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDIPGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYEIATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            708704..709762
FT                   /locus_tag="SP670_0746"
FT   CDS_pept        708704..709762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0746"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90814"
FT                   /protein_id="ADM90814.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKRGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLSKVEHVGAVTK
FT                   VSDQKNPEPDELVDIQSHFNHKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELSQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQIENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            709772..710971
FT                   /locus_tag="SP670_0747"
FT   CDS_pept        709772..710971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0747"
FT                   /product="cell division protein DivIB"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90815"
FT                   /protein_id="ADM90815.1"
FT                   /translation="MSKDKKNEDKEILEELKELSEWQKRNQEYLKKKAEEEAALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEESEEKVASSEADKEKEEKEESESKE
FT                   KEEQDKKLAKKATKEKPAKAKIPGIHILRAFTILFPSLLLLIVSAYLLSPYATMKDIRV
FT                   EGTVQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKFTIK
FT                   VKEYDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKVFVSELAQ
FT                   ISPELKATIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLSEPS
FT                   VVDMEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKKQEEESNRNQTTQRSSRR
FT                   "
FT   gene            711204..711905
FT                   /gene="pyrF"
FT                   /locus_tag="SP670_0748"
FT   CDS_pept        711204..711905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="SP670_0748"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90816"
FT                   /protein_id="ADM90816.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKVLSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIYYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGAAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEDPVAAYH
FT                   TIKDEWTQDWN"
FT   gene            711939..712571
FT                   /gene="pyrE"
FT                   /locus_tag="SP670_0749"
FT   CDS_pept        711939..712571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="SP670_0749"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90817"
FT                   /protein_id="ADM90817.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSELIHLAQEEGYITPEGLDLLKRFKEDQENWQEG"
FT   gene            713032..713154
FT                   /locus_tag="SP670_0750"
FT   CDS_pept        713032..713154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90818"
FT                   /protein_id="ADM90818.1"
FT                   /translation="MYYNGGGDNYIGSGTRLAMAPQFGNHVRIHTSGSWSPDSY"
FT   gene            713250..714014
FT                   /locus_tag="SP670_0751"
FT   CDS_pept        713250..714014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90819"
FT                   /protein_id="ADM90819.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKRYLAIVGST
FT                   AIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQFLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKLGAIFIPVAYMMVGGILWAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSGHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            714014..714766
FT                   /locus_tag="SP670_0752"
FT   CDS_pept        714014..714766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0752"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90820"
FT                   /protein_id="ADM90820.1"
FT                   /translation="MKQFVQFYKKDFLAVLVYFILLLSCVLSSTVYLLRCRQYSIHPNV
FT                   LEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIRLKSIKHFTSFSFKLAAL
FT                   STGIWTAILFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISIANNASFFIGFFFSYIAY
FT                   YFFLSLLTISSFSWFKKSNMSLVFLFTFLFVESLFWIYQLNNGIIGLLPIFQYMVNSNP
FT                   YALIYWLALLSIIIPLTVFSVHRNWRRV"
FT   gene            714770..715474
FT                   /locus_tag="SP670_0753"
FT   CDS_pept        714770..715474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0753"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90821"
FT                   /protein_id="ADM90821.1"
FT                   /translation="MEMGKLSSHIWRLNQIIYTKYFWGYVLFWILICLGLWYWLEGNDR
FT                   LVIEILKGPNLSQNSFLVLSIWLLHWFIIHTFFLAVVYRRRASDFFLEVIRFSSIKLWI
FT                   RYQIWTCFLYGLILIMVKVLVIQFMLQLPNWDIGVLFIVDFLNACVLVLFCFMLYALGA
FT                   NVQMNFACVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFKSI
FT                   FYFTRQKRRFIE"
FT   gene            715471..716118
FT                   /locus_tag="SP670_0754"
FT   CDS_pept        715471..716118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0754"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90822"
FT                   /protein_id="ADM90822.1"
FT                   /translation="MNEIITLKNIELKLKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(716206..716760)
FT                   /locus_tag="SP670_0755"
FT   CDS_pept        complement(716206..716760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0755"
FT                   /product="polar amino acid ABC uptake transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90823"
FT                   /protein_id="ADM90823.1"
FT                   /translation="MISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLIT
FT                   DVKQLEGKTLIVTKGTTAETYFEKNHPEIKLQKYDQYSDSYQALLDGRGDAFSTDNTEV
FT                   LAWALENKGFEVGITSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTL
FT                   HPTYGDAAKADDLVVEGGKVD"
FT   gene            complement(716835..717077)
FT                   /locus_tag="SP670_0756"
FT   CDS_pept        complement(716835..717077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0756"
FT                   /product="polar amino acid ABC uptake transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90824"
FT                   /protein_id="ADM90824.1"
FT                   /translation="MKLFKPLLTVLALAFALIFITACSSGGNAGSSSGKTTAKARTIDE
FT                   IKKSGELRIAVFGDKKPFGYVDNDGSYQGYATILN"
FT   gene            complement(717089..717595)
FT                   /locus_tag="SP670_0757"
FT   CDS_pept        complement(717089..717595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0757"
FT                   /product="glutamate/aspartate transport ATP-binding protein
FT                   GltL"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90825"
FT                   /protein_id="ADM90825.1"
FT                   /translation="MVFQSYELFPHLDVLQNLILGPIKAQGRDKKEVTEEALQLLERVG
FT                   LLDKQHSFARQLSGGQKQRVAIVRALLMHPEIILFDEVTASLDPEMVREVLELINDLTQ
FT                   EGRTMILVTHEMQFAQAITDRIIFLDQGKIAEEGTAQAFFTNPQTKRAQEFLNVFDFSQ
FT                   FGSYL"
FT   gene            complement(717849..718136)
FT                   /locus_tag="SP670_0758"
FT   CDS_pept        complement(717849..718136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0758"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90826"
FT                   /protein_id="ADM90826.1"
FT                   /translation="MTNVQLYYHIIIPQVLRRLLPQAINLVTRMIKTTSLVVLIGVVEV
FT                   TKVGQQIIDSNRLTIPTASFWIYGTILVLYFAVCYPISKLSTHLEKHWRN"
FT   gene            complement(718146..718526)
FT                   /locus_tag="SP670_0759"
FT   CDS_pept        complement(718146..718526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0759"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90827"
FT                   /protein_id="ADM90827.1"
FT                   /translation="MQDSGIQVLFQGNNLLRILQGLGVTIGISILSVLLSMMFGTVMGI
FT                   IMTSHSRIIRFLTRLYLEFIRIMPQLVLLFIVYFGLARNFNINISGETSAIIIFTLWGT
FT                   AEMGDLVRGAITSLPKHQFESG"
FT   gene            complement(718486..719166)
FT                   /locus_tag="SP670_0760"
FT   CDS_pept        complement(718486..719166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0760"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90828"
FT                   /protein_id="ADM90828.1"
FT                   /translation="MDWSIVEQYLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYR
FT                   IPVLAQVATAYIELSRNTPLLIQLFFLYFGLPRIGIVLSSEVCATLGLVFLGGSYMAES
FT                   FRSGLEAISQTQQEIGLAIGLTPLQVFRYVVLPQATAVALPSFSANVIFLIKETSVFSA
FT                   VALADLMYVAKDLIGLYYETDIALAMLVVAYLIMLLPISLVFSWIERRTRHAGFGNPST
FT                   LSRK"
FT   gene            719381..719527
FT                   /locus_tag="SP670_0761"
FT   CDS_pept        719381..719527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0761"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90829"
FT                   /protein_id="ADM90829.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   SFQ"
FT   gene            719654..721144
FT                   /gene="lysS"
FT                   /locus_tag="SP670_0762"
FT   CDS_pept        719654..721144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SP670_0762"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90830"
FT                   /protein_id="ADM90830.1"
FT                   /translation="MSTEHMEELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELK
FT                   DKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENY
FT                   EIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRK
FT                   RYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADF
FT                   QDIMDLTEGIIQHAAKSVKGDGPVNYQGTEIKINEPFKRVHMVDAIREITGVDFWQDMT
FT                   LEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNP
FT                   EDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   gene            721769..722905
FT                   /gene="lctO"
FT                   /locus_tag="SP670_0763"
FT   CDS_pept        721769..722905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="SP670_0763"
FT                   /product="L-lactate oxidase"
FT                   /EC_number="1.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90831"
FT                   /protein_id="ADM90831.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCDVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGAQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   gene            723460..724128
FT                   /locus_tag="SP670_0764"
FT   CDS_pept        723460..724128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0764"
FT                   /product="tena/thi-4 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90832"
FT                   /protein_id="ADM90832.1"
FT                   /translation="METQDYAFQPGLTVGELLKSSQKDWQAAINHRFVKELFAGTIENK
FT                   VLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKELK
FT                   VAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVY
FT                   IHSEWINLHRGPFFAEWVQFLVDELNRVGKNREDLTELQQRWNQAVALELAFFDIGYDV
FT                   "
FT   gene            complement(724183..724314)
FT                   /locus_tag="SP670_0765"
FT   CDS_pept        complement(724183..724314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0765"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90833"
FT                   /protein_id="ADM90833.1"
FT                   /translation="MKIKEQTRRLTAGCSKHCFEPVDKTDEVSSKHCFEVVDRTDVV"
FT   gene            724416..725198
FT                   /gene="thiM"
FT                   /locus_tag="SP670_0766"
FT   CDS_pept        724416..725198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="SP670_0766"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90834"
FT                   /protein_id="ADM90834.1"
FT                   /translation="MTSLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPAD
FT                   LEDLLKYAGGLLINIGTLTDENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADD
FT                   LINNYKLAAIRGNAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIPIVVTGEV
FT                   DAIAVNGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLETAMLVYNIAG
FT                   EIAEKHPNGHLPGTFKVEFINALYEITDEDVKEFKRVK"
FT   gene            725200..725829
FT                   /locus_tag="SP670_0767"
FT   CDS_pept        725200..725829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0767"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90835"
FT                   /protein_id="ADM90835.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGE
FT                   GALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIRNEEEFQQSKVEYVDYVGVGPVFGTQSKDDAGGTIGYEGLELMRKLLPQM
FT                   PLVAIGGIQTKHIKDIIKTNMDGVSIISAISYAKNIEKTVREMSEQ"
FT   gene            726388..726948
FT                   /locus_tag="SP670_0768"
FT   CDS_pept        726388..726948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0768"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90836"
FT                   /protein_id="ADM90836.1"
FT                   /translation="MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQA
FT                   FANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLGALLSGLVQGLG
FT                   SEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFISVY
FT                   FFCTILVRAIVKLYHQFATGGKA"
FT   gene            726949..728334
FT                   /locus_tag="SP670_0769"
FT   CDS_pept        726949..728334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0769"
FT                   /product="ABC transporter ATP-binding protein-cobalt or
FT                   other cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90837"
FT                   /protein_id="ADM90837.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSNGSGKSSLFQMIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIIARVQKVGILLQNPNHQFTMENLFEELIFTLENIGY
FT                   HLQEIDSKIAEVVQQCRCEAILHRPIHHLSGGEKQKAALAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELALDGKTVILCDHDLSDYKAYIDYMVELRDGKLREVFQIPSYEMT
FT                   QVASKEVAASPELFHMNRVTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGRIAWKGTVLKKKKSLYRDLTGVVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            728336..728986
FT                   /locus_tag="SP670_0770"
FT   CDS_pept        728336..728986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90838"
FT                   /protein_id="ADM90838.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMLYY
FT                   RRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            728997..729689
FT                   /locus_tag="SP670_0771"
FT   CDS_pept        728997..729689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0771"
FT                   /product="tena/thi-4 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90839"
FT                   /protein_id="ADM90839.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKAFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEINDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            729694..730218
FT                   /gene="thiW"
FT                   /locus_tag="SP670_0772"
FT   CDS_pept        729694..730218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiW"
FT                   /locus_tag="SP670_0772"
FT                   /product="ThiW protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90840"
FT                   /protein_id="ADM90840.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFYFSALGEIV
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFSERID"
FT   gene            730218..731021
FT                   /locus_tag="SP670_0773"
FT   CDS_pept        730218..731021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0773"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90841"
FT                   /protein_id="ADM90841.1"
FT                   /translation="MQEFTNPFPIGSSSLIHCMTNEISCEMLANGILALGCKPVMADDS
FT                   REVLDFTKQSQALFINLGHLSAEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLV
FT                   KDLLYYRPTVLKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMSF
FT                   LVTGPKDLIVSKNQVAVLENGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVSY
FT                   LNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEVYE"
FT   gene            731014..731646
FT                   /locus_tag="SP670_0774"
FT   CDS_pept        731014..731646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0774"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90842"
FT                   /protein_id="ADM90842.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKVETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARQVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPIVAI
FT                   GGLTSENIDQLMGTGIAGVAVVRDLMQAEDIEAKTQAFLTKLHDILS"
FT   gene            complement(731855..732661)
FT                   /gene="thiD"
FT                   /locus_tag="SP670_0775"
FT   CDS_pept        complement(731855..732661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SP670_0775"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90843"
FT                   /protein_id="ADM90843.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDVYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLESVFSDIPPQAVKTGMLATTEIMEIIQPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSNARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEDMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAV
FT                   ITAELAKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   gene            733027..733422
FT                   /locus_tag="SP670_0776"
FT   CDS_pept        733027..733422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0776"
FT                   /product="copper transport repressor, CopY/TcrY family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90844"
FT                   /protein_id="ADM90844.1"
FT                   /translation="MQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTIQTLLA
FT                   RLVEKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLLADLIVECEFT
FT                   QTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            733433..733804
FT                   /locus_tag="SP670_0777"
FT   CDS_pept        733433..733804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0777"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90845"
FT                   /protein_id="ADM90845.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSEQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQA
FT                   GEFGFACGMNMMHGKMIVE"
FT   gene            733814..736057
FT                   /locus_tag="SP670_0778"
FT   CDS_pept        733814..736057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0778"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90846"
FT                   /protein_id="ADM90846.1"
FT                   /translation="MTEIVKANLENGIQKIRIRAEKGYHPAHIQLQKGIPAEITFHRAT
FT                   PSNCYKEILFEEEGILEAIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVEKTRKS
FT                   LSLLQRFWITSIFTVPLVILMIGMLTGSISHQVMHWGTFLATTPIMLVAGKPYIQSAWA
FT                   SFKKHNANMDTLVALGTLVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKMRKN
FT                   TSQAVEKLLDLQAKTAEVLSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGVSSI
FT                   DESMVTGESLPVDKTVGDTVIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQTSRA
FT                   PIQDLTDKISGIFVPVVVILGIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLIIACP
FT                   CALGLATPTALMVGTGRSAKMGVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVTDII
FT                   GDEVEVFGLAASLEDASQHPLAEAIVKRASEAGLEFQTVENFQTLHGKGVSGRINGKQV
FT                   LLGNAKMLDGMDISNTYQDKLEELEKEAKTVVFLAVDNEIKGLLALQDIPKENAKLAIS
FT                   QLKKRGLRTVMLTGDNAGVARAIADQIGIEEVIAGVLPEEKAHEIHKLQQSGKVAFVGD
FT                   GINDAPALSVADVGIAMGAGTDIAIESADLVLTTNNLLGVVRAFDMSKKTFHRILLNLF
FT                   WAFIYNVVGIPIAAGVFSGVGLALNPELAGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            736264..738039
FT                   /gene="spxB"
FT                   /locus_tag="SP670_0779"
FT   CDS_pept        736264..738039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="SP670_0779"
FT                   /product="pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90847"
FT                   /protein_id="ADM90847.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAVSKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   PFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            738150..738296
FT                   /locus_tag="SP670_0780"
FT   CDS_pept        738150..738296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90848"
FT                   /protein_id="ADM90848.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCL
FT                   MLS"
FT   gene            738303..738497
FT                   /locus_tag="SP670_0781"
FT   CDS_pept        738303..738497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90849"
FT                   /protein_id="ADM90849.1"
FT                   /translation="MVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKLLHGPTVTDWGT
FT                   ESLLVQGPAGLVLDFYRMK"
FT   gene            complement(738614..739123)
FT                   /locus_tag="SP670_0782"
FT   CDS_pept        complement(738614..739123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0782"
FT                   /product="transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90850"
FT                   /protein_id="ADM90850.1"
FT                   /translation="MYQDEAGFGRISKLGSCWSPIGVGPHVHSHYIREFRYCYGAVDAH
FT                   TGESFFLIAGRCNTEWMNAFLEELSQAYPYDYFLLVIDNAIWHKSSTLKIPTNIGFAFI
FT                   PPYTPEMNPIEQVWKEIRKRGFKNKAFRTLEDVMNQLQDVIQGLEKEVIKSIVNRRWTR
FT                   MLFESR"
FT   gene            complement(739155..739421)
FT                   /locus_tag="SP670_0783"
FT   CDS_pept        complement(739155..739421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0783"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90851"
FT                   /protein_id="ADM90851.1"
FT                   /translation="MTVEEEKAFLARHLKATEAGEFATIDALFQAYKKELGRSYTRDAF
FT                   YQLLKRHGWRNITPRPEHPKKADAQTIVASKNKISIQEDKKAL"
FT   gene            complement(739418..739660)
FT                   /locus_tag="SP670_0784"
FT   CDS_pept        complement(739418..739660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0784"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90852"
FT                   /protein_id="ADM90852.1"
FT                   /translation="MKLTKEEIQTIKTLLKDSRTAKYHKRLQIVLFRLMGKSYKEIIEL
FT                   LDCNQTTIWRSVKNMRSSDSTLSFKKHVVVVTMHI"
FT   gene            739725..740021
FT                   /locus_tag="SP670_0785"
FT   CDS_pept        739725..740021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0785"
FT                   /product="6-phospho-beta-glucosidase AscB"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90853"
FT                   /protein_id="ADM90853.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWGC
FT                   IDPVSAGTGEMNKRYGFIYVDRDNVGNGALKRSKKKSFYWYKDVIDSNGASIG"
FT   gene            740142..741086
FT                   /gene="manA"
FT                   /locus_tag="SP670_0786"
FT   CDS_pept        740142..741086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="SP670_0786"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90854"
FT                   /protein_id="ADM90854.1"
FT                   /translation="MSEPLFLQSVMQEKIWGGAKLRDEFGYDIPSEKIGEYWAISAHPN
FT                   GVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGL
FT                   EHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDDLLTKVPVKAGDFF
FT                   YVPSGTMHAIGTGTLILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPT
FT                   NSRPVTIKADDLRSTLLVSNDFFAVYKWEITGKVDFEKTADYSLLSVLAGQGQLTVDGK
FT                   NYPIQKGSHFILPSDVEAWTLEGKGLELIVSHP"
FT   gene            complement(741107..742366)
FT                   /locus_tag="SP670_0787"
FT   CDS_pept        complement(741107..742366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0787"
FT                   /product="sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90855"
FT                   /protein_id="ADM90855.1"
FT                   /translation="MTAANGGGGFLLIFLISTILIDFPLLLAEFALGRSAGVSAIKTFG
FT                   KLGKNNKYNFIGWIGAFALFILLSFYSVIGGWILVYLGIEFGKLFQLGGTGDYAQLFTS
FT                   IISNPAIALGAQAAFILLNIFIVSRGVQKGIERASKVMIPLLFIIFVVIIERSPSLPNA
FT                   MEGVLYFLKPDFSKLTSAGPLYALGQSFFALSLGVTVMLTYASYLDKKTNLVQSGISIV
FT                   AMNISVSIMAGLAIFQARSPFNIQSEGGPSLLFIVLPQLFDKMPFGTIFYVLFLFATVT
FT                   SSVVILEINVGNITNQDNSKRAKWSVILGILTFVFGIPSALSYGVMADVHIFGKTFFDA
FT                   MDFLVSNLLMPFGALYLSLFTGYIFKKALAMEELHLDERAWKQGLFQVWLFLLRFFVSS
FT                   FQSSSLWSSLPNLCNQKGLE"
FT   gene            742823..743434
FT                   /locus_tag="SP670_0789"
FT   CDS_pept        742823..743434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0789"
FT                   /product="regulator of the multidrug efflux pump PmrA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90856"
FT                   /protein_id="ADM90856.1"
FT                   /translation="MERLQVILYYKYLGFSLEKIAELLKEERTDLLPHLTRQLDYLTRE
FT                   RQHLDTLISTLQKTIQEQKGERKMTIEEKFTGFSYQDNQKYHQEAVEKYGQEVMGQALE
FT                   RQKGHEDEATAAFNQVFQTLAQNLQVGLPATATENQEQAAKLLQAIRTYGFDCSIEVFG
FT                   HIGKGYVYNPEFKKNIDKFGSGTAQYTSDAIAAYVQTNAE"
FT   gene            complement(743583..744335)
FT                   /locus_tag="SP670_0790"
FT   CDS_pept        complement(743583..744335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0790"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90857"
FT                   /protein_id="ADM90857.1"
FT                   /translation="MDRGYESYNLMAHFQEKGWLYIIRIRDGKQSMPSSFNLPNTECFD
FT                   QKVSLKLSRKQTNQLKKLYRDFPNDYHFIPHNSIFDFLPETSRKQDPVTLYELPFRMVR
FT                   LEVEEGKYETLVTNTDYSVQELKNLYASRWGIETSFRDLKYSIGLVNFHAKKKGGILQE
FT                   IFARFTNFNFCRWVTSQVAIDSSHKKQRYKVCFSDAAYACRLFFNGSLSSLQLKNYLKK
FT                   QLSIIRPNRKYSRKIKAQSVVDFIYRVT"
FT   gene            complement(744328..744873)
FT                   /locus_tag="SP670_0791"
FT   CDS_pept        complement(744328..744873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0791"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90858"
FT                   /protein_id="ADM90858.1"
FT                   /translation="MIKQIKAHLNKSIQSIIGQKVEFVKQDEQAFTRKRRLSLETMIRT
FT                   ILGMGGKSLSKELLDARLTVSNSAFVQRRYQIKPEAFYALFKEFTAPIPLNTDFPIFAA
FT                   DGSDICIPRNPMDTETSIQTQTDVKSYNLIHINALYDLTTGVYRDVSIQDKHAQHERLA
FT                   LIQMMEASPFRESSCYHG"
FT   gene            complement(744993..746006)
FT                   /locus_tag="SP670_0792"
FT   CDS_pept        complement(744993..746006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0792"
FT                   /product="3-carboxymuconate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90859"
FT                   /protein_id="ADM90859.1"
FT                   /translation="MKETVYFGTYTRRTSQGIYKADFDTETGQLSNLELFAAEPSPTYL
FT                   AFDQHQHLYTVGSQDDKGGIAAYQTDGTVLNHVVEEGAPHCYVAVDEKRDLVYAANYHK
FT                   GQVLVYKRQEDGSLLLSDMDQHSGQGPHENQASPHVHYTDLTPDHYLVTCDLGTDQVIT
FT                   YDLDQEGKLSKLYTYHSKPGAGSRHIIFHNHYKIAYLICELNSTIEVLIYDGVGEFERM
FT                   QVISTLPEAYEGFNGTAAIHLSKDGKYLYASNRGHDSIAVYTILADGSLELLEIVPTHG
FT                   QTPRDFDLTPDQKFLIVVHQDSDNATVFKRNCDNGRLAELSNDFHVPEAVCIRFAP"
FT   gene            746150..747316
FT                   /locus_tag="SP670_0793"
FT   CDS_pept        746150..747316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0793"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90860"
FT                   /protein_id="ADM90860.1"
FT                   /translation="MEQKEKHFSLSWFFKWFLDNKAITVFLVTLLLGLNLFILSKISFL
FT                   FSPVLDFLAVVMLPVILSGLLYYLLNPIVDWMEKHKVNRVIAITIVFVIIALFIIWGLA
FT                   VAIPNLQRQVLTFARNVPVYLEDIDRIVNGLVAQHLPDDFRPQLEQVLTNFSSQATVLA
FT                   SKVSSQAVNWVSAFISGASQVIVALIIVPFMLFYLLRDGKGLRNYLTQFIPRKLKEPVG
FT                   QVLSDVNQQLSNYVRGQVTVAIIVAVMFIIFFKIIGLRYAVTLGVTAGILNLVPYLGSF
FT                   LAMLPALVLGLIAGPVMLLKVVIVFIVEQTIEGRFVSPLILGSQLNIHPINVLFVLLTS
FT                   GSMFGIWGVLLGIPVYASAKVVISAIFEWYKVVSGLYELEGEEVKSEQ"
FT   gene            747306..748535
FT                   /locus_tag="SP670_0794"
FT   CDS_pept        747306..748535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0794"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90861"
FT                   /protein_id="ADM90861.1"
FT                   /translation="MNNSQQMLQALEEQDLTKAEHYFAKALENDSSDLLYELATYLEGI
FT                   GFYPQAKEIYLKIVEDFPEVHLNLAAIASEDGQIEEAFTYLEEIQADSDWYVSSLALKA
FT                   DLYQLEGLTDVAREKLLEALTYSEDSLLILGLAELDSELENYQAAIQAYAQLDNRSIYE
FT                   QTGISTYQRIGFAYAQLGKFETATEFLEKALELEYDDLTAFELASLYFDQEEYQKATLY
FT                   FKQLDTISPDFEGYEYGYSQALHKEHQVQEALRIAKQGLEKNPFETRLLLAASQFSYEL
FT                   HDASGAENYLLTAKEDAEDTEEILLRLATIYLEQERYEDILELQSEEPENLLTKWMIAR
FT                   SYQEMDDLDTAYEYYQELTGDLKDNPEFLEHYIYLLRELGHFEEAKVHAHTYLKLVPDD
FT                   VQMQELFERL"
FT   gene            748681..749322
FT                   /locus_tag="SP670_0795"
FT   CDS_pept        748681..749322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0795"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90862"
FT                   /protein_id="ADM90862.1"
FT                   /translation="MSYLFEILPSLLNGASTTVQVFALVLLFSIPLGVLIAFALQVHWK
FT                   PLHYLINIYIWVMRGTPLLLQLIFIYYVLPSIGIRLDRLPAAIIAFVLNYAAYFAEIFR
FT                   GGIDTIPRGQYEAAKVLKFSPFDRVRYIILPQVTKIVLPSVFNEVMSLVKDTSLVYALG
FT                   ISDLILASRTAANRDASLVPMFLAGAIYLILIGIVTIISKKVEKKYSYYR"
FT   gene            749332..749961
FT                   /locus_tag="SP670_0796"
FT   CDS_pept        749332..749961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0796"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90863"
FT                   /protein_id="ADM90863.1"
FT                   /translation="MLELRNINKVFGDKQILSNFSLSIPEKQILAIVGPSGGGKTTLLR
FT                   MLAGLETIDSGQIFYNGQPLELDELQKRNLLGFVFQDFQLFPHLSVLENLTLSPVKTMG
FT                   MKQEEAEKKASGLLEQLGLGGHAEAYPFSLSGGQKQRVALARAMMIDPEIIGYDEPTSA
FT                   LDPELRLEVEKLILQNRELGMTQIVVTHDLQFAENIADVLLKVEPK"
FT   gene            749974..750822
FT                   /locus_tag="SP670_0797"
FT   CDS_pept        749974..750822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0797"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90864"
FT                   /protein_id="ADM90864.1"
FT                   /translation="MKKWMKKWMLVLVSLMTALFLVACGKNSSETSGDNWSKYQSNKSI
FT                   TIGFDSTFVPMGFAQKDGSYAGFDIDLATAVFEKYGITVNWQPIDWDLKEAELTKGTID
FT                   LIWNGYSATDERREKVAFSNSYMKNEQVLVTKKSSGITTAKDMTGKTLGAQAGSSGYAD
FT                   FEANPEILKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYN
FT                   VFTVGLETEAFAVGARKEDTNLVKKINEAFSSLYKDGKFQEISQKWFGEDVATKEVKEG
FT                   Q"
FT   gene            complement(751100..751447)
FT                   /locus_tag="SP670_0798"
FT   CDS_pept        complement(751100..751447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0798"
FT                   /product="bacterocin transport accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90865"
FT                   /protein_id="ADM90865.1"
FT                   /translation="MEQFLDNIKDLEVTTVVRAQEALDKKETATFFIGRKTCPYCRKFA
FT                   GTLSGVVAETKAHIYFINSEEPSQLNDLQAFRSRYGIPTVPGFVHITDGQINVRCDSSM
FT                   SAQEIKDFAGL"
FT   gene            complement(751558..753276)
FT                   /locus_tag="SP670_0799"
FT   CDS_pept        complement(751558..753276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0799"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90866"
FT                   /protein_id="ADM90866.1"
FT                   /translation="MSYQENYQKWVDFVELPDYLRQDLENMDEKTKEDAFYTNLEFGTA
FT                   GMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESA
FT                   AVLAKHGIKSYVFESLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQM
FT                   PPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPAL
FT                   IEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQ
FT                   AAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAH
FT                   KNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYM
FT                   MGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKT
FT                   ISVTLSGVDGAEQIKAIMAKFRNNAPKEWNATAITVVEDFKAQTATVADGTVTNLTTPP
FT                   SDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNEESQAKIANIEAEINAFVK"
FT   gene            753510..753653
FT                   /locus_tag="SP670_0800"
FT   CDS_pept        753510..753653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0800"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90867"
FT                   /protein_id="ADM90867.1"
FT                   /translation="MAYSTDFKQRALDSIKEGHSHVEAAKFFGVGVRTLFTWEKKDVNK
FT                   DT"
FT   gene            753701..753835
FT                   /locus_tag="SP670_0801"
FT   CDS_pept        753701..753835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0801"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90868"
FT                   /protein_id="ADM90868.1"
FT                   /translation="MKAFVEAHPDAFLREIAAHFDCALPSVWAALKYIKVTLKKDDEL"
FT   gene            753822..754355
FT                   /locus_tag="SP670_0802"
FT   CDS_pept        753822..754355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0802"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90869"
FT                   /protein_id="ADM90869.1"
FT                   /translation="MTSFKEQEPEKVAEFLDILDNLKDLPIVYIDETGIDRYLYRPYAR
FT                   APRGEKVYEKISGRRFERTSIVAGQVDGEFIAPMIYKKSMTSDFFVEWFKTQLLPALKT
FT                   PHVIVMGNASFHPKNILDELCIQDKHFFLPLPPYSPDLNPIEQAWAILKKKVTDLLREV
FT                   PTIFECLECFFKTR"
FT   gene            754477..754590
FT                   /locus_tag="SP670_0803"
FT   CDS_pept        754477..754590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90870"
FT                   /protein_id="ADM90870.1"
FT                   /translation="MYKKGLNVELAHQQIKGFFEAEFKNRINGVLNTKIKK"
FT   gene            754696..754950
FT                   /locus_tag="SP670_0804"
FT   CDS_pept        754696..754950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0804"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90871"
FT                   /protein_id="ADM90871.1"
FT                   /translation="MLNVDQDFMSISKSNKSGSDWKKTFTVRTTNRLANDLNNVLKQAD
FT                   KDTPNTPTWLNSAASKAKDDDRAYKLLKTLIPGENYLSC"
FT   gene            755061..756167
FT                   /locus_tag="SP670_0805"
FT   CDS_pept        755061..756167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0805"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90872"
FT                   /protein_id="ADM90872.1"
FT                   /translation="MNIILIAKPLRENTNTKANALNNGWARSGSEEFKKFSHFVGVDKG
FT                   IVRTNVLTGKKLSDKIRKEVGSGDSKLGKGGYFSTGDVLLGKDVVSYTVQVFSENNERV
FT                   GVNTQSHRVQYNLPILADFSVIQDTVEPSRTVVEKIIPKLNIPEEEKGKITEEIKKKKK
FT                   TSELAELISENVKVRYVDEQGRLLSLKNDTGIGEKESDGTYITNKKQLIGTSYNVTDKK
FT                   LSSMTTTDGKYYTFKEADTNSASLTGNIVSEGRTVTLVYRESEAPTTATVTANYYKEGS
FT                   QEKLAESVIKADLAIGSEYTTESKTIEGKTTTEDKEDRVITRKTTYTLVATPANAYQKT
FT                   VQQLTITTVRMLRKQWFPKQQPLLRRRL"
FT   gene            756125..756646
FT                   /locus_tag="SP670_0806"
FT   CDS_pept        756125..756646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0806"
FT                   /product="MucBP domain family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90873"
FT                   /protein_id="ADM90873.1"
FT                   /translation="MVPKTATSTETKTITRIIHYVDKVTNQNVKEDVVQPVTLSRTKTE
FT                   NKVTGVVTYGEWTTGNWDEVVSGKIDKYKDPDIPTVESQEVTSDSSDKEITVRYDRLST
FT                   PDKPTPDPGTPKTETPVNPDPEVPTYETGKREELPNTGTEANATLASAGIMTLLASLGL
FT                   GFFKKKEDEK"
FT   gene            756870..757739
FT                   /locus_tag="SP670_0807"
FT   CDS_pept        756870..757739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0807"
FT                   /product="glycerol facilitator-aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90874"
FT                   /protein_id="ADM90874.1"
FT                   /translation="MDFTWALKYATEFLGTAILIILGNGAVANVELKGTKGHQSGWIVI
FT                   AVGYGMGVMIPALMFGNVSGNHINPAFTLGLAVSGLFPWAQVVPYIIAQVLGAIFGQAL
FT                   VVATYRPFYLKTENPNNILGTFSTISSIDHGTKESRYAATVNGLINEFVGSFVLFFAAL
FT                   GLTKNFFGAEVLQFMKQKAIEAGQTVDFSDLAIKAQVAPHTASGLSVAHLALGFLVMAL
FT                   VTSLGGPTGPALNPARDLGPRLLHAFLPKSVLGEHKGDSKWWYSWVPVVAPIAAAIAAV
FT                   AVFKFLYL"
FT   gene            758184..758306
FT                   /locus_tag="SP670_0808"
FT   CDS_pept        758184..758306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0808"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90875"
FT                   /protein_id="ADM90875.1"
FT                   /translation="MTLLSPMIVIVLSAILYSMKIKGQTKKLAAGCSKHSFEVV"
FT   gene            758649..759845
FT                   /gene="tuf"
FT                   /locus_tag="SP670_0809"
FT   CDS_pept        758649..759845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="SP670_0809"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90876"
FT                   /protein_id="ADM90876.1"
FT                   /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVN
FT                   QPKDYASIDAAPEERERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDG
FT                   AILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
FT                   YDFPGDDLPVIQGSALKALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVF
FT                   SITGRGTVASGRIDRGIVKVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGV
FT                   LLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTT
FT                   DVTGSIELPAGTEMVMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA"
FT   gene            760229..760579
FT                   /locus_tag="SP670_0810"
FT   CDS_pept        760229..760579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0810"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90877"
FT                   /protein_id="ADM90877.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVLFRLMGKSYKEIIEL
FT                   LDCNQTTIWRNVKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATEAGEFVT
FT                   IPYFRLISFLHT"
FT   gene            760533..760718
FT                   /locus_tag="SP670_0811"
FT   CDS_pept        760533..760718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0811"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90878"
FT                   /protein_id="ADM90878.1"
FT                   /translation="MLQYLISGLYRSYTRDAFYQLLKRHGWRNIMPRPEHPKKADAQTI
FT                   VASKNKISIQEEKKAL"
FT   gene            760750..761259
FT                   /locus_tag="SP670_0812"
FT   CDS_pept        760750..761259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0812"
FT                   /product="transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90879"
FT                   /protein_id="ADM90879.1"
FT                   /translation="MYQDEAGFGRISKLGSCWSPIGVGPHVHSHYIREFRYCYGAVDAH
FT                   TGESFFLRAGGCNTEWMNAFLEELSQAYPDDYLLLVMDNAIWHKSSTLKIPTNIGFAFI
FT                   PPYTPEINPVEQVWKEIRKRGFKNKAFRTLEDVMNQLQDIIQGLEKEVIKPIVNRRWTR
FT                   MLFESR"
FT   gene            complement(761323..762405)
FT                   /locus_tag="SP670_0813"
FT   CDS_pept        complement(761323..762405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0813"
FT                   /product="dead rna helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90880"
FT                   /protein_id="ADM90880.1"
FT                   /translation="MKTKLPTEWQELSDQLGFQEFTPIQTQLFDPLLTGENLLGVSQTG
FT                   TGKTLAYLLPSLLRLQKKKAQQLLILAPNTELAGQIFDVCKTWAEAIGLTAQLFLSGSS
FT                   QKRQIERLKKGPEILIGTPGRIFELIKLKKIKMMNVETIILDEFDQLLDDSQIHFVEKI
FT                   THYAPRDHQLVYMSATTKFDQEKIVPNTRTIDLSNQKLDNIQHFYMQVDQRHRVDILRK
FT                   LAHVEDFRGLVFFNSLSDLGNAEEKLQYRDILAVSLASDVNVKFRKVILEKFKDNQLTL
FT                   LLATDLLARGIDIDSLECVVNFDIPRDSETYTHRAGRTGRMGKEGYVITLVTHPEEIKK
FT                   LKKFASIREIVLKNQELYIK"
FT   gene            complement(762402..763379)
FT                   /locus_tag="SP670_0814"
FT   CDS_pept        complement(762402..763379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0814"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90881"
FT                   /protein_id="ADM90881.1"
FT                   /translation="MLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASR
FT                   YQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVTQPQEWFD
FT                   LIQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGADFNYAKYSSKMPDLLTGQTP
FT                   NVFSDRFAGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSIDLNGDGILFYPDYQV
FT                   HIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQTHHTMTEEV
FT                   AAFAHMIQQPDLNLYQTWLDDAGSVHELLYTMRQTAGIRFEAEK"
FT   gene            763612..763989
FT                   /locus_tag="SP670_0815"
FT   CDS_pept        763612..763989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0815"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90882"
FT                   /protein_id="ADM90882.1"
FT                   /translation="MICQFIRDMLDLPAKNVTILEGSNIHVLPSMPYSAQDFYTSIDVL
FT                   AELDNGIQVIIEIQVHHQNFFINRLWAYLCSQVNQNLEKIRQREGDTHQSYKQIAPVYA
FT                   IAIVDSNYFSDDLAFHSFIVK"
FT   gene            764224..765614
FT                   /pseudo
FT                   /locus_tag="SP670_0817"
FT   CDS_pept        764224..765614
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0817"
FT                   /note="peptidoglycan GlcNAc deacetylase, unverified
FT                   frameshift"
FT   gene            765728..766570
FT                   /locus_tag="SP670_0818"
FT   CDS_pept        765728..766570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0818"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90883"
FT                   /protein_id="ADM90883.1"
FT                   /translation="MNTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDT
FT                   AAIYQNEESVGQAIKDSGVPREEMFVTTKLWNSQQTYEQTRQALEKSIEKLGLDYLDLY
FT                   LIHWPNPKPLRENDAWKTRNAEVWRAMEDLYQEGKIRAIGVSNFLPHHLDALLETATIV
FT                   PAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQEIAANHGKSIAQI
FT                   ALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF"
FT   gene            766825..766953
FT                   /locus_tag="SP670_0819"
FT   CDS_pept        766825..766953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90884"
FT                   /protein_id="ADM90884.1"
FT                   /translation="MKERRAVDNLYLVKDDSQLAAFRDFVVRNTEKLKRLSIFFKE"
FT   gene            767060..767605
FT                   /locus_tag="SP670_0820"
FT   CDS_pept        767060..767605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90885"
FT                   /protein_id="ADM90885.1"
FT                   /translation="MVMTPDLAVWKELYLYQLMDYECSQQTQAIESHYHSLSENFLLQI
FT                   VGHELAHWSEYFLDDFDGYDSYIWFEEGMVEYISRKYFLTEEEFQAEKICNQSLVELFQ
FT                   KKYGWHSLNDFGSSTYDKNYASIFYEYWRSFLTIDKLVENLGSVQAVFDSYHLWANTDK
FT                   TLPLLNWFVQQKLIEKEI"
FT   gene            767800..768717
FT                   /gene="glyQ"
FT                   /locus_tag="SP670_0821"
FT   CDS_pept        767800..768717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="SP670_0821"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90886"
FT                   /protein_id="ADM90886.1"
FT                   /translation="MSKKLTFQEIILTLQQFWNDQGCMLMQAYDNEKGAGTMSPYTFLR
FT                   AIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKLG
FT                   INPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATGPVTAEVTY
FT                   GLERLASYIQEVDSVYDIEWANGVKYGEIFIQPEYEHSKYSFEISDQEMLLENFDKFEK
FT                   EAGRALEEGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVA
FT                   ERKRLGYPLLDEETRVKLLAEDAE"
FT   gene            768977..771013
FT                   /gene="glyS"
FT                   /locus_tag="SP670_0822"
FT   CDS_pept        768977..771013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="SP670_0822"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90887"
FT                   /protein_id="ADM90887.1"
FT                   /translation="MTKNLLVELGLEELPAYVVTPSEKQLGEKMAAFLKENRLSFEAIQ
FT                   TFSTPRRLAVRVTGLSDKQSDLTEDFKGPAKKIALDSDGNFTKAAQGFVRGKGLTVEDI
FT                   EFREIKGEEYVYVTKEEVGQSVEAIVPGVVDVLKSLTFPVSMHWAGNSFEYIRPVHTLT
FT                   VLLDEQEFDLDFLDIKGSRVSRGHRFLGKETKIQSALSYEEDLRKQFVIADPCEREQMI
FT                   VDQIKEIEAKHGVRIEIDADLLNEVLNLVEYPTAFMGSFDAKYLEVPEEVLVTSMKEHQ
FT                   RYFVVRDQDGKLLPNFISVRNGNAERLKNVIKGNEKVLVARLEDGEFFWREDQKLVISD
FT                   LVEKLNNVTFHEKIGSLREHMIRTGQITVLLAEKAGLSVDETVDLARAAAIYKFDLLTG
FT                   MVGEFDELQGIMGEKYTLLAGETPAVAAAIREHYMPTSAEGELPESKVGAVLAIADKLD
FT                   TILSFFSVGLIPSGSNDPYALRRATQGVVRILDAFGWHIAMDELIDSLYALKFDSLTYE
FT                   NKAEVMDFIKARVDKMMGSTPKDIKEAVLAGSNFVVADMLEAASALVEVSKEEDFKPSV
FT                   ESLSRAFNLAEKAEGVATVDSALFENDQEKALAEAVETLVLSGPASQQLKQLFALSPVI
FT                   DAFFENTMVMAEDQAVRQNRLAILSQLTKKAAKFACFNQINTK"
FT   gene            771055..771312
FT                   /locus_tag="SP670_0823"
FT   CDS_pept        771055..771312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0823"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90888"
FT                   /protein_id="ADM90888.1"
FT                   /translation="MDPKKIARINELAKKKKTEGLTPEEKVEQAKLREEYIEGYRRAVR
FT                   HHIEGIKIVDEEGNDVTPEKLRQVQREKGLHGRSLDDPNS"
FT   gene            complement(771429..772673)
FT                   /locus_tag="SP670_0824"
FT   CDS_pept        complement(771429..772673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0824"
FT                   /product="NADPH-dependent fmn reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90889"
FT                   /protein_id="ADM90889.1"
FT                   /translation="MKFVGLVGSNYDQSYNRKLLEFIRRNFKFKFELEVLEIDEVPMFN
FT                   QDEKWDESFQLRFLYNKITRADGVIIATPEHNHTISASLKSVLEWLSYEVHPFENKPVM
FT                   IVGASYYDQGTSRAQVHLRKILDAPGVNAYTLPGNEFLLGKAKEAFDNNGNITNEGTVK
FT                   FLETCLDNFVKYVGVVSKLKKPKPIESEDLDCGKPIATTITEVDPDDPEWVEKVAAITG
FT                   AVSGDTYVKLDHGILTVNQIDMFLKAMPFELTYADDNNQFLYYNNAHQDPDTMFAKRVP
FT                   PQSGSRMSTVHGSLPPARMKNVEWVIGTLRNGNQEYVRTIVPGSPAGVINTHNYQAMYY
FT                   PDGSYAGINEIVFNFQPWLDWYLKETGQRLVGGSGPFAPAAGGHGDADATSGASDSGDV
FT                   GGHGGDADATAGASY"
FT   gene            complement(772691..773296)
FT                   /locus_tag="SP670_0825"
FT   CDS_pept        complement(772691..773296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0825"
FT                   /product="NADPH-dependent fmn reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90890"
FT                   /protein_id="ADM90890.1"
FT                   /translation="MLKLIAIVGTNSKRSTNRQLLQYMQKHFADKAEIELVEIKAIPVF
FT                   NKPADKQVPAEILEIAAKIEEADGVIIGTPEYDHSIPAVLMSALAWLSYGIYPLLNKPI
FT                   MITGASYGTLGSSRAQLQLRQILNAPEIKANVLPDEFLLSHSLQAFNPSGDLVDLDVIK
FT                   KLDAIFDDFRIFVKITEKLRNAQELLRKDAEDFDWENL"
FT   gene            complement(773356..774279)
FT                   /locus_tag="SP670_0826"
FT   CDS_pept        complement(773356..774279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0826"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90891"
FT                   /protein_id="ADM90891.1"
FT                   /translation="MTLRSHSERLMGTTITISLVDEQADIFLQKSFDLLKELEYRFNAN
FT                   SQESELMEINYQAGVSPVTVHPDLFELISLGLEHSLALSSHLNISIGPLIQTWRIGFSD
FT                   AKVAQPQEIESVLPLINPHGIELDSSTSTVFLKQKGMKIDLGCLAKGYSADKVAQFLRK
FT                   EGVTSALINLGGNILTIGKNQARGDNPWQIGIQDPANPRGNHLMTIPVVNKSVVTSGIY
FT                   ERHLTVDGQDYHHIFDSQTGYPVETELASLTIISDKSVDGEIWTTRLFGERPASILWQV
FT                   ESLEGIEVILIDKEGHLSCSSGIPTL"
FT   gene            774573..775952
FT                   /locus_tag="SP670_0827"
FT   CDS_pept        774573..775952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0827"
FT                   /product="NADH oxidase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90892"
FT                   /protein_id="ADM90892.1"
FT                   /translation="MSKIVVVGANHAGTACINTMLDNFGNENEIVVFDQNSNISFLGCG
FT                   MALWIGEQIDGAEGLFYSDKDKLEAKGAKVYMNSPVLSIDYDNKVVTAEVEGKEHKESY
FT                   EKLIFATGSTPILPPIEGVEIVKGNREFKATLENVQFVKLYQNAEEVINKLSDKSQHLD
FT                   RIAVVGGGYIGVELAEAFERLGKEVVLVDIVDTVLNGYYDKDFTQMMAKNLEDHNIRLA
FT                   LGQTVKAIEGDGKVERLITDKESFDVDMVILAVGFRPNTALADGKIELFRNGAFLVDKK
FT                   QETSIPGVYAVGDCATVYDNARKDTSYIALASNAVRTGIVGAYNACGHELEGIGVQGSN
FT                   GISIYGLHMVSTGLTLEKAKAAGYNATETGFNDLQKPEFMKHDNHEVAIKIVFDKDSRE
FT                   ILGAQMVSHDIAISMGIHMFSLAIQEHVTIDKLALTDLFFLPHFNKPYNYITMAALTAE
FT                   K"
FT   gene            776104..776979
FT                   /locus_tag="SP670_0828"
FT   CDS_pept        776104..776979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0828"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90893"
FT                   /protein_id="ADM90893.1"
FT                   /translation="MTENRYELNKNLAQMLKGGVIMDVQNPEQARIAEAAGAAAVMALE
FT                   RIPADIRAAGGVSRMSDPKMIKEIQEAVSIPVMAKVRIGHFVEAQILEAIEIDYIDESE
FT                   VLSPADDRFHVDKKEFQVPFVCGAKDLGEALRRIAEGASMIRTKGEPGTGDIVQAVRHM
FT                   RMMNQEIRRIQNLREDELYVAAKDLQVPVELVQYVHEHGKLPVVNFAAGGVATPADAAL
FT                   MMQLGAEGVFVGSGIFKSGDPVKRASAIVKAVTNFRNPQILAQISEDLGEAMVGINENE
FT                   IQILMAERGK"
FT   gene            776980..777561
FT                   /locus_tag="SP670_0829"
FT   CDS_pept        776980..777561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0829"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90894"
FT                   /protein_id="ADM90894.1"
FT                   /translation="MKIGILALQGAFAEHAKVLDQLGVESVELRNLDDFQQDQSDLSGL
FT                   ILPGGESTTMGKLLRDQNMLLPIREAILSGLPVFGTCAGLILLAKEITSQKESHLGTMD
FT                   MVVERNAYGRQLGSFYTEAECKGVGKIPMTFIRGPIISSVGEGVEILATVNNQIVAAQE
FT                   KNMLVSSFHPELTDDVRLHQYFINMCKEKS"
FT   gene            complement(777582..778229)
FT                   /locus_tag="SP670_0830"
FT   CDS_pept        complement(777582..778229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0830"
FT                   /product="hemolysin-3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90895"
FT                   /protein_id="ADM90895.1"
FT                   /translation="MNTSLKLSKQLSFGEEIANSVTHAVGAVIMLILLPISSIYSYEAH
FT                   GFLSSIGVSIFVISLFLMFLSSTIYHSMAYGSTHKYVLRIIDHSMIYVAIAGSYTPVVL
FT                   TLMNNWFGYLIIVIQWGTTIFGILYKIFAKKVNEKFSLALYLIMGWLVLAIIPAIINQT
FT                   TPVFWSLMVTGGLCYTVGAGFYAKKKPYFHMIWHLFILAASVLQYIAIVYYM"
FT   gene            complement(778226..778672)
FT                   /locus_tag="SP670_0831"
FT   CDS_pept        complement(778226..778672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0831"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90896"
FT                   /protein_id="ADM90896.1"
FT                   /translation="MKTTFSYPKWAEIPNIDLYLDQVLLYVNQVCAPISPNKDKGLTAS
FT                   MVNNYVKNGYLTKPDKKKYQRQQIARLIAITTLKSVFSIQEIAQTLNTLQTQASSDQLY
FT                   DAFVDYMNQGIDPANPIIQTSCQTVKLYHQTLDLIDHTQEEVIQ"
FT   gene            778807..779301
FT                   /locus_tag="SP670_0832"
FT   CDS_pept        778807..779301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0832"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90897"
FT                   /protein_id="ADM90897.1"
FT                   /translation="MEIRLAFPNEVDAIMQVMEDAKKCLADAGSDQWQNGYPNADVIID
FT                   DIISGQAYVALEEGELLAYAAVTKSPEEAYEAIYEGNWQAGESEYLVFHRIAVAADVQG
FT                   KGVAQTFLEGLIEGFDYLDFRSDTHAENKVMQHIFEKLGFKQVGKVPVDGERLAYQKLK
FT                   K"
FT   gene            779301..779831
FT                   /locus_tag="SP670_0833"
FT   CDS_pept        779301..779831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0833"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90898"
FT                   /protein_id="ADM90898.1"
FT                   /translation="MQKKYVKILYSSPIGILSLVADDHYLYGIWVQEQKHFERGLGDET
FT                   IEEVVSHPILDPVIACLDDYFKGKPQDLSNLLLAPIGTNFEKRVWDYLQGIPYGQTVTY
FT                   GQIAQDLQVASAQAIGGAVGRNPWSILVPCHRVLGAGKRLTGYAAGVEKKAWLLEHEGV
FT                   DFKDRNNRRRSTC"
FT   gene            779825..780181
FT                   /locus_tag="SP670_0834"
FT   CDS_pept        779825..780181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0834"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90899"
FT                   /protein_id="ADM90899.1"
FT                   /translation="MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNW
FT                   LETSGFELKQFFNTSGIKYRELGLKDKVGSLSNQEAAELLASDGMLLKRPILVENGTVK
FT                   QIGYRKSYEELGLK"
FT   gene            780339..781139
FT                   /locus_tag="SP670_0835"
FT   CDS_pept        780339..781139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0835"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-aspartate/glutamate transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90900"
FT                   /protein_id="ADM90900.1"
FT                   /translation="MNVTTILASDWYQNLMQLIPDGKLFSLRSVFDGIPRIVQQLPTTI
FT                   MLTIGGALFGLVLALLFAIVKINRVKILYPLQAFFVSFLKGTPILVQLMLTYYGIPLAL
FT                   KALNQQWGTGLNINAIPAAAFAIVAFAFNEAAYASETIRAAILSVNPGEIEAARSLGMT
FT                   RAQVYRRVIIPNAAVVATPTLINSLIGLTKGTSLAFSAGVVEVFAQAQILGGADYRYFE
FT                   RFISVALVYWVVNIGIESLGRFIERKMAISAPDTVQTDVKGDLR"
FT   gene            781139..781882
FT                   /locus_tag="SP670_0836"
FT   CDS_pept        781139..781882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0836"
FT                   /product="L-cystine import ATP-binding protein TcyN"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90901"
FT                   /protein_id="ADM90901.1"
FT                   /translation="MIKISNLSKSFSGQTVLDHLNLDIQKGEVVALIGSSGAGKSTFLR
FT                   SLNYLETPDSGSIQIDGFSVDFSKITQEEILALRRKLSMVFQQFNLFERRTALDNVKEG
FT                   LVVVKKLSDQEATKIAKEELAKVGLSDRENHYPRHLSGGQKQRVALARALAMKPDVLLL
FT                   DEPTSALDPELVGEVEKSIADAAKSGQTMILVSHDMSFVAQVADKILFLDKGKIIESGT
FT                   PDEIIHTPKEERTKEFFASYKRTYI"
FT   gene            781960..782184
FT                   /locus_tag="SP670_0837"
FT   CDS_pept        781960..782184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0837"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90902"
FT                   /protein_id="ADM90902.1"
FT                   /translation="MLLQLFSLYFESLILTTILVLIFLGIWIGLRAMSGVDKTAKARQA
FT                   HLYDMIMIGVLVVPVLSFAVMSLILVFKA"
FT   gene            782250..783161
FT                   /gene="trxB"
FT                   /locus_tag="SP670_0838"
FT   CDS_pept        782250..783161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SP670_0838"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90903"
FT                   /protein_id="ADM90903.1"
FT                   /translation="MYDTIIIGAGPAGMTAALYAARSNLKVALIEGGLPGGQMNNTSDI
FT                   ENYPGYANISGPELAEKMFEPLENLGVEHIYGYVENVEDHGDFKKVMTDDQTYETRTVI
FT                   VATGSKHRPLGVPGEEELNSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEALFLTRFA
FT                   KTVTIVHRRDQLRAQKVLQDRAFANEKISFIWDSVVREIKGENRVESVVFENVKTGQVT
FT                   EQVFGGVFIYVGLDPLSDFVKELNIQDQAGWIVTDNHMKTAVDGIFAVGDVRLKDLRQV
FT                   TTAVGDGAIAGQEAYKFITEHS"
FT   gene            complement(783199..783927)
FT                   /locus_tag="SP670_0839"
FT   CDS_pept        complement(783199..783927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0839"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90904"
FT                   /protein_id="ADM90904.1"
FT                   /translation="MKTNDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATE
FT                   KKVSISWTSKKSLSEMTEGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLT
FT                   DPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLNQTLYK
FT                   LKDEGFWTFGTDMNGTPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQ
FT                   SLNASVAAAILMYEVFRNRL"
FT   gene            complement(783972..784583)
FT                   /locus_tag="SP670_0840"
FT   CDS_pept        complement(783972..784583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0840"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90905"
FT                   /protein_id="ADM90905.1"
FT                   /translation="MSAIERITKAAHLIDMNDIIREGNPTLRAIAEEVTFPLSDQEIIL
FT                   GEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAVLVPNIVEEGETPQEAYD
FT                   LEAIMYNPKIVSHSVQDAALGEGEGCLSVDRNVPGYVVRHARVTVDYFDKDGEKHRIKL
FT                   KGYNSIVVQHEIDHINGIMFYDRINEKDPFAVKDGLLILE"
FT   gene            784762..784953
FT                   /locus_tag="SP670_0841"
FT   CDS_pept        784762..784953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90906"
FT                   /protein_id="ADM90906.1"
FT                   /translation="MKEILICDIIKRKGLHKKVGRTKIQRRQNRNQGGLAFRFMKGLVN
FT                   FLGVIASGAIRDLWRYSC"
FT   gene            complement(784907..785020)
FT                   /locus_tag="SP670_0842"
FT   CDS_pept        complement(784907..785020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0842"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90907"
FT                   /protein_id="ADM90907.1"
FT                   /translation="MTSQGIPWKLSNNKTKPIDKPTASKSIATNPLLLHLR"
FT   gene            785096..785218
FT                   /locus_tag="SP670_0843"
FT   CDS_pept        785096..785218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0843"
FT                   /product="enzyme of poly-gamma-glutamate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90908"
FT                   /protein_id="ADM90908.1"
FT                   /translation="MAHGDLLYHDGLFFSAKKEDGTYDFHENFEYVTPWLKQGD"
FT   gene            785312..785824
FT                   /locus_tag="SP670_0844"
FT   CDS_pept        785312..785824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0844"
FT                   /product="enzyme of poly-gamma-glutamate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90909"
FT                   /protein_id="ADM90909.1"
FT                   /translation="MDAIKEAGYHVLDLAHNHILDSQIEGVISTADIIEKAGITPIGVY
FT                   THEPRDQAPLVIKEVNAIKVALLAYSYGFNGIEQYIFQEDYNRYLSDLNEDKIKAEVER
FT                   AEKEADITIIMPQMGVEYRLEPTEEQKALYHKMIDWGADIIFGGHPHVVEPSETVEKDG
FT                   DKKLIIY"
FT   gene            785825..785974
FT                   /locus_tag="SP670_0845"
FT   CDS_pept        785825..785974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0845"
FT                   /product="enzyme of poly-gamma-glutamate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90910"
FT                   /protein_id="ADM90910.1"
FT                   /translation="MGNFISNQRIESMGDEENAKWTERGVLMDVTIKKKDGKTTIGTAK
FT                   AHPT"
FT   gene            786183..787010
FT                   /locus_tag="SP670_0846"
FT   CDS_pept        786183..787010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0846"
FT                   /product="conserved hypothetical protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90911"
FT                   /protein_id="ADM90911.1"
FT                   /translation="MMIKVIATDMDGTLLDARGQLDLPRLEKILDQLDQRGIRFVIATG
FT                   NEIHRMRQLLSPLVDRVVLVVANGARIFENNELIQAQTWDDAIVNKALAHFKGRACQNQ
FT                   FVVTGMKGDFVKEGTIFTDLESFMTPEMIEKFYQRMQFVDELTSDLFGGVLKMSMVVGE
FT                   ERLSSVLEEINALFDGRVRAVSSGYGCIDILQAGIHKAWGLEELLKRWDLKSQEIMAFG
FT                   DSENDVEMLEMAGIAYAMENADEKAKAVATALAPANSQGGVYQVLENWLEKGE"
FT   gene            787012..787647
FT                   /locus_tag="SP670_0847"
FT   CDS_pept        787012..787647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0847"
FT                   /product="conserved hypothetical protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90912"
FT                   /protein_id="ADM90912.1"
FT                   /translation="MVVQLLENWLLKEQEKIQTKYRHLNHISVVEPNILFIGDSIVEYY
FT                   PLQELFGTSKTIVNRGIRGYQTGLLLENLDAHLYGGAVDKIFLLIGTNDIGKDVPVNEV
FT                   LNNLEAIIQSVARDYPLTEIKLLSILPVNEGEKYQQAVYIRSNEKIQNWNQAYQELASA
FT                   YMQVEFVPVFDCLTDQAGQLKKEYTTDGLHLSIAGYQALSKSLKDYLY"
FT   gene            787731..788456
FT                   /locus_tag="SP670_0848"
FT   CDS_pept        787731..788456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0848"
FT                   /product="CppA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0848"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90913"
FT                   /protein_id="ADM90913.1"
FT                   /translation="MNVNQIVRIIPTLKANNRKLNETFYIETLGMKALLEESAFLSLGD
FT                   QTGLEKLVLEEAPSMRTRKVEGRKKLARLIVKVENPLEIEGILSKTDSIHRLYKGQNGY
FT                   AFEIFSPEDDLILIHAEDDIASLVEVGEKPEFQTDLASISLSKFEISMELHLPTDIESF
FT                   LESSEIGASLDFIPAQGQDLTVDNTVTWDLSMLKFLVNELDIASLRQKFESTEYFIPKS
FT                   EKFFLCKDRNNVELWFEEV"
FT   gene            788453..789388
FT                   /locus_tag="SP670_0849"
FT   CDS_pept        788453..789388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0849"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0849"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90914"
FT                   /protein_id="ADM90914.1"
FT                   /translation="MKWTKIIKKIEEQIEAGIYPGASFAYFKDNQWTEFYLGQSDPEHG
FT                   LQTEAGLVYDLASVSKVVGVGTVCTFLWEIGQLDIDRLVIDFLPESDYPDITIRQLLTH
FT                   ATDLDPFIPNRDLLTAPELKEAMFHLNRRSQPAFLYSDVHFLLLGFILERIFNQDLDVI
FT                   LKDQVWKPWGMTETKFGPVELAVPTVRGVEAGIVHDPKARLLGRHAGSAGLFSTIKDLQ
FT                   IFLEHYLADDFARDLNQNFSPLDDKERSLAWNLEGDWLDHTGYTGTFIMWNRQKQEATI
FT                   FLSNRTYEKDERAQWILDRNQVMNLIRKEE"
FT   gene            789397..790293
FT                   /locus_tag="SP670_0850"
FT   CDS_pept        789397..790293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0850"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90915"
FT                   /protein_id="ADM90915.1"
FT                   /translation="MSNSLKGTLLTVVAGIAWGVSGTSGQYLMAHGISALVLTNLRLLI
FT                   AGGILMILAYATAKDKILVFLKDRKSLLSLLIFALIGLFLNQFAYLSAIQETNAGTATV
FT                   LQYVCPVGILIYSCIKDRVAPTLGEIVSIIFAIGGTFLIATHGQLDQLSMTPAGLFWGL
FT                   FSALTYALYIILPIALIKKWGSSLVIGVGMVIAGLVALPFTGVLQANIPTSLDFLLAFA
FT                   GIILIGTVFAYTAFLKGASLIGPVKSSLLASIEPISAVFFAFLIMNEQFYPIDFLGMAM
FT                   ILFAVTLISLKDLFLEK"
FT   gene            complement(790336..791034)
FT                   /locus_tag="SP670_0851"
FT   CDS_pept        complement(790336..791034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0851"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90916"
FT                   /protein_id="ADM90916.1"
FT                   /translation="MLPAYMKIHDQIKKDIDEHRWAIGERLPSERDLAEQFAVSRMTLR
FT                   QAVSLLVEEGVLERRVGSGTFVSSTRVQEKMRGTTSFTEIVKSQGKVPSSQLISYKKTI
FT                   PNEQEVAKLGIFPTDNIIRMERVRYADQVPLVYEVASIPEKFIKDFKKEEITSHFFQTL
FT                   QKHGYRIGKSQQTIYARLAKEKIAHYLEVEKGHAILGLTQVSYLEDGTAFEYVKSQYVG
FT                   ERFEFYLENN"
FT   gene            791176..792738
FT                   /locus_tag="SP670_0852"
FT   CDS_pept        791176..792738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0852"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90917"
FT                   /protein_id="ADM90917.1"
FT                   /translation="MSNISTDLQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKI
FT                   SAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKV
FT                   VPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPY
FT                   AAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKIRET
FT                   VGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGL
FT                   NIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLKDVKFLAQGTLYTDVI
FT                   ESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFP
FT                   GPGLAIRVMGEITEEKLETVRESDAILREEIAKAGLDRDIWQYFTVNTGVRSVGVMGDG
FT                   RTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATV
FT                   EWE"
FT   gene            793042..793227
FT                   /locus_tag="SP670_0853"
FT   CDS_pept        793042..793227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0853"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90918"
FT                   /protein_id="ADM90918.1"
FT                   /translation="MPQPIVPVEIPQSRLFDSKKRNDILLKIRIGKLEVSFFQSLNLEM
FT                   VEQLLDKVLLYDNSSI"
FT   gene            793208..793495
FT                   /locus_tag="SP670_0854"
FT   CDS_pept        793208..793495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0854"
FT                   /product="IS66 family element"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0854"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90919"
FT                   /protein_id="ADM90919.1"
FT                   /translation="MTIHLSSLGQVYLVCGKTDMRQGIDSLAYLVKTHFELDPFSGQVF
FT                   LFCGGRKDRFKALYWDGQGFWLLYKRFENGRLTWLSTEKDVKALAPEQVD"
FT   gene            793728..793922
FT                   /locus_tag="SP670_0855"
FT   CDS_pept        793728..793922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0855"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90920"
FT                   /protein_id="ADM90920.1"
FT                   /translation="MKIIQQQSATIDSLTNELALLREQVAYLTQKLYGKSSEKSVCPSG
FT                   QLNLFEEESPSEEDGDVPS"
FT   gene            793909..794214
FT                   /locus_tag="SP670_0856"
FT   CDS_pept        793909..794214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0856"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90921"
FT                   /protein_id="ADM90921.1"
FT                   /translation="MFPVETEEITYKRKKSKGKRQALLAQFDSEEVHHQVEERICPDCQ
FT                   GDLKEIGGSLQGQELVFIPAQLKRIDHIQHAYKCQACSDKNPSDKIVKAPIPKAPL"
FT   gene            794266..794436
FT                   /locus_tag="SP670_0857"
FT   CDS_pept        794266..794436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0857"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0857"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90922"
FT                   /protein_id="ADM90922.1"
FT                   /translation="MLESDSQLTYYWTFLSGKAENQAITLYHHDQRRSGLVVQEFLGDY
FT                   SGYVHCDMLRQ"
FT   gene            794509..794958
FT                   /locus_tag="SP670_0858"
FT   CDS_pept        794509..794958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0858"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90923"
FT                   /protein_id="ADM90923.1"
FT                   /translation="MVNCEPLEAYRQLEEAALVGCWAHVRRKFFEATPKQADKSSLGAK
FT                   GLAYCDQLFSLERDWEALPADERLQKRQEELQPLIEDFFAWCRRQSVLAGSKLGRAIEY
FT                   SLKYEETFKTILKDGHLVLSNNLAECAIKSLVMGRSKRVQWTLLA"
FT   gene            795029..795187
FT                   /locus_tag="SP670_0859"
FT   CDS_pept        795029..795187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0859"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90924"
FT                   /protein_id="ADM90924.1"
FT                   /translation="MSLLETAKRHQLNSEKYLSYLLECLPNEETLVNKEVLEAYLPWTK
FT                   VVQEKCK"
FT   gene            complement(795651..796928)
FT                   /locus_tag="SP670_0860"
FT   CDS_pept        complement(795651..796928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0860"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90925"
FT                   /protein_id="ADM90925.1"
FT                   /translation="MLFTGKSGNGKSSLINSINGLAVRYDNAKTKGEIIIDGKNIKNLE
FT                   LYQISMLVSTVFQNPKTYFFNVNTTLELLFYLENIGLAREEMDRRLKDILEIFPIKNLL
FT                   NRNIFNLSGGEKQILCIAASYIAGTKIIVMDEPSSNLDIKSISVLAKMLKILKEKGISI
FT                   IVAEHRIYYLMDIVDRVFLIDKGKLKKTYTRSEFLKLDKNELNALSLRDKELSKLKVPY
FT                   LKEGGEYQIKNLSYKFTDDECLSLKDISFKLGKIYGIIGSNGRGKSTLLRCLIGLEKKS
FT                   KEEIYFKGEKLSKKERLKNSSLVMQDVNHQLFTDEVFNELRLGVKNFDEEKAKIILKDL
FT                   CLDEFIERHPMSLSGGQKQRLAIASVMCKNSPFVFFDEPSSGMDYSNMIKISELINKYK
FT                   TMDKIIFIVSHDIEFLNEVADEIFEL"
FT   gene            complement(797003..797698)
FT                   /locus_tag="SP670_0861"
FT   CDS_pept        complement(797003..797698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0861"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90926"
FT                   /protein_id="ADM90926.1"
FT                   /translation="MPTFSSNAPFNPNPISKILVVFITGLTVMHSINIRFELAIVCLIG
FT                   ILLYLNGYKKTLFKWIILCGILYSLPNFMVLSELNPIVKMFLSIPIVIRMFILPFMAAS
FT                   FMIKTSDVGAIISSMDKLKISKNVSIPIAVMFRFFPSFKEEKKNIKMAMRVRGINFKNP
FT                   VKYLEYVSVPLLIISSNISDDIAKAAETKAIENPIAKTRYIRVKIQLIDFVYVLAVAGL
FT                   IVGGLIWLK"
FT   gene            complement(797698..798282)
FT                   /locus_tag="SP670_0862"
FT   CDS_pept        complement(797698..798282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0862"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0862"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90927"
FT                   /protein_id="ADM90927.1"
FT                   /translation="MDNKKLKVKDLVSIGVFGVIYFAFMFGVGMMGLIPILFLIYPTVL
FT                   AIVAGTVVMLFMAKVQKPWALFIFGMISPLVMFAAGHTYVVVVLSLIVMIIAELIRKIG
FT                   NYNSFKYNMLSYAIFSTWICSSLMQMLLAKEKYMEWSLMTMGKDYVDVLEKLITYPHMA
FT                   LVALGAFLGGILGAYIGKALLKKHFEKAGIV"
FT   gene            complement(798293..800014)
FT                   /locus_tag="SP670_0863"
FT   CDS_pept        complement(798293..800014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0863"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0863"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90928"
FT                   /protein_id="ADM90928.1"
FT                   /translation="MKEFYKKRFALTDGGARNLSKATLASFFVYCINMLPAILLMIFAQ
FT                   EVLENMGKSNGFYIVFSVLILIAMYILLSIEYDKLYNTTYQESADLRIRTAENLSKLPL
FT                   SYFSKHDISDISQTIMADIEGIEHAMSHSIPKVGGMVLFFPLISVMMLAGNVKMGLAVI
FT                   IPSILSFIFIPLSKKYQVNGQNRYYDVLRKNSESFQENIEMQMEIKAYNLSKDIKDDLY
FT                   KKMEDSEKVHLKAEVTTILTLSISSIFSFISLAVVIFVGVNLIINKEINSLYLIGYLLA
FT                   AMKIKDSLDASKEGLMEIFYLSPKIERLKEIQNQDLQEGDDYSLKKFDIDLKDVEFAYN
FT                   KDEKVLNGVSFKAKQGEVTALVGASGCGKTTILKLISRLYDYDKGQILIDGKDIKEIST
FT                   ESLFDKVSIVFQDVVLFNQSVMENIRIGKQDASDEEVKRAAKLANCTDFIEKMDKGFDT
FT                   VIGENGAELSGGERQRLSIARAFLKDAPILILDEITASLDVNNEKKIQESLNNLVKDKT
FT                   VVIISHRMKSIENADKIVVLQNGRVESEGKHEELLQKSKIYKNLIEKTKMAEEFIY"
FT   gene            complement(799998..801752)
FT                   /locus_tag="SP670_0864"
FT   CDS_pept        complement(799998..801752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0864"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0864"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90929"
FT                   /protein_id="ADM90929.1"
FT                   /translation="MKIYKKLFAYVQDKKYLGVLAIIFSAISAALTVYGYYLIYKFLDK
FT                   LIINSNLSGAESIALKSVITLTSGAIFYFVSGMFSHILGFRLETNLRKRGIDGLEKASF
FT                   RFFDLNPSGQIRKIIDDNAAQTHQVVAHMIPDSSQAIITPVLVLALGFIVSIRVGIILL
FT                   ALTIIGGLILGAMMGEQEFMKIYQESLSKLSAETVEYVRGMQVVKIFKANVESFKSFYK
FT                   AIKDYSKYAYDYSLSCKRPYVLYQWLFFGLIAILIIPIVYFMTSLASAKVILLELIMIL
FT                   FLSGVLFVSFMRMMWYSMYISQGNYAVDTLEALYEDMQKDKLVHGNVNNFKNYNIEFEN
FT                   VSFAYNDKAVIENLSFNLEEGKSYALVGSSGSGKSTVAKLISGFYNVNKGSIKIGGIAI
FT                   SEYSDEALIKAISFVFQDSKLFKKSIYDNVALANKDATKDDVMRALKLAGCDLILDKFP
FT                   ERENTIIGSKGVYLSGGEKQRIAIARAILKDSKIIIMDEASASIDPDNEFELQKAFKNL
FT                   MKDKTVIMIAHRLSTIKDLDEIIVMDSGKIIERGSDKELMSKDTRYKSLQEMFNIANEW
FT                   RVSNERVL"
FT   gene            801912..802904
FT                   /locus_tag="SP670_0865"
FT   CDS_pept        801912..802904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0865"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0865"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90930"
FT                   /protein_id="ADM90930.1"
FT                   /translation="MSYYDFVKDYMKVDECKNNEKYSSAGHTFCWKKENSTYAEGLYWF
FT                   YEGGSFIIDIHDFYIKEEVVQNSTYSMSDYVSIYSSYIVSANGEKFNPYQTITANSLCT
FT                   FDFDNIKDDFVFLLHENCCYLAVSIGFKKELIEKHLASININPESFYSTLLQPNQIILT
FT                   KALERVAMEILNCKMDAPAADFFFKAKANEWISIVIDTYLNRKKYKIEIDDDKALEDVA
FT                   RFLDDHFATNVNQGTLEKISKMSGTKLKNLFKEKYCQSITEYTQRKRMNVAETLLLNTE
FT                   LPIKEIAESVGYSSASKFSIYYKRYKGKLPSEVRNLACKHHNFKCDYCD"
FT   gene            complement(803026..803172)
FT                   /locus_tag="SP670_0866"
FT   CDS_pept        complement(803026..803172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0866"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0866"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90931"
FT                   /protein_id="ADM90931.1"
FT                   /translation="MSSKLLKAKEQVKSQDKDKKSILGQIKSFKTDDKSKSNKKDHSKG
FT                   AER"
FT   gene            complement(803414..804604)
FT                   /locus_tag="SP670_0867"
FT   CDS_pept        complement(803414..804604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0867"
FT                   /product="DNA modification methyltransferase M.XbaI"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0867"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90932"
FT                   /protein_id="ADM90932.1"
FT                   /translation="MTVLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKLSNNKNIMY
FT                   SFEDTWTSIEDYKEFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQ
FT                   SEIIWNYKRWSNSKKGLLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDG
FT                   NSKTIYKVDNNGNYILAKEKNGVPLSDVWNIPFLNPKAKERVGYPTQKPILLLEQIIKI
FT                   ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENVIKTSSNLLNK
FT                   GIEAYRTKTEEEENILKLLQAKIVQRNKGIDGFLPKHFQKKPIPIKIQKNNECLNESIS
FT                   LLQNAINSKKLDFGVVIKTHSDNLLFDFDTIPENIIVVDHFELTIEKWLSKSQQLL"
FT   gene            complement(804601..804732)
FT                   /locus_tag="SP670_0868"
FT   CDS_pept        complement(804601..804732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0868"
FT                   /product="restriction endonuclease R.XbaI"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0868"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90933"
FT                   /protein_id="ADM90933.1"
FT                   /translation="MYNGIGGKYYGDSAWEHLRAVTGIDLLSILTDIANKKTGVKSK"
FT   gene            complement(804973..805155)
FT                   /locus_tag="SP670_0869"
FT   CDS_pept        complement(804973..805155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0869"
FT                   /product="restriction endonuclease R.XbaI"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0869"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90934"
FT                   /protein_id="ADM90934.1"
FT                   /translation="MANDNKSHYLIYRVLGISFEEGENIDLYQNKGRFLYKYAGSFLEE
FT                   AAVLSFNEKFGTENT"
FT   gene            805779..807065
FT                   /locus_tag="SP670_0870"
FT   CDS_pept        805779..807065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0870"
FT                   /product="peptidase, U32 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0870"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90935"
FT                   /protein_id="ADM90935.1"
FT                   /translation="MTKTLKRPEVLSPAGTLEKLKVAVQYGADAVFIGGQAYGLRSRAG
FT                   NFTFEQMEEGVQFAAKYGAKVYVAANMVMHEGNEAGAGEWFRKLRDIGIAAVIVSDPAL
FT                   IMIAATEAPGLEIHLSTQASATNYETLEFWKELGLTRVVLAREVSMEELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCTLSNHMSMRDANRGGCSQSCRWKYDLYDMPFGKERKSLQGEI
FT                   PEEFSMSAVDMSMIDHIPDMIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYLESPE
FT                   KFEAIKQDLVDEMWKVAQRELATGFYYGIPSENEQLFGARRKIPEYKFVAEVVSYDDAV
FT                   QTATIRQRNVINEGDQVEFYGPGFRHFETYIEDLHDAKGNKIDRAPNPMELLTIKVPQP
FT                   VQSGDMVRALKEGLINFYKEDGTSVTVRA"
FT   gene            complement(807320..807469)
FT                   /locus_tag="SP670_0871"
FT   CDS_pept        complement(807320..807469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0871"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90936"
FT                   /protein_id="ADM90936.1"
FT                   /translation="MRFIVGRFTSFSLGIEFSPTSKLDDLLFKIAFLMILATWIKARKT
FT                   KGAT"
FT   gene            807640..808299
FT                   /locus_tag="SP670_0872"
FT   CDS_pept        807640..808299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0872"
FT                   /product="peptidase, U32 family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0872"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90937"
FT                   /protein_id="ADM90937.1"
FT                   /translation="MRDANRGGCSQSCRWKYDLYDMPFGKERKSLQGEIPEEFSMSAVD
FT                   MSMIDHIPDMIENGVDSLKIEGRMESIHYVLTVTNCYKAAVDAYLESPEKFEAIKQDLV
FT                   DEMWKVAQRELATGFYYGTPSENEQLFGARRKIPEYKFVAEVVSYDDAAQTATIRQRNV
FT                   INEGDQVEFYGPGFRHFETYIEDLHDAKGNKIDRAPNPMELLTIKVPQPIQSFSKI"
FT   gene            808368..809087
FT                   /locus_tag="SP670_0873"
FT   CDS_pept        808368..809087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0873"
FT                   /product="ABC transporter ATP-binding protein-multidrug
FT                   efflux"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0873"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90938"
FT                   /protein_id="ADM90938.1"
FT                   /translation="MKILVQNNQPTSGNIISSDNIGYLIEEPKLFLSKTGLENLKYLSN
FT                   LYGVDYNQERFRSLIQELDLTQSINKKVKTYSLGTKQKLALLLTLVTKPDILILDEPTN
FT                   GLDIESSQIVLAVLKKLALNENVGILISSHKLEDIEEICERVLFLESGLLTFQKVGKDS
FT                   HNFLFEIAFSSATDRDIFITKQEFGDIVQEEGLRITMSGNIQSSELFKFFNENSIKVVD
FT                   FETKKETLKDIYLNRSK"
FT   gene            809103..809831
FT                   /locus_tag="SP670_0874"
FT   CDS_pept        809103..809831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0874"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0874"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90939"
FT                   /protein_id="ADM90939.1"
FT                   /translation="MKLNKLNFLKENIRNLYSSGVIYLSLLISFIPPILLTFFILKTQG
FT                   TSLGIKHISNFYAMLGMLMAVIHANRVISRDFSHNTVSLFYNQQKNRMIYVLSNFLYAI
FT                   SVSIIYALNGIVLLVIVSKLGIPGDLGLDFIVAIVVNTILLVLFYFLLSYIFYLYKLKS
FT                   GLVFGILVALLLFIPNILNTMMMNTSNDLFIKAIELLPFYSLPVFVASNTMSISQYLVL
FT                   ITTIILLYFFTLKKSKKYSF"
FT   gene            810216..810425
FT                   /locus_tag="SP670_0875"
FT   CDS_pept        810216..810425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0875"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0875"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90940"
FT                   /protein_id="ADM90940.1"
FT                   /translation="MVKNLKLKLARVELDLTQGQLADAVGVTRQTIGLIEAGKYNPSLS
FT                   LCQSICRCLGKTLDQLFWEEEDEK"
FT   gene            810415..810903
FT                   /locus_tag="SP670_0876"
FT   CDS_pept        810415..810903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0876"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0876"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90941"
FT                   /protein_id="ADM90941.1"
FT                   /translation="MKNRFYYYQLLDEREEQLFNKAGSESFYICIALSLLSYIISVLAP
FT                   SLFNSNMLLIVIIIGTFYFFNRARYLGVTYYSRFHFTILGCFFLTLAITALLMLQNYQF
FT                   NIEIYQHNPLNFKYLSAWVITYVIYLPWVFIGNLGLKSYGEWAQKKFEQDMDELESGE"
FT   gene            811019..812479
FT                   /gene="pncB"
FT                   /locus_tag="SP670_0877"
FT   CDS_pept        811019..812479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="SP670_0877"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0877"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90942"
FT                   /protein_id="ADM90942.1"
FT                   /translation="MYPDDSLTLHTDLYQINMMQVYFDQGIHNKKAVFEVYFRQQPFKN
FT                   GYAVFAGLERIVNYLEDLRFSDSDIAYLESLGYHGAFLDYLRNFKLELTVRSAQEGDLV
FT                   FANEPIVQVEGPLAQCQLVETALLNIVNYQTLVATKAARIRSVIEDEPLMEFGTRRAQE
FT                   MDAAIWGTRAAVIGGANGTSNVRAGKLFDIPVLGTHAHALVQVYGNDYEAFKAYAATHK
FT                   NCVFLVDTYDTLRIGVPAAIQVARELGDQINFMGVRIDSGDIAYISKKVRQQLDEAGFT
FT                   EAKIYASNDLDENTILNLKMQKAKIDVWGVGTKLITAYDQPALGAVYKIVAIEDETGQM
FT                   RNTIKLSNNAEKVSTPGKKQVWRITSREKGKSEGDYITYDGVDISDMTEIKMFHPTYTY
FT                   IKKTVRNFDAVPLLVDIFKEGILVYNLPSLTDIQDYARKEFDKLWDEYKRVLNPQHYPV
FT                   DLARDVWQDKMDLIDKMRKEALGEGEEE"
FT   gene            812476..813300
FT                   /gene="nadE"
FT                   /locus_tag="SP670_0878"
FT   CDS_pept        812476..813300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SP670_0878"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0878"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90943"
FT                   /protein_id="ADM90943.1"
FT                   /translation="MSLQETIIQELGVKPVIDAQEEIRRSIDFLKRYLKKHPFLKTFVL
FT                   GISGGQDSTLAGRLAQLAMEELRAETGDDSYKFIAVRLPYGVQADEADAQKALAFIQPD
FT                   VSLVVNIKESADAMTAAVEATGSPVSDFNKGNIKARCRMIAQYALAGSHSGAVIGTDHA
FT                   AENITGFFTKFGDGGADILPLYRLNKRQGKQLLQKLGAEPALYEKIPTADLEEDKPGLA
FT                   DEVALGVTYAEIDDYLEGKTISPETQATIENWWHKGQHKRHLPITVFDDFWE"
FT   gene            813650..814201
FT                   /locus_tag="SP670_0879"
FT   CDS_pept        813650..814201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0879"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0879"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90944"
FT                   /protein_id="ADM90944.1"
FT                   /translation="MKSIGTQILQTERLILRRFVESDAEAMFQNWASSAENLTYVTWNP
FT                   HPDVEITRNSIRNWVASYTNLNYYKWAICLKENPEQVIGDISIVKIDEADLSCEIGYVL
FT                   GKAYWGHGMMTEALKAVLDFCFTQAGFQKVRARYASLNPASGRVMEKAGMSYLQTIVNG
FT                   VERKGYLADLIYYGISREEC"
FT   gene            815662..816051
FT                   /locus_tag="SP670_0880"
FT   CDS_pept        815662..816051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0880"
FT                   /product="choline binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0880"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90945"
FT                   /protein_id="ADM90945.1"
FT                   /translation="MVKRRIRRGTREPEKVVVPEQSSIPSYPVSVTSNQGTDVAVEPAK
FT                   AVAPTTGWKQENGMWYFYNTDGSMATGWVQVNGSWYYLNSNGSMKVNQWFQVGGKWYYV
FT                   NASGELAVNTSIDGYRVNDNGEWVR"
FT   gene            complement(816712..817740)
FT                   /gene="queA"
FT                   /locus_tag="SP670_0881"
FT   CDS_pept        complement(816712..817740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SP670_0881"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0881"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90946"
FT                   /protein_id="ADM90946.1"
FT                   /translation="MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHS
FT                   IIDMLEPGDALVMNDTRVLPARLYGQKVETGGHVELLLLKNTSGDEWEVLAKPAKRLKV
FT                   GTRISFGDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESLGEMPLPPYIHEKLDDRER
FT                   YQTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEH
FT                   EMHSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIF
FT                   IKPGYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMF
FT                   IY"
FT   gene            817891..818598
FT                   /locus_tag="SP670_0882"
FT   CDS_pept        817891..818598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0882"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0882"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90947"
FT                   /protein_id="ADM90947.1"
FT                   /translation="MKVIKVENQVQGGKVAFEILKEKLANGAQTLGLATGSSPLEFYKE
FT                   IVESDLDFSNLTSVNLDEYVGLDGDNPQSYRYFMQENLFNQKPFKESFLPRGVKDNAEA
FT                   EVERYNQILADHPVDLQILGIGRNGHIGFNEPGTPFDSQTHLVELDQSTIEANARFFAK
FT                   IEDVPTQAISMGIKNILDAKSIILFAYGESKAEAIAGTVSGPVTENLPASSLQNHPDVT
FT                   IIADAEALSLLEK"
FT   gene            818738..818914
FT                   /gene="rpsU"
FT                   /locus_tag="SP670_0883"
FT   CDS_pept        818738..818914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="SP670_0883"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0883"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90948"
FT                   /protein_id="ADM90948.1"
FT                   /translation="MSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKR
FT                   KRKSEVARKRKKF"
FT   gene            819044..819979
FT                   /gene="hprK"
FT                   /locus_tag="SP670_0884"
FT   CDS_pept        819044..819979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="SP670_0884"
FT                   /product="HPr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0884"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90949"
FT                   /protein_id="ADM90949.1"
FT                   /translation="MSVLVKEVIEKLRLDIVYGEPELLEKEINTADITRPGLEMTGYFD
FT                   YYTPERIQLLGMKEWSYLISMPSNSRYEVLKKMFLPETPAVIVARGLVVPEEMLKAARE
FT                   CKIAILTSRAATSRLSGELSSYLDSRLAERTSVHGVLMDIYGMGVLIQGDSGIGKSETG
FT                   LELVKRGHRLVADDRVDIFAKDEITLWGEPAEILKHLIEIRGVGIIDVMSLYGASAVKD
FT                   SSQVQLAVYLENYDTHKTFDRLGNNAEELEVSGVAIPRIRIPVKTGRNISVVIEAAAMN
FT                   YRAKEMGFDATRLFDERLTSLIARNEVQNA"
FT   gene            819972..820760
FT                   /gene="lgt"
FT                   /locus_tag="SP670_0885"
FT   CDS_pept        819972..820760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SP670_0885"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0885"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90950"
FT                   /protein_id="ADM90950.1"
FT                   /translation="MLDPIAIQLGPLAIRWYALCIVTGLILAVYLTMKEAPRKKIIPDD
FT                   ILDFILVAFPLAILGARLYYVIFRFDYYSQNLGEIFAIWNGGLAIYGGLITGALVLYIF
FT                   ADRKLINTWDFLDIAAPSVMIAQSLGRWGNFFNQEAYGATVDNLDYLPGFIRDQMYIEG
FT                   SYHQPTFLYESLWNLLGFALILIFRRKWKSLRRGHITAFYLIWYGFGRMVIEGMRTDSL
FT                   MFFGLRVSQWLSVVFIGLGIMIVIYQNRKKAPYYITEEEN"
FT   gene            820761..821144
FT                   /locus_tag="SP670_0886"
FT   CDS_pept        820761..821144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0886"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0886"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90951"
FT                   /protein_id="ADM90951.1"
FT                   /translation="MLEVAYILVALAVIVFLVYLIITVQKLGRVIDETEKTIKTLTSDV
FT                   DVTLHHTNELLAKVNVLADDINVKVATIDPLFSAVADLSLSVSDLNDHARVLSKKASSA
FT                   GSKTLKTGASLSALRLASKFFKK"
FT   gene            821160..821549
FT                   /locus_tag="SP670_0887"
FT   CDS_pept        821160..821549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0887"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0887"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90952"
FT                   /protein_id="ADM90952.1"
FT                   /translation="MGKLSSILLGTVSGAALALFLTSDKGKQVCSQAQDFLDDLREDPE
FT                   YAKEQVCEKLTEVKEQATDFVLKTKEQVESGEITVDSILAQAKSYAFQATEASKNQLNN
FT                   LKEQWQEKAEALDDSEEIVIDITEE"
FT   gene            821633..822763
FT                   /locus_tag="SP670_0888"
FT   CDS_pept        821633..822763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0888"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0888"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90953"
FT                   /protein_id="ADM90953.1"
FT                   /translation="MQKKPTSAYVHIPFCTQICYYCDFSKVFIKNQPVDSYLEHLLEEF
FT                   RSYDIEKLSTLYIGGGTPTALSAPQLEVLLNGLTKNLDLSVLEELTIEANPGDLDADKI
FT                   AVLKNSAVNRVSLGVQTFDDKMLKKIGRSHLEKDIYENIDRLKLAGFDNISIDLIYALP
FT                   GQTMEQVKENVAKAIGLDIPHMSLYSLILENHTVFMNRMRRGKLPLPKEELEAEMFEYI
FT                   IAELERAGFEHYEISNFSKPGFESRHNLMYWDNAEYYGIGAGASGYVNGVRYKNHGPIR
FT                   HYLSAVEEGNACITEDHLSQKEQMEEEMFLGLRKKSGVSMARFEEKFGQSFAGLYGEIV
FT                   RDLVQQGLMQIEGDHVRMTKRGLFLGDTVAERFILE"
FT   gene            822768..823505
FT                   /locus_tag="SP670_0889"
FT   CDS_pept        822768..823505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0889"
FT                   /product="acyl-acyl-carrier protein thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0889"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90954"
FT                   /protein_id="ADM90954.1"
FT                   /translation="MGLTYQMKMKIPFDMADMNGHIKLPDVILLSLQVSGMQSIELGVS
FT                   DKAILEEYNLVWIIVEYDIEVFRLPRFAEEITIETEALSYNRLFCYRRFTIYNEAEQEL
FT                   IHMMATFVLMDRDSRKVHVVEPEIVAPYQSDFDKKLIRGPKYESLEEPISKDYHVRFYD
FT                   LDMNGHVNNSKYLDWIFEVMGADFLTHYIPKKINLKYVKEVRPGGVITSAVERTGLESK
FT                   HEITSDGVINAQAIITWQEIKKA"
FT   gene            823516..824289
FT                   /locus_tag="SP670_0890"
FT   CDS_pept        823516..824289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0890"
FT                   /product="HAD-superfamily subfamily IIA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0890"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90955"
FT                   /protein_id="ADM90955.1"
FT                   /translation="MKYKGYLIDLDGTIYKGKDRIPAGETFVHELQKRDIPYLFVTNNT
FT                   TRTPESVKEMLAQNFNIDTPLSTVYTATLATIDYMNDLGLEKTVYVVGEAGLKEAIKAA
FT                   GYVEDKEKPAYVVVGLDWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGAGS
FT                   LITLLEVATRVKPVYIGKPNAIIMDKAVEHLGLEREELIMVGDNYLTDIRAGIDNGIPT
FT                   LLVTTGFTKAEEVAGLPIAPTHVVSSLAEWDFDEN"
FT   gene            824279..824896
FT                   /locus_tag="SP670_0891"
FT   CDS_pept        824279..824896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0891"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0891"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90956"
FT                   /protein_id="ADM90956.1"
FT                   /translation="MKTKLIFWGSMLFLLSLSILLTIYLAWIFYPMEIQWLNLTNRVYL
FT                   KPETIQYNFHILMNYLTNPFSQVLQMPDFRSSAAGLHHFAVVKNLFHLVQLVALVTLPS
FT                   FYVFVNRIVKKDFLSLYRKSLLALVVLPVMIGLGGVLIGFDQFFTLFHQILFVGDDTWL
FT                   FDPAKDPVIMILPETFFLHAFLLFFALYENFFGYLCLKSRRK"
FT   gene            825106..825507
FT                   /locus_tag="SP670_0892"
FT   CDS_pept        825106..825507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0892"
FT                   /product="regulatory protein spx"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0892"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90957"
FT                   /protein_id="ADM90957.1"
FT                   /translation="MITLFLSPSCTSCRKAKAWLEKHKVPFVEHNIMTSPLTRKELQHI
FT                   LSLTENGTDDIISTRSKIFQKLNIDVESISVSELLHLIEQYPSLLRRPIIIDAKRMQIG
FT                   FNEDEIRAFLPRSYRKQELKEARMRAGIS"
FT   gene            825567..825785
FT                   /locus_tag="SP670_0893"
FT   CDS_pept        825567..825785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0893"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0893"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90958"
FT                   /protein_id="ADM90958.1"
FT                   /translation="MLSFFNDVEAAYEGKVEAKKLLDSYKGFKAVVPSKSEEKRLGREF
FT                   ETVSGYSLYRAVQAAKEKGEGKISLGK"
FT   gene            825775..826548
FT                   /locus_tag="SP670_0894"
FT   CDS_pept        825775..826548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0894"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0894"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90959"
FT                   /protein_id="ADM90959.1"
FT                   /translation="MESKFEFAKELVKKAGQYILDHMQEDLRVETKSSPTDLVTRLDKE
FT                   VQELLVGEILSRYPEDKICAEEGCLRASVQEGKVWVIDPIDGTNNFVAQQEDFAVMMAY
FT                   FENGQGQFGLIYDVVKGDCYHGGGEFPVCLNDRSLAPFKTKPLGDFLIAGNSGMLETNE
FT                   WGLADLSRSVLGVRVYGSAAISFAKILSGRLLTYLTYLQPWDYAAASILGESLGYRVVT
FT                   LFGEAPDFQTRQPVMMVPLEMQEEIQSYIYERKRT"
FT   gene            826549..827853
FT                   /locus_tag="SP670_0895"
FT   CDS_pept        826549..827853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0895"
FT                   /product="NOL1/NOP2/sun family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0895"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90960"
FT                   /protein_id="ADM90960.1"
FT                   /translation="MQFPEGFVEKYKEILGDEARDFLASFEEEAVSAFRVNPLKEEQLS
FT                   FSDAITQTPWGHYGKVSGKSPEHATGLVYSQEPAAQMVAQVAQPSPGMKVLDLAAAPGG
FT                   KSTQLAAYLAGEGLLVSNEISSKRAKILVENMERFGATNVVVTNESADRLVKVFKGYFD
FT                   LIVLDAPCSGEGMFRKQPDAMDYWSLDYPSQCASLQREILEDAVTMLAEGGHLVYSTCT
FT                   WAPEENEEIVNWLLEEYDFDLLPVEHINGMVAGIDLPETARMYPHQFKGEGQFVAHLQF
FT                   KGNNPAPKFKASKSNLSREQVALWQEFAQNHLKVNLPGILQTFGDQLYLLPELLPDLGK
FT                   LKIARNGLHLGTFKKKRFEPSFALGLALKPSQVEQSVEIGQEAFVKYAAGEIVQLAESL
FT                   PNGWYQVLVKGNGLGFAKVTGNVLKNYFPKGLRFK"
FT   gene            complement(828084..828197)
FT                   /locus_tag="SP670_0896"
FT   CDS_pept        complement(828084..828197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0896"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0896"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90961"
FT                   /protein_id="ADM90961.1"
FT                   /translation="MQGKLLSLDDNPKARKVSQTSLLSQTSLQLKGKDSIL"
FT   gene            828427..829305
FT                   /locus_tag="SP670_0897"
FT   CDS_pept        828427..829305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0897"
FT                   /product="phosphate-binding protein PstS 1"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0897"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90962"
FT                   /protein_id="ADM90962.1"
FT                   /translation="MKKRKKLALSLIAFWLTACLVGCASWIDRGESITAVGSTALQPLV
FT                   EVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHK
FT                   VAVAGLALIVNKEVDVDNLTTEQLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRAT
FT                   FDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPE
FT                   NISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDA
FT                   AGTVTVLEGRQ"
FT   gene            829305..830222
FT                   /locus_tag="SP670_0898"
FT   CDS_pept        829305..830222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0898"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0898"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90963"
FT                   /protein_id="ADM90963.1"
FT                   /translation="MNQEELAKKMLLPSKNSRLEKLGKGLTFACLSLIVILVAMILVFV
FT                   AQKGLSTFFVNGVNIFDFLLGGTWNPSSKEFGALPMILGSFIVTILSALIATPFAIGAA
FT                   VFMTEVSPKGAKILQPAIELLVGIPSVVYGFIGLQVVVPFVRSVFGGTGFGILSGISVL
FT                   FVMILPTVTFMTTDSLRAVPRYYREASFAMGATRWQTIWRVILKAARSGIFTAVVFGMA
FT                   RAFGEALAIQMVVGNSAVIPTSLTTPAATLTSILTMGIGNTVMGTVNNNVLWSLALVLL
FT                   LMSLVFNSVIKLITKERGKKNYAR"
FT   gene            830212..831096
FT                   /locus_tag="SP670_0899"
FT   CDS_pept        830212..831096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0899"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0899"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90964"
FT                   /protein_id="ADM90964.1"
FT                   /translation="MRAKKLDKLATAVLYTIASIIVTILASLILYILVRGLPHISWSFL
FT                   TGRSSAFQAGGGIGIQLYNSFFLLVITLIISVPLSMGAGIYLAEYAKKGPVTNFVRTCI
FT                   EILSSLPSVVVGLFGYLIFVVQFEYGFSIISGALALTVFNLPQMTRNVEDSLKHVHHTQ
FT                   REAGLALGISRWETVVHVVIPEALPGIVTGVVLASGRIFGEAAALIYTAGQSAPALDWS
FT                   NWNILSVTSPISIFRQAETLAVHIWKVNSEGTIPDGTIVSAGSAAVLLIFILIFNFGAR
FT                   KFGSYLHKKLTAA"
FT   gene            831107..831910
FT                   /locus_tag="SP670_0900"
FT   CDS_pept        831107..831910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0900"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0900"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90965"
FT                   /protein_id="ADM90965.1"
FT                   /translation="MSTYNWDEKHILTFPEEKVALSTKDVHVYYGKNESIKGIDMQFER
FT                   NKITALIGPSGSGKSTYLRSLNRMNDTIDIAKVTGQILYRGIDVNRPEINVYEMRKHIG
FT                   MVFQRPNPFAKSIYRNITFAHERAGVKDKQVLDEIVETSLRQAALWDQVKDDLHKSALT
FT                   LSGGQQQRLCIARAISVKPDILLMDEPASALDPIATMQLEETMFELKKNFTIIIVTHNM
FT                   QQAARASDYTGFFYLGDLIEYDKTATIFQNAKLQSTNDYVSGHFG"
FT   gene            831923..832681
FT                   /locus_tag="SP670_0901"
FT   CDS_pept        831923..832681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0901"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0901"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90966"
FT                   /protein_id="ADM90966.1"
FT                   /translation="MTDAILQVSDLSVYYNKKKALNSVSLSFQPKEITALIGPSGSGKS
FT                   TLLKSLNRMGDLNPEVTTTGSVVYNGHNIYSPRTDTVELRKEIGMVFQQPNPFPMTIYE
FT                   NVVYGLRINGIKDKQVLDEAVEKALQGASIWDEVKDRLYDSAIGLSGGQQQRVCVARVL
FT                   ATSPKIILLDEPTSALDPISAGKIEETLYGLKDKYTMLLVTRSMQQASRISDKTGFFLD
FT                   GDLIEFNDTKQMFLDPQHKETEDYITGKFG"
FT   gene            832693..833346
FT                   /locus_tag="SP670_0902"
FT   CDS_pept        832693..833346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0902"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0902"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90967"
FT                   /protein_id="ADM90967.1"
FT                   /translation="MLRSQFEEDLEKLHNQFYAMGQEVLSQINRTVRAFVTHDRDLAKE
FT                   VIEDDAEVNEYEVKLEKKSFEMIALQQPVSQDLRTVLTVLKTVSDVERMGDHAVAIAQA
FT                   TIRMKGEERIPAVEEEIKKMGREVKSVVEAALDLYLNGSVDDAYRVASMDEQINHYFET
FT                   IRDLATEEIKKNPEAIVTGRDYFQVISYLERIGDYAKNICEWVVYFETGKIVEL"
FT   gene            833503..834318
FT                   /locus_tag="SP670_0903"
FT   CDS_pept        833503..834318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0903"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0903"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90968"
FT                   /protein_id="ADM90968.1"
FT                   /translation="MKSKKWIFVLCNFLASFFLVACQSGSNGSQSAVEAIKQKGKLVVA
FT                   TSPDYAPFEFQSLVDGKNQVVGADIDMAQAIADELGVKLEISSMSFDNVLTSLQTGKAD
FT                   LAVAGISATDERKEVFDFSIPYYENKISFLVRKADVEKYKDLTSLESANIAAQKGTVPE
FT                   SMVKEQLPKAQLTSLTNMGEAVNELQAGKVDAVHMDEPVALSYAAKNAGLAVATVSLKM
FT                   KDGDANAVALRKNSDDLKEVVDKVIQKLKDEGIYQSYLEKAASLTEVEE"
FT   gene            complement(834338..835609)
FT                   /locus_tag="SP670_0904"
FT   CDS_pept        complement(834338..835609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0904"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0904"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90969"
FT                   /protein_id="ADM90969.1"
FT                   /translation="MKKQSKYKEVVSYLKNGIESGRFPTGSRLPSIRQLSLDFHCSKDT
FT                   IQRALLELRHEQYLYAKPQSGYYVLEQGQHQDLEIEVTDEHASAYDDFRLCVNETLIGR
FT                   ENYLFNYYDNQEGLEDLRQSIHKLLFEQALYCKANQLVLTSGTQQALFILSQISFPRQA
FT                   KEILVEQPTYHRMNRLLIAQGLDYQTIERGIDGIDLEELEGHFKTGKIKFFYTIPRFHY
FT                   PLGHSYSEQDKRSILNLAAKYDVYIVEDDYLGDLDSKKGQTFHYLDTEEHVIYIKSFST
FT                   SLFPALRITALILPNAIKEAFVAYKNILDYDSNLIMQKALSLYIDSQLFEKNRLARLTN
FT                   HESYQKQIEERITKTPCPLPHYPLHDGLLLDLRQYPKIASLKHSQLGLDFFEEAYLSTC
FT                   PYQFAKVSLDNLENVLNYLKAELE"
FT   gene            835751..836482
FT                   /gene="budA"
FT                   /locus_tag="SP670_0905"
FT   CDS_pept        835751..836482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="budA"
FT                   /locus_tag="SP670_0905"
FT                   /product="alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0905"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90970"
FT                   /protein_id="ADM90970.1"
FT                   /translation="MDKNVQEPVKLFQYNTLGALMAGLYGGTMTVGELLEHGDLGLGTL
FT                   DSIDGELIVLDGKAYQAKGSGDQPEIVEVSPDALIPYAAVVPHQAEVIFRQRFEMTDKE
FT                   LKERIESYYDGENLFRSIKIRGEFLHMHVRMIPKSTPDTKFADVATHQPEYSRDNVAGT
FT                   IVGFWTPEIFHGVSVAGYHLHFISDDLTFGGHVMDFVIKEGIIEVGAVDQLDQRFPVQD
FT                   RQYLFAKFNVDEMKKDIEKAE"
FT   gene            836492..837244
FT                   /locus_tag="SP670_0906"
FT   CDS_pept        836492..837244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0906"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0906"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90971"
FT                   /protein_id="ADM90971.1"
FT                   /translation="MTIHIIITMLLLLAFLIGSIWFAKKKYQINLAVLGLGAVAFFVSS
FT                   QILEKLVHILILHPQKDGSIALLQDHPLIYIIYGLAMAAFFEETARLVFFKWLEKKRSL
FT                   EKADALAYGLGHGGLELIFLGLTSLLNLYIVLSTVQTQNPQVMQLLSENMLKTIQSLSV
FT                   WQIYLLGFERILALGFQLLLTVWVYQAVRQKKWIYLLAAYGLHAFFDLAPSLSQVGWLT
FT                   NPVLVEVILALELVLVAYGTKEIFCKKS"
FT   gene            837356..838261
FT                   /gene="murB"
FT                   /locus_tag="SP670_0907"
FT   CDS_pept        837356..838261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="SP670_0907"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0907"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90972"
FT                   /protein_id="ADM90972.1"
FT                   /translation="MSVREKMLEILEGIDIRFKEPLHSYSYTKVGGEADYLVFPRNRFE
FT                   LARLVKFANQENIPWMVLGNASNIIVRDGGIRGFVILCDKLNNVSVDGYTIEAEAGANL
FT                   IETTRIALRHSLTGFEFACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETL
FT                   SAKDLAFGYRHSAIQESGAVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCG
FT                   SVFKRPVGHFAGQLISEAGLKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEK
FT                   VKEHSGITLEREVRILGESK"
FT   gene            838421..839578
FT                   /locus_tag="SP670_0908"
FT   CDS_pept        838421..839578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0908"
FT                   /product="spermidine/putrescine import ATP-binding protein
FT                   PotA"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0908"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90973"
FT                   /protein_id="ADM90973.1"
FT                   /translation="MKKPIIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSG
FT                   KSTILNIIAGLLDATTGDIMLDGVRINDIPTNKRDVHTVFQSYALFPHMNVFENVAFPL
FT                   RLRKIDKKEIEQRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDE
FT                   PLSALDLKLRTDMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTP
FT                   VDIYDEPINHFVATFIGESNILPGTMIEDYLVEFNGKRFEAVDGGMKPNEPVEVVIRPE
FT                   DLRITLPEEGKLQVKVDTQLFRGVHYEIIAYDELGNEWMIHSTRKAIVGEEIGLDFESE
FT                   DIHIMRLNETEEEFDARIEEYVEIEEQEAGLINAIEEERDEENKL"
FT   gene            839559..840365
FT                   /locus_tag="SP670_0909"
FT   CDS_pept        839559..840365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0909"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-spermidine/putrescine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0909"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90974"
FT                   /protein_id="ADM90974.1"
FT                   /translation="MKKTSSKLFVVPYMLWIALFVLAPLVLIFGQSFFNIEGQFSLENY
FT                   KSYFASQNLTYLKMSFNSVLYAGIVTFVTLLISYPTALFLTRLKHRQLWLMLIILPTWI
FT                   NLLLKAYAFIGIFGQNGSINQFLEFIGIGSQQLLFTDFSFIFVASYIELPFMILPIFNV
FT                   LDDMDNNLINASYDLGATKWETFRHVIFPLSMNGVRSGVQSVFIPSLSLFMLTRLIGGN
FT                   RVITLGTAIEQNFLTNDNYGMGSTIGVILILTMFITMWVTKERRER"
FT   gene            840362..841135
FT                   /locus_tag="SP670_0910"
FT   CDS_pept        840362..841135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0910"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-spermidine/putrescine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0910"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90975"
FT                   /protein_id="ADM90975.1"
FT                   /translation="MKKFANLYLGLVFLVLYLPIFYLIGYAFNAGDDMNSFTGFSWTHF
FT                   ETMFGDGRLMLILAQTFFLAFLSALIATIIGTFGAIYIYQSRKKYQEAFLSLNNILMVA
FT                   PDVMIGASFLILFTQLKFSLGFLTVLSSHVAFSIPIVVLMVLPRLKEMNGDMIHAAYDL
FT                   GASQFQMIKEIMLPYLTPSIIAGYFMAFTYSLDDFAVTFFVTGNGFSTLSVEIYSRARK
FT                   GISLEINALSALVFLFSIILVVGYYFISREKEEQA"
FT   gene            841132..842202
FT                   /locus_tag="SP670_0911"
FT   CDS_pept        841132..842202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0911"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0911"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90976"
FT                   /protein_id="ADM90976.1"
FT                   /translation="MKKIYSFLAGIAAIILVLWGIATHLDSKINSRDSQKLVIYNWGDY
FT                   IDPELLTQFTEETGIQVQYETFDSNEAMYTKIKQGGTTYDIAIPSEYMINKMKDEDLLV
FT                   PLDYSKIEGIENIGPEFLNQSFDPGNKFSIPYFWGTLGIVYNETMVDEAPEHWDDLWKP
FT                   EYKNSIMLFDGAREVLGLGLNSLGYSLNSKDLQQLEETVDKLYKLTPNIKAIVADEMKG
FT                   YMIQNNVAIGVTFSGEASQMLEKNENLRYVVPTEASNLWFDNMVIPKTVKNQNSAYAFI
FT                   NFMLKPENALQNAEYVGYSTPNLPAKELLPEETKEDKAFYPDVETMKHLEVYEKFDHKW
FT                   TGKYSDLFLQFKMYRK"
FT   gene            842463..842702
FT                   /locus_tag="SP670_0912"
FT   CDS_pept        842463..842702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0912"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0912"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90977"
FT                   /protein_id="ADM90977.1"
FT                   /translation="MKMSTFFKKSFWPTFMIVNQTAILFHLKDGLDRQYLTTESIYWVI
FT                   GTFIFGNILVAVFSNMKIWDKKKNGSKKKYILKK"
FT   gene            842977..843462
FT                   /locus_tag="SP670_0913"
FT   CDS_pept        842977..843462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP670_0913"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP670_0913"
FT                   /db_xref="EnsemblGenomes-Tr:ADM90978"
FT                   /protein_id="ADM90978.1"
FT                   /translation="MKTFLVKQKFRLGGERFAIKDDRGEIAYQVEGSFFKIPKTFTIYD
FT                   AAGEQVSQISKEILTLLPRFEIQLRDGSSFVIRKKLTFWRDKYEFDNLGLRIEGNIWDL
FT                   NFKLLDDRDQLIAEIKKDLFHLTSTYTVTVLEDAYADLVISLCVAIDYVEMLESQSH"
FT   gene            843484..846102
FT                   /gene="alaS"
FT                   /locus_tag="SP670_0914"
FT   CDS_pept        843484..846102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="SP670_0914"
FT                   /product="alanyl-tRNA synthetase"