(data stored in ACNUC7421 zone)

EMBL: CP002183

ID   CP002183; SV 1; circular; genomic DNA; STD; PRO; 4027676 BP.
XX
AC   CP002183;
XX
PR   Project:PRJNA38713;
XX
DT   07-SEP-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Bacillus subtilis subsp. spizizenii str. W23, complete genome.
XX
KW   .
XX
OS   Bacillus subtilis subsp. spizizenii str. W23
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4027676
RX   DOI; 10.1099/mic.0.048520-0.
RX   PUBMED; 21527469.
RA   Zeigler D.R.;
RT   "The genome sequence of Bacillus subtilis subsp. spizizenii W23: insights
RT   into speciation within the B. subtilis complex and into the history of B.
RT   subtilis genetics";
RL   Microbiology (Reading, Engl.) 157(Pt 7):2033-2041(2011).
XX
RN   [2]
RP   1-4027676
RA   Zeigler D.R.;
RT   ;
RL   Submitted (25-AUG-2010) to the INSDC.
RL   Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave,
RL   Columbus, OH 43210, USA
XX
DR   MD5; 67d9e633945350f77cfca0d2d072f9c6.
DR   BioSample; SAMN02602993.
DR   EnsemblGenomes-Gn; BSUW23_06620.
DR   EnsemblGenomes-Gn; BSUW23_miscRNA2.
DR   EnsemblGenomes-Gn; BSUW23_miscRNA32.
DR   EnsemblGenomes-Gn; BSUW23_miscRNA35.
DR   EnsemblGenomes-Gn; BSUW23_miscRNA41.
DR   EnsemblGenomes-Gn; BSUW23_miscRNA5.
DR   EnsemblGenomes-Gn; BSUW23_miscRNA55.
DR   EnsemblGenomes-Gn; BSUW23_r20616.
DR   EnsemblGenomes-Gn; BSUW23_r20618.
DR   EnsemblGenomes-Gn; BSUW23_r20620.
DR   EnsemblGenomes-Gn; BSUW23_r20622.
DR   EnsemblGenomes-Gn; BSUW23_r20624.
DR   EnsemblGenomes-Gn; BSUW23_r20626.
DR   EnsemblGenomes-Gn; BSUW23_r20628.
DR   EnsemblGenomes-Gn; BSUW23_r20630.
DR   EnsemblGenomes-Gn; BSUW23_r20632.
DR   EnsemblGenomes-Gn; BSUW23_r20634.
DR   EnsemblGenomes-Gn; BSUW23_r20636.
DR   EnsemblGenomes-Gn; BSUW23_r20638.
DR   EnsemblGenomes-Gn; BSUW23_r20640.
DR   EnsemblGenomes-Gn; BSUW23_r20642.
DR   EnsemblGenomes-Gn; BSUW23_r20644.
DR   EnsemblGenomes-Gn; BSUW23_r20646.
DR   EnsemblGenomes-Gn; BSUW23_r20648.
DR   EnsemblGenomes-Gn; BSUW23_r20650.
DR   EnsemblGenomes-Gn; BSUW23_r20652.
DR   EnsemblGenomes-Gn; BSUW23_r20654.
DR   EnsemblGenomes-Gn; BSUW23_r20656.
DR   EnsemblGenomes-Gn; BSUW23_r20658.
DR   EnsemblGenomes-Gn; BSUW23_r20660.
DR   EnsemblGenomes-Gn; BSUW23_r20662.
DR   EnsemblGenomes-Gn; BSUW23_t20462.
DR   EnsemblGenomes-Gn; BSUW23_t20464.
DR   EnsemblGenomes-Gn; BSUW23_t20466.
DR   EnsemblGenomes-Gn; BSUW23_t20468.
DR   EnsemblGenomes-Gn; BSUW23_t20470.
DR   EnsemblGenomes-Gn; BSUW23_t20472.
DR   EnsemblGenomes-Gn; BSUW23_t20474.
DR   EnsemblGenomes-Gn; BSUW23_t20476.
DR   EnsemblGenomes-Gn; BSUW23_t20478.
DR   EnsemblGenomes-Gn; BSUW23_t20480.
DR   EnsemblGenomes-Gn; BSUW23_t20482.
DR   EnsemblGenomes-Gn; BSUW23_t20484.
DR   EnsemblGenomes-Gn; BSUW23_t20486.
DR   EnsemblGenomes-Gn; BSUW23_t20488.
DR   EnsemblGenomes-Gn; BSUW23_t20490.
DR   EnsemblGenomes-Gn; BSUW23_t20492.
DR   EnsemblGenomes-Gn; BSUW23_t20494.
DR   EnsemblGenomes-Gn; BSUW23_t20496.
DR   EnsemblGenomes-Gn; BSUW23_t20498.
DR   EnsemblGenomes-Gn; BSUW23_t20500.
DR   EnsemblGenomes-Gn; BSUW23_t20502.
DR   EnsemblGenomes-Gn; BSUW23_t20504.
DR   EnsemblGenomes-Gn; BSUW23_t20506.
DR   EnsemblGenomes-Gn; BSUW23_t20508.
DR   EnsemblGenomes-Gn; BSUW23_t20510.
DR   EnsemblGenomes-Gn; BSUW23_t20512.
DR   EnsemblGenomes-Gn; BSUW23_t20514.
DR   EnsemblGenomes-Gn; BSUW23_t20516.
DR   EnsemblGenomes-Gn; BSUW23_t20518.
DR   EnsemblGenomes-Gn; BSUW23_t20520.
DR   EnsemblGenomes-Gn; BSUW23_t20522.
DR   EnsemblGenomes-Gn; BSUW23_t20524.
DR   EnsemblGenomes-Gn; BSUW23_t20526.
DR   EnsemblGenomes-Gn; BSUW23_t20528.
DR   EnsemblGenomes-Gn; BSUW23_t20530.
DR   EnsemblGenomes-Gn; BSUW23_t20532.
DR   EnsemblGenomes-Gn; BSUW23_t20534.
DR   EnsemblGenomes-Gn; BSUW23_t20536.
DR   EnsemblGenomes-Gn; BSUW23_t20538.
DR   EnsemblGenomes-Gn; BSUW23_t20540.
DR   EnsemblGenomes-Gn; BSUW23_t20542.
DR   EnsemblGenomes-Gn; BSUW23_t20544.
DR   EnsemblGenomes-Gn; BSUW23_t20546.
DR   EnsemblGenomes-Gn; BSUW23_t20548.
DR   EnsemblGenomes-Gn; BSUW23_t20550.
DR   EnsemblGenomes-Gn; BSUW23_t20552.
DR   EnsemblGenomes-Gn; BSUW23_t20554.
DR   EnsemblGenomes-Gn; BSUW23_t20556.
DR   EnsemblGenomes-Gn; BSUW23_t20558.
DR   EnsemblGenomes-Gn; BSUW23_t20560.
DR   EnsemblGenomes-Gn; BSUW23_t20562.
DR   EnsemblGenomes-Gn; BSUW23_t20564.
DR   EnsemblGenomes-Gn; BSUW23_t20566.
DR   EnsemblGenomes-Gn; BSUW23_t20568.
DR   EnsemblGenomes-Gn; BSUW23_t20570.
DR   EnsemblGenomes-Gn; BSUW23_t20572.
DR   EnsemblGenomes-Gn; BSUW23_t20574.
DR   EnsemblGenomes-Gn; BSUW23_t20576.
DR   EnsemblGenomes-Gn; BSUW23_t20578.
DR   EnsemblGenomes-Gn; BSUW23_t20580.
DR   EnsemblGenomes-Gn; BSUW23_t20582.
DR   EnsemblGenomes-Gn; BSUW23_t20584.
DR   EnsemblGenomes-Gn; BSUW23_t20586.
DR   EnsemblGenomes-Gn; BSUW23_t20588.
DR   EnsemblGenomes-Gn; BSUW23_t20590.
DR   EnsemblGenomes-Gn; BSUW23_t20592.
DR   EnsemblGenomes-Gn; BSUW23_t20594.
DR   EnsemblGenomes-Gn; BSUW23_t20596.
DR   EnsemblGenomes-Gn; BSUW23_t20598.
DR   EnsemblGenomes-Gn; BSUW23_t20600.
DR   EnsemblGenomes-Gn; BSUW23_t20602.
DR   EnsemblGenomes-Gn; BSUW23_t20604.
DR   EnsemblGenomes-Gn; BSUW23_t20606.
DR   EnsemblGenomes-Gn; BSUW23_t20608.
DR   EnsemblGenomes-Gn; BSUW23_t20610.
DR   EnsemblGenomes-Gn; BSUW23_t20612.
DR   EnsemblGenomes-Gn; BSUW23_t20614.
DR   EnsemblGenomes-Gn; EBG00001279416.
DR   EnsemblGenomes-Gn; EBG00001279417.
DR   EnsemblGenomes-Gn; EBG00001279418.
DR   EnsemblGenomes-Gn; EBG00001279419.
DR   EnsemblGenomes-Gn; EBG00001279420.
DR   EnsemblGenomes-Gn; EBG00001279421.
DR   EnsemblGenomes-Gn; EBG00001279422.
DR   EnsemblGenomes-Gn; EBG00001279423.
DR   EnsemblGenomes-Gn; EBG00001279424.
DR   EnsemblGenomes-Gn; EBG00001279425.
DR   EnsemblGenomes-Gn; EBG00001279426.
DR   EnsemblGenomes-Gn; EBG00001279427.
DR   EnsemblGenomes-Gn; EBG00001279428.
DR   EnsemblGenomes-Gn; EBG00001279429.
DR   EnsemblGenomes-Gn; EBG00001279430.
DR   EnsemblGenomes-Gn; EBG00001279431.
DR   EnsemblGenomes-Gn; EBG00001279432.
DR   EnsemblGenomes-Gn; EBG00001279433.
DR   EnsemblGenomes-Gn; EBG00001279434.
DR   EnsemblGenomes-Gn; EBG00001279435.
DR   EnsemblGenomes-Gn; EBG00001279436.
DR   EnsemblGenomes-Gn; EBG00001279437.
DR   EnsemblGenomes-Gn; EBG00001279438.
DR   EnsemblGenomes-Gn; EBG00001279439.
DR   EnsemblGenomes-Gn; EBG00001279440.
DR   EnsemblGenomes-Gn; EBG00001279441.
DR   EnsemblGenomes-Gn; EBG00001279442.
DR   EnsemblGenomes-Gn; EBG00001279443.
DR   EnsemblGenomes-Gn; EBG00001279444.
DR   EnsemblGenomes-Gn; EBG00001279445.
DR   EnsemblGenomes-Gn; EBG00001279446.
DR   EnsemblGenomes-Gn; EBG00001279447.
DR   EnsemblGenomes-Gn; EBG00001279448.
DR   EnsemblGenomes-Gn; EBG00001279449.
DR   EnsemblGenomes-Gn; EBG00001279450.
DR   EnsemblGenomes-Gn; EBG00001279451.
DR   EnsemblGenomes-Gn; EBG00001279452.
DR   EnsemblGenomes-Gn; EBG00001279453.
DR   EnsemblGenomes-Gn; EBG00001279454.
DR   EnsemblGenomes-Gn; EBG00001279455.
DR   EnsemblGenomes-Gn; EBG00001279456.
DR   EnsemblGenomes-Gn; EBG00001279457.
DR   EnsemblGenomes-Gn; EBG00001279458.
DR   EnsemblGenomes-Gn; EBG00001279459.
DR   EnsemblGenomes-Gn; EBG00001279460.
DR   EnsemblGenomes-Gn; EBG00001279461.
DR   EnsemblGenomes-Gn; EBG00001279462.
DR   EnsemblGenomes-Gn; EBG00001279463.
DR   EnsemblGenomes-Gn; EBG00001279464.
DR   EnsemblGenomes-Gn; EBG00001279465.
DR   EnsemblGenomes-Gn; EBG00001279466.
DR   EnsemblGenomes-Gn; EBG00001279467.
DR   EnsemblGenomes-Gn; EBG00001279468.
DR   EnsemblGenomes-Gn; EBG00001279469.
DR   EnsemblGenomes-Gn; EBG00001279470.
DR   EnsemblGenomes-Gn; EBG00001279471.
DR   EnsemblGenomes-Gn; EBG00001279472.
DR   EnsemblGenomes-Gn; EBG00001279473.
DR   EnsemblGenomes-Gn; EBG00001279474.
DR   EnsemblGenomes-Gn; EBG00001279475.
DR   EnsemblGenomes-Gn; EBG00001279476.
DR   EnsemblGenomes-Gn; EBG00001279477.
DR   EnsemblGenomes-Gn; EBG00001279478.
DR   EnsemblGenomes-Gn; EBG00001279479.
DR   EnsemblGenomes-Gn; EBG00001279480.
DR   EnsemblGenomes-Gn; EBG00001279481.
DR   EnsemblGenomes-Gn; EBG00001279482.
DR   EnsemblGenomes-Gn; EBG00001279483.
DR   EnsemblGenomes-Gn; EBG00001279484.
DR   EnsemblGenomes-Gn; EBG00001279485.
DR   EnsemblGenomes-Gn; EBG00001279486.
DR   EnsemblGenomes-Gn; EBG00001279487.
DR   EnsemblGenomes-Gn; EBG00001279488.
DR   EnsemblGenomes-Gn; EBG00001279489.
DR   EnsemblGenomes-Gn; EBG00001279490.
DR   EnsemblGenomes-Gn; EBG00001279491.
DR   EnsemblGenomes-Gn; EBG00001279492.
DR   EnsemblGenomes-Gn; EBG00001279493.
DR   EnsemblGenomes-Gn; EBG00001279494.
DR   EnsemblGenomes-Gn; EBG00001279495.
DR   EnsemblGenomes-Gn; EBG00001279496.
DR   EnsemblGenomes-Gn; EBG00001279497.
DR   EnsemblGenomes-Gn; EBG00001279498.
DR   EnsemblGenomes-Gn; EBG00001279499.
DR   EnsemblGenomes-Gn; EBG00001279500.
DR   EnsemblGenomes-Gn; EBG00001279501.
DR   EnsemblGenomes-Gn; EBG00001279502.
DR   EnsemblGenomes-Gn; EBG00001279503.
DR   EnsemblGenomes-Gn; EBG00001279504.
DR   EnsemblGenomes-Gn; EBG00001279505.
DR   EnsemblGenomes-Gn; EBG00001279506.
DR   EnsemblGenomes-Gn; EBG00001279507.
DR   EnsemblGenomes-Gn; EBG00001279508.
DR   EnsemblGenomes-Gn; EBG00001279509.
DR   EnsemblGenomes-Gn; EBG00001279510.
DR   EnsemblGenomes-Gn; EBG00001279511.
DR   EnsemblGenomes-Gn; EBG00001279512.
DR   EnsemblGenomes-Gn; EBG00001279513.
DR   EnsemblGenomes-Gn; EBG00001279514.
DR   EnsemblGenomes-Gn; EBG00001279515.
DR   EnsemblGenomes-Gn; EBG00001279516.
DR   EnsemblGenomes-Gn; EBG00001279517.
DR   EnsemblGenomes-Gn; EBG00001279518.
DR   EnsemblGenomes-Gn; EBG00001279519.
DR   EnsemblGenomes-Gn; EBG00001279520.
DR   EnsemblGenomes-Gn; EBG00001279521.
DR   EnsemblGenomes-Gn; EBG00001279522.
DR   EnsemblGenomes-Gn; EBG00001279523.
DR   EnsemblGenomes-Gn; EBG00001279524.
DR   EnsemblGenomes-Gn; EBG00001279525.
DR   EnsemblGenomes-Gn; EBG00001279526.
DR   EnsemblGenomes-Gn; EBG00001279527.
DR   EnsemblGenomes-Gn; EBG00001279528.
DR   EnsemblGenomes-Gn; EBG00001279529.
DR   EnsemblGenomes-Gn; EBG00001279530.
DR   EnsemblGenomes-Gn; EBG00001279531.
DR   EnsemblGenomes-Gn; EBG00001279532.
DR   EnsemblGenomes-Gn; EBG00001279533.
DR   EnsemblGenomes-Gn; EBG00001279534.
DR   EnsemblGenomes-Gn; EBG00001279535.
DR   EnsemblGenomes-Gn; EBG00001279536.
DR   EnsemblGenomes-Gn; EBG00001279537.
DR   EnsemblGenomes-Gn; EBG00001279538.
DR   EnsemblGenomes-Gn; EBG00001279539.
DR   EnsemblGenomes-Gn; EBG00001279540.
DR   EnsemblGenomes-Gn; EBG00001279541.
DR   EnsemblGenomes-Gn; EBG00001279542.
DR   EnsemblGenomes-Gn; EBG00001279543.
DR   EnsemblGenomes-Gn; EBG00001279544.
DR   EnsemblGenomes-Gn; EBG00001279545.
DR   EnsemblGenomes-Gn; EBG00001279546.
DR   EnsemblGenomes-Gn; EBG00001279547.
DR   EnsemblGenomes-Gn; EBG00001279548.
DR   EnsemblGenomes-Gn; EBG00001279549.
DR   EnsemblGenomes-Gn; EBG00001279550.
DR   EnsemblGenomes-Gn; EBG00001279551.
DR   EnsemblGenomes-Gn; EBG00001279552.
DR   EnsemblGenomes-Gn; EBG00001279553.
DR   EnsemblGenomes-Gn; EBG00001279554.
DR   EnsemblGenomes-Gn; EBG00001279555.
DR   EnsemblGenomes-Gn; EBG00001279556.
DR   EnsemblGenomes-Gn; EBG00001279557.
DR   EnsemblGenomes-Gn; EBG00001279558.
DR   EnsemblGenomes-Gn; EBG00001279559.
DR   EnsemblGenomes-Gn; EBG00001279560.
DR   EnsemblGenomes-Gn; EBG00001279561.
DR   EnsemblGenomes-Gn; EBG00001279562.
DR   EnsemblGenomes-Gn; EBG00001279563.
DR   EnsemblGenomes-Gn; EBG00001279564.
DR   EnsemblGenomes-Gn; EBG00001279565.
DR   EnsemblGenomes-Gn; EBG00001279566.
DR   EnsemblGenomes-Gn; EBG00001279567.
DR   EnsemblGenomes-Gn; EBG00001279568.
DR   EnsemblGenomes-Gn; EBG00001279569.
DR   EnsemblGenomes-Gn; EBG00001279570.
DR   EnsemblGenomes-Gn; EBG00001279571.
DR   EnsemblGenomes-Gn; EBG00001279572.
DR   EnsemblGenomes-Tr; BSUW23_06620.
DR   EnsemblGenomes-Tr; BSUW23_miscRNA2-1.
DR   EnsemblGenomes-Tr; BSUW23_miscRNA32-1.
DR   EnsemblGenomes-Tr; BSUW23_miscRNA35-1.
DR   EnsemblGenomes-Tr; BSUW23_miscRNA41-1.
DR   EnsemblGenomes-Tr; BSUW23_miscRNA5-1.
DR   EnsemblGenomes-Tr; BSUW23_miscRNA55-1.
DR   EnsemblGenomes-Tr; BSUW23_r20616-1.
DR   EnsemblGenomes-Tr; BSUW23_r20618-1.
DR   EnsemblGenomes-Tr; BSUW23_r20620-1.
DR   EnsemblGenomes-Tr; BSUW23_r20622-1.
DR   EnsemblGenomes-Tr; BSUW23_r20624-1.
DR   EnsemblGenomes-Tr; BSUW23_r20626-1.
DR   EnsemblGenomes-Tr; BSUW23_r20628-1.
DR   EnsemblGenomes-Tr; BSUW23_r20630-1.
DR   EnsemblGenomes-Tr; BSUW23_r20632-1.
DR   EnsemblGenomes-Tr; BSUW23_r20634-1.
DR   EnsemblGenomes-Tr; BSUW23_r20636-1.
DR   EnsemblGenomes-Tr; BSUW23_r20638-1.
DR   EnsemblGenomes-Tr; BSUW23_r20640-1.
DR   EnsemblGenomes-Tr; BSUW23_r20642-1.
DR   EnsemblGenomes-Tr; BSUW23_r20644-1.
DR   EnsemblGenomes-Tr; BSUW23_r20646-1.
DR   EnsemblGenomes-Tr; BSUW23_r20648-1.
DR   EnsemblGenomes-Tr; BSUW23_r20650-1.
DR   EnsemblGenomes-Tr; BSUW23_r20652-1.
DR   EnsemblGenomes-Tr; BSUW23_r20654-1.
DR   EnsemblGenomes-Tr; BSUW23_r20656-1.
DR   EnsemblGenomes-Tr; BSUW23_r20658-1.
DR   EnsemblGenomes-Tr; BSUW23_r20660-1.
DR   EnsemblGenomes-Tr; BSUW23_r20662-1.
DR   EnsemblGenomes-Tr; BSUW23_t20462-1.
DR   EnsemblGenomes-Tr; BSUW23_t20464-1.
DR   EnsemblGenomes-Tr; BSUW23_t20466-1.
DR   EnsemblGenomes-Tr; BSUW23_t20468-1.
DR   EnsemblGenomes-Tr; BSUW23_t20470-1.
DR   EnsemblGenomes-Tr; BSUW23_t20472-1.
DR   EnsemblGenomes-Tr; BSUW23_t20474-1.
DR   EnsemblGenomes-Tr; BSUW23_t20476-1.
DR   EnsemblGenomes-Tr; BSUW23_t20478-1.
DR   EnsemblGenomes-Tr; BSUW23_t20480-1.
DR   EnsemblGenomes-Tr; BSUW23_t20482-1.
DR   EnsemblGenomes-Tr; BSUW23_t20484-1.
DR   EnsemblGenomes-Tr; BSUW23_t20486-1.
DR   EnsemblGenomes-Tr; BSUW23_t20488-1.
DR   EnsemblGenomes-Tr; BSUW23_t20490-1.
DR   EnsemblGenomes-Tr; BSUW23_t20492-1.
DR   EnsemblGenomes-Tr; BSUW23_t20494-1.
DR   EnsemblGenomes-Tr; BSUW23_t20496-1.
DR   EnsemblGenomes-Tr; BSUW23_t20498-1.
DR   EnsemblGenomes-Tr; BSUW23_t20500-1.
DR   EnsemblGenomes-Tr; BSUW23_t20502-1.
DR   EnsemblGenomes-Tr; BSUW23_t20504-1.
DR   EnsemblGenomes-Tr; BSUW23_t20506-1.
DR   EnsemblGenomes-Tr; BSUW23_t20508-1.
DR   EnsemblGenomes-Tr; BSUW23_t20510-1.
DR   EnsemblGenomes-Tr; BSUW23_t20512-1.
DR   EnsemblGenomes-Tr; BSUW23_t20514-1.
DR   EnsemblGenomes-Tr; BSUW23_t20516-1.
DR   EnsemblGenomes-Tr; BSUW23_t20518-1.
DR   EnsemblGenomes-Tr; BSUW23_t20520-1.
DR   EnsemblGenomes-Tr; BSUW23_t20522-1.
DR   EnsemblGenomes-Tr; BSUW23_t20524-1.
DR   EnsemblGenomes-Tr; BSUW23_t20526-1.
DR   EnsemblGenomes-Tr; BSUW23_t20528-1.
DR   EnsemblGenomes-Tr; BSUW23_t20530-1.
DR   EnsemblGenomes-Tr; BSUW23_t20532-1.
DR   EnsemblGenomes-Tr; BSUW23_t20534-1.
DR   EnsemblGenomes-Tr; BSUW23_t20536-1.
DR   EnsemblGenomes-Tr; BSUW23_t20538-1.
DR   EnsemblGenomes-Tr; BSUW23_t20540-1.
DR   EnsemblGenomes-Tr; BSUW23_t20542-1.
DR   EnsemblGenomes-Tr; BSUW23_t20544-1.
DR   EnsemblGenomes-Tr; BSUW23_t20546-1.
DR   EnsemblGenomes-Tr; BSUW23_t20548-1.
DR   EnsemblGenomes-Tr; BSUW23_t20550-1.
DR   EnsemblGenomes-Tr; BSUW23_t20552-1.
DR   EnsemblGenomes-Tr; BSUW23_t20554-1.
DR   EnsemblGenomes-Tr; BSUW23_t20556-1.
DR   EnsemblGenomes-Tr; BSUW23_t20558-1.
DR   EnsemblGenomes-Tr; BSUW23_t20560-1.
DR   EnsemblGenomes-Tr; BSUW23_t20562-1.
DR   EnsemblGenomes-Tr; BSUW23_t20564-1.
DR   EnsemblGenomes-Tr; BSUW23_t20566-1.
DR   EnsemblGenomes-Tr; BSUW23_t20568-1.
DR   EnsemblGenomes-Tr; BSUW23_t20570-1.
DR   EnsemblGenomes-Tr; BSUW23_t20572-1.
DR   EnsemblGenomes-Tr; BSUW23_t20574-1.
DR   EnsemblGenomes-Tr; BSUW23_t20576-1.
DR   EnsemblGenomes-Tr; BSUW23_t20578-1.
DR   EnsemblGenomes-Tr; BSUW23_t20580-1.
DR   EnsemblGenomes-Tr; BSUW23_t20582-1.
DR   EnsemblGenomes-Tr; BSUW23_t20584-1.
DR   EnsemblGenomes-Tr; BSUW23_t20586-1.
DR   EnsemblGenomes-Tr; BSUW23_t20588-1.
DR   EnsemblGenomes-Tr; BSUW23_t20590-1.
DR   EnsemblGenomes-Tr; BSUW23_t20592-1.
DR   EnsemblGenomes-Tr; BSUW23_t20594-1.
DR   EnsemblGenomes-Tr; BSUW23_t20596-1.
DR   EnsemblGenomes-Tr; BSUW23_t20598-1.
DR   EnsemblGenomes-Tr; BSUW23_t20600-1.
DR   EnsemblGenomes-Tr; BSUW23_t20602-1.
DR   EnsemblGenomes-Tr; BSUW23_t20604-1.
DR   EnsemblGenomes-Tr; BSUW23_t20606-1.
DR   EnsemblGenomes-Tr; BSUW23_t20608-1.
DR   EnsemblGenomes-Tr; BSUW23_t20610-1.
DR   EnsemblGenomes-Tr; BSUW23_t20612-1.
DR   EnsemblGenomes-Tr; BSUW23_t20614-1.
DR   EnsemblGenomes-Tr; EBT00001810649.
DR   EnsemblGenomes-Tr; EBT00001810650.
DR   EnsemblGenomes-Tr; EBT00001810651.
DR   EnsemblGenomes-Tr; EBT00001810652.
DR   EnsemblGenomes-Tr; EBT00001810653.
DR   EnsemblGenomes-Tr; EBT00001810654.
DR   EnsemblGenomes-Tr; EBT00001810655.
DR   EnsemblGenomes-Tr; EBT00001810656.
DR   EnsemblGenomes-Tr; EBT00001810657.
DR   EnsemblGenomes-Tr; EBT00001810658.
DR   EnsemblGenomes-Tr; EBT00001810659.
DR   EnsemblGenomes-Tr; EBT00001810660.
DR   EnsemblGenomes-Tr; EBT00001810661.
DR   EnsemblGenomes-Tr; EBT00001810662.
DR   EnsemblGenomes-Tr; EBT00001810663.
DR   EnsemblGenomes-Tr; EBT00001810664.
DR   EnsemblGenomes-Tr; EBT00001810665.
DR   EnsemblGenomes-Tr; EBT00001810666.
DR   EnsemblGenomes-Tr; EBT00001810667.
DR   EnsemblGenomes-Tr; EBT00001810668.
DR   EnsemblGenomes-Tr; EBT00001810669.
DR   EnsemblGenomes-Tr; EBT00001810670.
DR   EnsemblGenomes-Tr; EBT00001810671.
DR   EnsemblGenomes-Tr; EBT00001810672.
DR   EnsemblGenomes-Tr; EBT00001810673.
DR   EnsemblGenomes-Tr; EBT00001810674.
DR   EnsemblGenomes-Tr; EBT00001810675.
DR   EnsemblGenomes-Tr; EBT00001810676.
DR   EnsemblGenomes-Tr; EBT00001810677.
DR   EnsemblGenomes-Tr; EBT00001810678.
DR   EnsemblGenomes-Tr; EBT00001810679.
DR   EnsemblGenomes-Tr; EBT00001810680.
DR   EnsemblGenomes-Tr; EBT00001810681.
DR   EnsemblGenomes-Tr; EBT00001810682.
DR   EnsemblGenomes-Tr; EBT00001810683.
DR   EnsemblGenomes-Tr; EBT00001810684.
DR   EnsemblGenomes-Tr; EBT00001810685.
DR   EnsemblGenomes-Tr; EBT00001810686.
DR   EnsemblGenomes-Tr; EBT00001810687.
DR   EnsemblGenomes-Tr; EBT00001810688.
DR   EnsemblGenomes-Tr; EBT00001810689.
DR   EnsemblGenomes-Tr; EBT00001810690.
DR   EnsemblGenomes-Tr; EBT00001810691.
DR   EnsemblGenomes-Tr; EBT00001810692.
DR   EnsemblGenomes-Tr; EBT00001810693.
DR   EnsemblGenomes-Tr; EBT00001810694.
DR   EnsemblGenomes-Tr; EBT00001810695.
DR   EnsemblGenomes-Tr; EBT00001810696.
DR   EnsemblGenomes-Tr; EBT00001810697.
DR   EnsemblGenomes-Tr; EBT00001810698.
DR   EnsemblGenomes-Tr; EBT00001810699.
DR   EnsemblGenomes-Tr; EBT00001810700.
DR   EnsemblGenomes-Tr; EBT00001810701.
DR   EnsemblGenomes-Tr; EBT00001810702.
DR   EnsemblGenomes-Tr; EBT00001810703.
DR   EnsemblGenomes-Tr; EBT00001810704.
DR   EnsemblGenomes-Tr; EBT00001810705.
DR   EnsemblGenomes-Tr; EBT00001810706.
DR   EnsemblGenomes-Tr; EBT00001810707.
DR   EnsemblGenomes-Tr; EBT00001810708.
DR   EnsemblGenomes-Tr; EBT00001810709.
DR   EnsemblGenomes-Tr; EBT00001810710.
DR   EnsemblGenomes-Tr; EBT00001810711.
DR   EnsemblGenomes-Tr; EBT00001810712.
DR   EnsemblGenomes-Tr; EBT00001810713.
DR   EnsemblGenomes-Tr; EBT00001810714.
DR   EnsemblGenomes-Tr; EBT00001810715.
DR   EnsemblGenomes-Tr; EBT00001810716.
DR   EnsemblGenomes-Tr; EBT00001810717.
DR   EnsemblGenomes-Tr; EBT00001810718.
DR   EnsemblGenomes-Tr; EBT00001810719.
DR   EnsemblGenomes-Tr; EBT00001810720.
DR   EnsemblGenomes-Tr; EBT00001810721.
DR   EnsemblGenomes-Tr; EBT00001810722.
DR   EnsemblGenomes-Tr; EBT00001810723.
DR   EnsemblGenomes-Tr; EBT00001810724.
DR   EnsemblGenomes-Tr; EBT00001810725.
DR   EnsemblGenomes-Tr; EBT00001810726.
DR   EnsemblGenomes-Tr; EBT00001810727.
DR   EnsemblGenomes-Tr; EBT00001810728.
DR   EnsemblGenomes-Tr; EBT00001810729.
DR   EnsemblGenomes-Tr; EBT00001810730.
DR   EnsemblGenomes-Tr; EBT00001810731.
DR   EnsemblGenomes-Tr; EBT00001810732.
DR   EnsemblGenomes-Tr; EBT00001810733.
DR   EnsemblGenomes-Tr; EBT00001810734.
DR   EnsemblGenomes-Tr; EBT00001810735.
DR   EnsemblGenomes-Tr; EBT00001810736.
DR   EnsemblGenomes-Tr; EBT00001810737.
DR   EnsemblGenomes-Tr; EBT00001810738.
DR   EnsemblGenomes-Tr; EBT00001810739.
DR   EnsemblGenomes-Tr; EBT00001810740.
DR   EnsemblGenomes-Tr; EBT00001810741.
DR   EnsemblGenomes-Tr; EBT00001810742.
DR   EnsemblGenomes-Tr; EBT00001810743.
DR   EnsemblGenomes-Tr; EBT00001810744.
DR   EnsemblGenomes-Tr; EBT00001810745.
DR   EnsemblGenomes-Tr; EBT00001810746.
DR   EnsemblGenomes-Tr; EBT00001810747.
DR   EnsemblGenomes-Tr; EBT00001810748.
DR   EnsemblGenomes-Tr; EBT00001810749.
DR   EnsemblGenomes-Tr; EBT00001810750.
DR   EnsemblGenomes-Tr; EBT00001810751.
DR   EnsemblGenomes-Tr; EBT00001810752.
DR   EnsemblGenomes-Tr; EBT00001810753.
DR   EnsemblGenomes-Tr; EBT00001810754.
DR   EnsemblGenomes-Tr; EBT00001810755.
DR   EnsemblGenomes-Tr; EBT00001810756.
DR   EnsemblGenomes-Tr; EBT00001810757.
DR   EnsemblGenomes-Tr; EBT00001810758.
DR   EnsemblGenomes-Tr; EBT00001810759.
DR   EnsemblGenomes-Tr; EBT00001810760.
DR   EnsemblGenomes-Tr; EBT00001810761.
DR   EnsemblGenomes-Tr; EBT00001810762.
DR   EnsemblGenomes-Tr; EBT00001810763.
DR   EnsemblGenomes-Tr; EBT00001810764.
DR   EnsemblGenomes-Tr; EBT00001810765.
DR   EnsemblGenomes-Tr; EBT00001810766.
DR   EnsemblGenomes-Tr; EBT00001810767.
DR   EnsemblGenomes-Tr; EBT00001810768.
DR   EnsemblGenomes-Tr; EBT00001810769.
DR   EnsemblGenomes-Tr; EBT00001810770.
DR   EnsemblGenomes-Tr; EBT00001810771.
DR   EnsemblGenomes-Tr; EBT00001810772.
DR   EnsemblGenomes-Tr; EBT00001810773.
DR   EnsemblGenomes-Tr; EBT00001810774.
DR   EnsemblGenomes-Tr; EBT00001810775.
DR   EnsemblGenomes-Tr; EBT00001810776.
DR   EnsemblGenomes-Tr; EBT00001810777.
DR   EnsemblGenomes-Tr; EBT00001810778.
DR   EnsemblGenomes-Tr; EBT00001810779.
DR   EnsemblGenomes-Tr; EBT00001810780.
DR   EnsemblGenomes-Tr; EBT00001810781.
DR   EnsemblGenomes-Tr; EBT00001810782.
DR   EnsemblGenomes-Tr; EBT00001810783.
DR   EnsemblGenomes-Tr; EBT00001810784.
DR   EnsemblGenomes-Tr; EBT00001810785.
DR   EnsemblGenomes-Tr; EBT00001810786.
DR   EnsemblGenomes-Tr; EBT00001810787.
DR   EnsemblGenomes-Tr; EBT00001810788.
DR   EnsemblGenomes-Tr; EBT00001810789.
DR   EnsemblGenomes-Tr; EBT00001810790.
DR   EnsemblGenomes-Tr; EBT00001810791.
DR   EnsemblGenomes-Tr; EBT00001810792.
DR   EnsemblGenomes-Tr; EBT00001810793.
DR   EnsemblGenomes-Tr; EBT00001810794.
DR   EnsemblGenomes-Tr; EBT00001810795.
DR   EnsemblGenomes-Tr; EBT00001810796.
DR   EnsemblGenomes-Tr; EBT00001810797.
DR   EnsemblGenomes-Tr; EBT00001810798.
DR   EnsemblGenomes-Tr; EBT00001810799.
DR   EnsemblGenomes-Tr; EBT00001810800.
DR   EnsemblGenomes-Tr; EBT00001810801.
DR   EnsemblGenomes-Tr; EBT00001810802.
DR   EnsemblGenomes-Tr; EBT00001810803.
DR   EnsemblGenomes-Tr; EBT00001810804.
DR   EnsemblGenomes-Tr; EBT00001810805.
DR   EuropePMC; PMC3193587; 21840319.
DR   EuropePMC; PMC3485967; 22941078.
DR   EuropePMC; PMC3516659; 24293722.
DR   EuropePMC; PMC4624242; 26505996.
DR   EuropePMC; PMC5169363; 28066362.
DR   EuropePMC; PMC5585990; 28039230.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01458; rli23.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02273; FsrA.
DR   SILVA-LSU; CP002183.
DR   SILVA-SSU; CP002183.
XX
CC   Bacteria available from the Bacillus Genetic Stock Center.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4027676
FT                   /organism="Bacillus subtilis subsp. spizizenii str. W23"
FT                   /sub_species="spizizenii"
FT                   /strain="W23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:655816"
FT   gene            410..1750
FT                   /gene="dnaA"
FT                   /locus_tag="BSUW23_00010"
FT   CDS_pept        410..1750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BSUW23_00010"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36060"
FT                   /db_xref="GOA:E0TXL0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL0"
FT                   /protein_id="ADM36060.1"
FT                   /translation="MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITA
FT                   PNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTS
FT                   DFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLAEDEQLQQHVKEIKEQLK"
FT   gene            1938..3074
FT                   /gene="dnaN"
FT                   /locus_tag="BSUW23_00015"
FT   CDS_pept        1938..3074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BSUW23_00015"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36061"
FT                   /db_xref="GOA:E0TXL1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL1"
FT                   /protein_id="ADM36061.1"
FT                   /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFT
FT                   GSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLT
FT                   IIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILT
FT                   GVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELV
FT                   DIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQESKTEIIVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAILADQIEGEELNISFSPKYMLDALK
FT                   VLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY"
FT   gene            3206..3421
FT                   /gene="yaaA"
FT                   /locus_tag="BSUW23_00020"
FT   CDS_pept        3206..3421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="BSUW23_00020"
FT                   /product="putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36062"
FT                   /db_xref="GOA:E0TXL2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL2"
FT                   /protein_id="ADM36062.1"
FT                   /translation="MANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNNEP
FT                   DNRRGRKLYVGDVVEIEGFGSFQVVN"
FT   gene            3437..4549
FT                   /gene="recF"
FT                   /locus_tag="BSUW23_00025"
FT   CDS_pept        3437..4549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BSUW23_00025"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36063"
FT                   /db_xref="GOA:E0TXL3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL3"
FT                   /protein_id="ADM36063.1"
FT                   /translation="MYIQNLELTSYRNYDHAELQFENKVNVIIGENAQGKTNLMEAIYV
FT                   LSMAKSHRTSNDKELIRWDKDYAKIEGRVMKQNGAIPMQLVISKKGKKGKVNHIEQQKL
FT                   SQYVGALNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHF
FT                   LKQLQTRKQTDRTMLDVLTDQLVEVAAKVVVKRLQFTAQLEKWAQPIHAGISRGLEELT
FT                   LKYHTALEVSDPKDLSKIGDSYQEAFSKLREKEIERGITLSGPHRDDVLFYVNGRDVQT
FT                   YGSQGQQRTTALSLKLAEIDLIHEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQT
FT                   FVTTTSVDGIDHETLRQAGMFRVQNGALVK"
FT   gene            4572..4817
FT                   /gene="yaaB"
FT                   /locus_tag="BSUW23_00030"
FT   CDS_pept        4572..4817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaB"
FT                   /locus_tag="BSUW23_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36064"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL4"
FT                   /protein_id="ADM36064.1"
FT                   /translation="MYIHLGDDFVVSTRDIVGIFDFKANMSPIVEEFLKKQKHKVVPSV
FT                   NGTPKSIVVTVQNIYYSPLSSSTLKKRAQFMFEIDS"
FT   gene            4872..6788
FT                   /gene="gyrB"
FT                   /locus_tag="BSUW23_00035"
FT   CDS_pept        4872..6788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BSUW23_00035"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36065"
FT                   /db_xref="GOA:E0TXL5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL5"
FT                   /protein_id="ADM36065.1"
FT                   /translation="MEQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEI
FT                   VDNSIDEALAGYCTDINIQIEKDNSITVIDNGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFDGSGYKVSGGLHGVGASVVNALSTELVVTVHRDGKIHRQTYKRGVPVSDLEIIGETD
FT                   HTGTTTHFVPDPEIFTETTVYDYDLLANRVRELAFLTKGVNITIEDKREGQERKNEYHY
FT                   EGGIKSYVEYLNRSKEVVHEEPIYIEGEKDGITVEVALQYNDSYTSNIYSFTNNINTYE
FT                   GGTHEAGFKTGLTRVINDYARKKGLIKENDPNLSGDDVREGLTAIISIKHPDPQFEGQT
FT                   KTKLGNSEARTITDTLFSAALETFMLENPDAAKKIVDKGLMAARARMAAKKARELTRRK
FT                   SALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFF
FT                   YRYMRQIIENGYVYIAQPPLYKVQQGKRVEYAYNDKELEDLLKTLPQTPKPGLQRYKGL
FT                   GEMNATQLWETTMDPSSRTLLQVTLEDAMDADETFEMLMGDKVEPRRNFIEANARYVKN
FT                   LDI"
FT   gene            7005..9470
FT                   /gene="gyrA"
FT                   /locus_tag="BSUW23_00040"
FT   CDS_pept        7005..9470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BSUW23_00040"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36066"
FT                   /db_xref="GOA:E0TXL6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL6"
FT                   /protein_id="ADM36066.1"
FT                   /translation="MNEQNTPQVREINISQEMRTSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFNYRYMLV
FT                   DGHGNFGSVDGDSAAAMRYTEARMSKISMEILRDITKDTIDYQDNYDGSEREPVVMPSR
FT                   FPNLLVNGAAGIAVGMATNIPPHQLGEIIDGVLAVSENPDITIPELMEFIPGPDFPTAG
FT                   QILGRSGIRKAYESGRGSITIRAKAEIEQTSSGKERIIVTELPYQVNKAKLIEKIADLV
FT                   RDKKIEGITDLRDESDRTGMRIVIEIRRDANANVILNNLYKQTALQTSFGINLLALVDG
FT                   QPKVLNLKQCLEHYLDHQKVVIRRRTAYELRKAEARAHILEGLRIALDHLDAVISLIRN
FT                   SQTAEIARTGLIEQFSLTEKQAQAILDMRLQRLTGLEREKIEEEYLSLVKLIAELKDIL
FT                   ANEYKVLEIIREELTEIKERFNDERRTEIVTAGLETIEDEDLIERENIVVTLTHNGYIK
FT                   RLPASTYRSQKRGGKGVQGMGTNEDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPE
FT                   YGRTAKGIPIINLLEVEKGEWINAIIPVTEFNAELYLFFTTKHGVSKRTSLSQFANIRN
FT                   NGLIALSLREDDELMGVRLTDGTKQMIIGTKNGLLIRFPETDVREMGRTAAGVKGITLT
FT                   DDDVVVGMEILEEESHVLIVTEKGYGKRTPAEEYRTQSRGGKGLKTAKITENNGQLVTV
FT                   KATKGEEDLMIITASGVLIRMDINDISITGRVTQGVRLIRMAEEEHVATVALVEKDEED
FT                   ENEETQEEV"
FT   gene            9750..11308
FT                   /locus_tag="BSUW23_r20632"
FT                   /note="rrnO-16S"
FT   rRNA            9750..11308
FT                   /locus_tag="BSUW23_r20632"
FT                   /product="16S ribosomal RNA"
FT   gene            11403..11479
FT                   /locus_tag="BSUW23_t20462"
FT                   /note="trnO-Ile"
FT   tRNA            11403..11479
FT                   /locus_tag="BSUW23_t20462"
FT                   /product="tRNA-Ile"
FT   gene            11491..11566
FT                   /locus_tag="BSUW23_t20464"
FT                   /note="trnO-Ala"
FT   tRNA            11491..11566
FT                   /locus_tag="BSUW23_t20464"
FT                   /product="tRNA-Ala"
FT   gene            11647..14573
FT                   /locus_tag="BSUW23_r20648"
FT                   /note="rrnO-23S"
FT   rRNA            11647..14573
FT                   /locus_tag="BSUW23_r20648"
FT                   /product="23S ribosomal RNA"
FT   gene            14711..14826
FT                   /locus_tag="BSUW23_r20616"
FT                   /note="rrnO-5S"
FT   rRNA            14711..14826
FT                   /locus_tag="BSUW23_r20616"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14866..15852)
FT                   /gene="yaaC"
FT                   /locus_tag="BSUW23_00045"
FT   CDS_pept        complement(14866..15852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BSUW23_00045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36067"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL7"
FT                   /protein_id="ADM36067.1"
FT                   /translation="MKYLDNGKDKEIHMTYHEWKDLALFYSVESTQKFLEKVYTLNGID
FT                   DAKKNSFKNSERFIYFLKHAESFYKQASYSPLEIKPILLFYGMAQLIKACLITRDPHYP
FT                   SHTSILAHGVTTRKRKKQNYCFSDDEVKIQRNGLCIHFMKHLFGQSDIVDERYTMKKLL
FT                   MAIPELSDTFYFQQKERFMTKIEKEKDRIAVPEDVVINYKMSDSRFAEYMSHHFQWSFE
FT                   RKNKQELLFEISPQDTKPWTSISLLYDMGKNQYFIPAQREQFLRLPEMAIHYLILYNIG
FT                   MIARYETEWWYELLTQHISDDYVLIQQFLLVTENKFPKYALQFLLHF"
FT   gene            15934..17400
FT                   /gene="guaB"
FT                   /locus_tag="BSUW23_00050"
FT   CDS_pept        15934..17400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BSUW23_00050"
FT                   /product="inosine 5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36068"
FT                   /db_xref="GOA:E0TXL8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL8"
FT                   /protein_id="ADM36068.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTKTLKLNIP
FT                   VISAGMDTVTESAMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   DHQVFDAEHLMGKYRISGVPIVDNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TASVGTTLDEAEKILQKHKIEKLPLVDDQNKLKGLITIKDIEKVIEFPNSSKDIHGRLI
FT                   VGAAVGVTGDTMTRVKKLVEANVDVIVIDTAHGHSQGVLNTVTKIRETYPELNIIAGNV
FT                   ATAEATRALIEAGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKTIIA
FT                   DGGIKFSGDITKALAAGGHAVMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEENKKFVPEGIEGRTPYKGPVEETVYQLVGGLRSGMGYCGSKDLHALREEA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
FT   gene            17553..18884
FT                   /gene="dacA"
FT                   /locus_tag="BSUW23_00055"
FT   CDS_pept        17553..18884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BSUW23_00055"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36069"
FT                   /db_xref="GOA:E0TXL9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXL9"
FT                   /protein_id="ADM36069.1"
FT                   /translation="MNTKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIM
FT                   IEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQD
FT                   NSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEVVAGSETKFVEKMNAKAKELGL
FT                   TDYKFVNATGLENKDLHGHQPEGTSVDEESEVSAKDMAILADHLITDYPEILETSSIAK
FT                   TKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAELNGMRVI
FT                   TVVLNAKGNLHTGRFDETKKMFDYAFNNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGI
FT                   VTNKAFSLPVKNGEEKNYKAKVTLNKETLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSN
FT                   LAGVDLVTKENVEKANWFVLTMRSISGFFAGIWGSIVDTVTGWF"
FT   gene            19081..19965
FT                   /gene="pdxS"
FT                   /locus_tag="BSUW23_00060"
FT   CDS_pept        19081..19965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BSUW23_00060"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36070"
FT                   /db_xref="GOA:E0TXM0"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM0"
FT                   /protein_id="ADM36070.1"
FT                   /translation="MAQTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEAMGVDYIDES
FT                   EVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVAMSEDELMTEAKNLGAPYELLLQIKKDGKLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHYTDYKLIAELSKELGTAMKGIEIS
FT                   NLLPEQRMQERGW"
FT   gene            19987..20577
FT                   /gene="pdxT"
FT                   /locus_tag="BSUW23_00065"
FT   CDS_pept        19987..20577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BSUW23_00065"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36071"
FT                   /db_xref="GOA:E0TXM1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM1"
FT                   /protein_id="ADM36071.1"
FT                   /translation="MLTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEIDGLILP
FT                   GGESTTMRRLIDTYQFMEPLRKFAAQGKPMFGTCAGLIILAKEIAGSDNPHLGLLNVVV
FT                   ERNSFGRQVDSFEADLTIKGLNEPFTGVFIRAPHILEAGENVEVLSEHNGRIVAAKQDQ
FT                   FLGCSFHPELTEDHRVTQLFVQMVEEYKQKALV"
FT   misc_binding    20630..20842
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader; regulation of serine biosynthetic gene
FT                   serS; uncharged tRNA acts as the effector for transcription
FT                   antitermination; BSUW23_misc_RNA_1"
FT   gene            20898..22175
FT                   /gene="serS"
FT                   /locus_tag="BSUW23_00070"
FT   CDS_pept        20898..22175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BSUW23_00070"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36072"
FT                   /db_xref="GOA:E0TXM2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM2"
FT                   /protein_id="ADM36072.1"
FT                   /translation="MLDTKMLRANFQEIKAKLVHKGEDLTDFDKFEALDDRRRELIGKV
FT                   EELKGKRNEVSQQVAVLKREKKDADHIIKEMREVGEEIKTLDEELRAVESELDTILLSI
FT                   PNIPHESVPVGETEDDNIEVRKWGEKPSFAYEPKPHWDIADELGILDFERAAKVTGSRF
FT                   VFYKGLGARLERALYNFMLDLHVDEYNYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPITNMHRDEILSGDSLPINYAAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYGELEKLTNQAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSQDTYREISSCSNFEAFQARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAAILEN
FT                   YQQEDGSVVIPKVLRPYMGNKEVIKP"
FT   gene            22310..22402
FT                   /locus_tag="BSUW23_t20466"
FT                   /note="trnSL-Ser1"
FT   tRNA            22310..22402
FT                   /locus_tag="BSUW23_t20466"
FT                   /product="tRNA-Ser"
FT   gene            complement(22514..23167)
FT                   /gene="dck"
FT                   /locus_tag="BSUW23_00075"
FT   CDS_pept        complement(22514..23167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BSUW23_00075"
FT                   /product="deoxyadenosine/deoxycytidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36073"
FT                   /db_xref="GOA:E0TXM3"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM3"
FT                   /protein_id="ADM36073.1"
FT                   /translation="MKEHHIPKNSIITVAGTVGVGKSTLTKALAKRLGFKTSLEEVDHN
FT                   PYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADK
FT                   GTMSKIDYKTYTSLFEAMVMTPYFPHPDVLIYLEGDLENILNRIEERGREMELQTSRSY
FT                   WEEMHTRYENWISGFNACPVLKLRIEDYDLLNDESSIENIVDQIASVIHENQKK"
FT   gene            complement(23164..23787)
FT                   /gene="dgk"
FT                   /locus_tag="BSUW23_00080"
FT   CDS_pept        complement(23164..23787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BSUW23_00080"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36074"
FT                   /db_xref="GOA:E0TXM4"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM4"
FT                   /protein_id="ADM36074.1"
FT                   /translation="MNTAPFIAIEGPIGAGKTTLATMLSQEFGFPMISEIVEDNPYLDK
FT                   FYDNIEEWSFQLEMFFLCHRYKQLEDTSDHFLKKGQPVIADYHIYKNVIFAERTLSQHQ
FT                   LEKYKKIYHLLTDDLPKPNFIIYIKASLPTLLHRIEKRGRPFEKKIETSYLEQLIADYE
FT                   VAIKQLQEADPELTVLTIDGDSKDFVLNKSDFERIAAHVKELIV"
FT   gene            complement(23886..25169)
FT                   /gene="yaaH"
FT                   /locus_tag="BSUW23_00085"
FT   CDS_pept        complement(23886..25169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="BSUW23_00085"
FT                   /product="spore peptidoglycan hydrolase (inner coat)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36075"
FT                   /db_xref="GOA:E0TXM5"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM5"
FT                   /protein_id="ADM36075.1"
FT                   /translation="MVKQGDTLSAIASQYRTTVNEITETNEIPNPDSLVVGQTIVIPIA
FT                   GQFYDVQQGDTLTSIARRFNTTAAELARVNRIQLNTVLQIGFRLYIPPVPKRDIESNAY
FT                   LEPRGNQVSENLQQAAREASPYLTYLGAFSFQAQRDGTLVAPPLTNLRSIAENQNTTLM
FT                   MIITNLENQAFSDELGRILLNDDTVKRRLLNEIVENAKRYDFYDIHFDFEYLRPQDREA
FT                   YNQFLREARDLFHREGLEISTALAPKTSATQQGRWYEAHDYRAHGQIVDFVVLMTYEWG
FT                   YSGGPPQAVSPIGPVRDVIEYALTEMPANKIVMGQNLYGYDWTLPYTAGGTPARAISPQ
FT                   QALAIADQNNATIQYDQTAQAPFFRYTDAENRRHEVWFEDARSIQAKFNLIKELNLRGI
FT                   SYWKLGLSFPQNWLLLSDQFNIVKKTFR"
FT   gene            complement(25239..25784)
FT                   /gene="yaaI"
FT                   /locus_tag="BSUW23_00090"
FT   CDS_pept        complement(25239..25784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="BSUW23_00090"
FT                   /product="putative isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36076"
FT                   /db_xref="GOA:E0TXM6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM6"
FT                   /protein_id="ADM36076.1"
FT                   /translation="MSKADTALLIVDMINNFEFDMGESLAKKTEKIVPHILSLKEHARQ
FT                   NDWPIIYINDHYGLWQADIKNIQQECTNERSKDIIRQIAPEDADYFLIKPKHSAFYETA
FT                   LHTLLTELQVKHIILTGIAGNICVLFTANDAYMREYSITIPKDCIASNRDEDNEFALTM
FT                   MENVLLAEITSEEQITEK"
FT   gene            25870..26355
FT                   /gene="tadA"
FT                   /locus_tag="BSUW23_00095"
FT   CDS_pept        25870..26355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="BSUW23_00095"
FT                   /product="tRNA specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36077"
FT                   /db_xref="GOA:E0TXM7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM7"
FT                   /protein_id="ADM36077.1"
FT                   /translation="MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVVNDEIIARAHNLRE
FT                   TEQRSIAHAEMLVIDEACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFD
FT                   PKGGCSGTIMNLLQEERFNHQAEVVSGVLEEECGGMLSSFFRELRKKKKAFRKNLSE"
FT   gene            26397..26750
FT                   /gene="scr"
FT                   /locus_tag="BSUW23_miscRNA2"
FT   ncRNA           26397..26750
FT                   /gene="scr"
FT                   /locus_tag="BSUW23_miscRNA2"
FT                   /product="small cytoplasmic RNA (scRNA, 4.5S RNA), signal
FT                   recognition particle-like (SRP) component"
FT                   /note="RNA component of the signal recognition particle
FT                   (SRP) ribonucleoprotein complex; involved in targeting
FT                   specific proteins for the plasma membrane;
FT                   BSUW23_misc_RNA_2"
FT                   /ncRNA_class="other"
FT   gene            26831..28522
FT                   /gene="dnaX"
FT                   /locus_tag="BSUW23_00100"
FT   CDS_pept        26831..28522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BSUW23_00100"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36078"
FT                   /db_xref="GOA:E0TXM8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM8"
FT                   /protein_id="ADM36078.1"
FT                   /translation="MSYQALYRVFRPQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITSQAIVGRMNKIVEAEQLQVEEGSLDIIASAADGGMRDALSLLD
FT                   QAVSFSGDVLKVEDALLITGAVSQLYIGKLAQSLHDKNVSDALETLNELLQQGKDPAKL
FT                   IEDMIFYFRDMLLYKTAPGLEGVLEKVKVDETFRGLSEQIPAQAIYEMIDILNKSHQEM
FT                   KWTNHPRIFFEVAVVKICQTSHQSAADLPEVDMLMKKIQQLEQEVERLKTTGIKAAAES
FT                   PKKETPRVPKGGKSNYKAPVGRIHEILKEATRPDLDLLRNSWGKLLDHLKQQNKVSHAA
FT                   LLNDSEPVAAASAAFVLKFKYEIHCKMVAEDNNGVRTNLEQILESMLGKRMDLIGVPEA
FT                   QWGKIREEFLVDHQQENEGSNEPAEEDPLIAEAKKLVGADLIEIKD"
FT   gene            28546..28869
FT                   /gene="yaaK"
FT                   /locus_tag="BSUW23_00105"
FT   CDS_pept        28546..28869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="BSUW23_00105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36079"
FT                   /db_xref="GOA:E0TXM9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXM9"
FT                   /protein_id="ADM36079.1"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMAKAQEELAEKVVEGTAGGGMVTV
FT                   KANGQKEILDVIIKEEVVDPEDIDMLQDLVLAATNEALKKVDEITNETMGQFTKGMNMP
FT                   GLF"
FT   gene            28884..29480
FT                   /gene="recR"
FT                   /locus_tag="BSUW23_00110"
FT   CDS_pept        28884..29480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BSUW23_00110"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36080"
FT                   /db_xref="GOA:E0TXN0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN0"
FT                   /protein_id="ADM36080.1"
FT                   /translation="MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAK
FT                   ALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQY
FT                   HVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPS
FT                   GIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            29498..29722
FT                   /gene="yaaL"
FT                   /locus_tag="BSUW23_00115"
FT   CDS_pept        29498..29722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BSUW23_00115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36081"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN1"
FT                   /protein_id="ADM36081.1"
FT                   /translation="MGFLRKKTLRREFDEKLVEQLFKQKEEWNRQKKLVEKSLEPSAEV
FT                   LYELKVAEAKYFFYLREAKQRNLKISRWK"
FT   gene            29789..30052
FT                   /gene="bofA"
FT                   /locus_tag="BSUW23_00120"
FT   CDS_pept        29789..30052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BSUW23_00120"
FT                   /product="inhibitor of the pro-sigma(K) processing
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36082"
FT                   /db_xref="GOA:E0TXN2"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN2"
FT                   /protein_id="ADM36082.1"
FT                   /translation="MEPIFIIGIILGLVILLFLSGSAAKPLKWIGITAVKFVAGALLLV
FT                   CVNMFGGSLGIHVPINLVTTAISGILGIPGIAALVVIKQFII"
FT   gene            30362..31920
FT                   /locus_tag="BSUW23_r20634"
FT                   /note="rrnA-16S"
FT   rRNA            30362..31920
FT                   /locus_tag="BSUW23_r20634"
FT                   /product="16S ribosomal RNA"
FT   gene            32015..32091
FT                   /locus_tag="BSUW23_t20468"
FT                   /note="trnA-Ile"
FT   tRNA            32015..32091
FT                   /locus_tag="BSUW23_t20468"
FT                   /product="tRNA-Ile"
FT   gene            32103..32178
FT                   /locus_tag="BSUW23_t20470"
FT                   /note="trnA-Ala"
FT   tRNA            32103..32178
FT                   /locus_tag="BSUW23_t20470"
FT                   /product="tRNA-Ala"
FT   gene            32259..35185
FT                   /locus_tag="BSUW23_r20650"
FT                   /note="rrnA-23S"
FT   rRNA            32259..35185
FT                   /locus_tag="BSUW23_r20650"
FT                   /product="23S ribosomal RNA"
FT   gene            35323..35438
FT                   /locus_tag="BSUW23_r20618"
FT                   /note="rrnA-5S"
FT   rRNA            35323..35438
FT                   /locus_tag="BSUW23_r20618"
FT                   /product="5S ribosomal RNA"
FT   gene            35616..35810
FT                   /gene="csfB"
FT                   /locus_tag="BSUW23_00125"
FT   CDS_pept        35616..35810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="BSUW23_00125"
FT                   /product="forespore-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36083"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN3"
FT                   /protein_id="ADM36083.1"
FT                   /translation="MDETVKPNHTCVICDQEKNRGIHLYSKFICLDCERKVISTSTSDP
FT                   DYAFYVKKLKSIHTPPLYS"
FT   gene            35943..36557
FT                   /gene="xpaC"
FT                   /locus_tag="BSUW23_00130"
FT   CDS_pept        35943..36557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpaC"
FT                   /locus_tag="BSUW23_00130"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36084"
FT                   /db_xref="GOA:E0TXN4"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN4"
FT                   /protein_id="ADM36084.1"
FT                   /translation="MQRFLHFLIWSLTGSATFVFIGVLCFFGLNQSLFLSFVYGLASGA
FT                   FVYTAGIWNARRLFLKKHSLTGREYAYIKKNLEEARQKIIRLRKALFQAKSIQMFKQNA
FT                   EMLRLVRRIYILTKKEPKRFYQAERFFYQTLDSVVELTEKYAFLSSHPKKSKELSISLS
FT                   EARITLAELTKRLEEDLTQVMGDEIDELQFELDAAKHSLKK"
FT   gene            36576..37733
FT                   /gene="telA"
FT                   /gene_synonym="yaaN"
FT                   /locus_tag="BSUW23_00135"
FT   CDS_pept        36576..37733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="telA"
FT                   /gene_synonym="yaaN"
FT                   /locus_tag="BSUW23_00135"
FT                   /product="putative tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36085"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN5"
FT                   /protein_id="ADM36085.1"
FT                   /translation="MNRDQSDLHIDKLLADPFGDIKIPKVEAVKAEKKQVRLVDVLPEE
FT                   NKEKAIQLAGQIDHKNMQSIVLYGSQAQSKLLNFSHTMIDHVQKKDVGEIGDILGELMK
FT                   KLEQVNPDDLQSKKKGFLARMFGRVSNSLQEVLSKYQKTSVQIDRISLKLEHSKNALIS
FT                   DNKLLEQLYEKNKEYFTALNVYIAAGELKLEELKTKTIPELKQQAESSEHNQMAVQEVN
FT                   DLIQFADRLDKRVHDLLLSRQITIQSAPQIRLIQNTNQALAEKIQSSIVTAIPLWKNQV
FT                   AIALTLLRQRNAVDAQQKVSDTTNELLLKNAELLKTNTIETVRANERGLVDIDTLKKVQ
FT                   ESLISTLEETLTIQEEGRIKRRQAEEELMMMEGDLKYKLLMMKER"
FT   gene            37815..39257
FT                   /gene="yaaO"
FT                   /locus_tag="BSUW23_00140"
FT   CDS_pept        37815..39257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BSUW23_00140"
FT                   /product="putative lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36086"
FT                   /db_xref="GOA:E0TXN6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN6"
FT                   /protein_id="ADM36086.1"
FT                   /translation="MNTPLYKALIQHARRNSHSFHVPGHHNGDVFFDDAKSIFDPLLTI
FT                   DVTELAGLDDLHHPSGVIKEAQELVSQLYGSAESFFLVNGTTVGNLAMILSVCEPGETI
FT                   LVQRNCHKSVFHAVDLAGAEPVYLAPDIDEAMHVPTHVPLDTIKKALAAYPDAKGLVLT
FT                   NPTYYGHSADLTEIISVAHHYGIPVLVDEAHGAHFVLGKPFPVSALKMGADIVVQSAHK
FT                   TLPAMTMGSYLHLNNGCRVDRNRVAEYLVRLQSSSPSYPIMASLDIARAYVQHIIEERK
FT                   LSDILQRIQSLKQTFDLLTNAEVVKPADPRMITDPLKLTIRSKRGHSGYTLQNILERAN
FT                   IFTELADENQVLLVLPLGGKRRINAETIKSIDDEIEKTPPDQLFVSAEWGVQPVTVLPY
FT                   QKKVLQTFKKEYVDFDEAAGRLNVEDIIPYPPGIPMIMSGERITKESVQKLSRLISMKT
FT                   HVQGNMKIKEKQLLVYIEEGKS"
FT   gene            39254..39892
FT                   /gene="tmk"
FT                   /locus_tag="BSUW23_00145"
FT   CDS_pept        39254..39892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BSUW23_00145"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36087"
FT                   /db_xref="GOA:E0TXN7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN7"
FT                   /protein_id="ADM36087.1"
FT                   /translation="MSGLFITFEGPEGAGKTTVLQEIKNILIAEGLQVTATREPGGIDI
FT                   AEQIREVILNENNTLMDPRTEALLYAAARRQHLVEKVKPALEQGHVVLCDRFIDSSLAY
FT                   QGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIHANGSREKNRLDLEKLS
FT                   FHTKVREGYQELMKRFPKRFHPVDASQSKDLVVQDVLKVVNEALKKIQL"
FT   gene            39967..40296
FT                   /gene="yaaQ"
FT                   /locus_tag="BSUW23_00150"
FT   CDS_pept        39967..40296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaQ"
FT                   /locus_tag="BSUW23_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36088"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN8"
FT                   /protein_id="ADM36088.1"
FT                   /translation="MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFM
FT                   IGVEDIRVDKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVD
FT                   EFHQF"
FT   gene            40309..40749
FT                   /gene="yaaR"
FT                   /locus_tag="BSUW23_00155"
FT   CDS_pept        40309..40749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BSUW23_00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36089"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXN9"
FT                   /protein_id="ADM36089.1"
FT                   /translation="MKINKDIRTFIDNKQLPSVKTSEITASFKTSMENQSSKLKFDQLT
FT                   RLLSDIEAFGKRLTKSRNFKDLARFKGLVKRFVKEAVDSGLSHETSKSFDLYGNSRTLG
FT                   LVKEIDDKLIQLTEEMMDQEKPAIDLLDRIGEIKGLLINLYT"
FT   gene            40761..41750
FT                   /gene="holB"
FT                   /locus_tag="BSUW23_00160"
FT   CDS_pept        40761..41750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BSUW23_00160"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36090"
FT                   /db_xref="GOA:E0TXP0"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP0"
FT                   /protein_id="ADM36090.1"
FT                   /translation="MAISWKEMNELQPRVMKLLYNSIEKDRLSHAYLFEGKKGTGKLDA
FT                   ALLLAKSFFCLEDGAEPCENCRNCKRIESGNHPDLHLVQPDGLSIKKAQIQALQEEFSK
FT                   TGLESHKKLYIISHADQMTANAANSLLKFLEEPNKDTMAILITEQPQRLLDTIISRCQT
FT                   LPFQPLQPKAIEDRLIEQDVLPHMARLLANMTNNVAEAVELSRNDEFAESRAKVIKLYE
FT                   VLHQRKGHAFFFIQDQWMPFFKEKTHQEMGLDMLLLIYRDVLSIQIGNEDKLIYQDLFQ
FT                   SIKQHALQSTQQSVTNQILAVLEAKKRLHSNVNVQGLMEHLVLMLQEG"
FT   gene            41753..42580
FT                   /gene="yaaT"
FT                   /locus_tag="BSUW23_00165"
FT   CDS_pept        41753..42580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="BSUW23_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36091"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP1"
FT                   /protein_id="ADM36091.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFHIEQDSCVIVETVRGVEYGQVV
FT                   IANKQVDEHDVVLPLRKVIRVADERDLLIVEENKQEALSAFDICQKKVIEHGLDMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GEMITTANGPAKVVGLNILERVLQVELINREKVIEYTWEELLEEGVVSAQTTD"
FT   gene            42595..42954
FT                   /gene="yabA"
FT                   /locus_tag="BSUW23_00170"
FT   CDS_pept        42595..42954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BSUW23_00170"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36092"
FT                   /db_xref="GOA:E0TXP2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP2"
FT                   /protein_id="ADM36092.1"
FT                   /translation="MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLEN
FT                   KHLRKRLDDTTQQIEKFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSV
FT                   RKEDCLFCLSFLNKK"
FT   gene            43013..43756
FT                   /gene="yabB"
FT                   /locus_tag="BSUW23_00175"
FT   CDS_pept        43013..43756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="BSUW23_00175"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36093"
FT                   /db_xref="GOA:E0TXP3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP3"
FT                   /protein_id="ADM36093.1"
FT                   /translation="MVSLRDDERLDYLLAEDMKIIQSPTVFAFSLDAVLLSKFAYVPIQ
FT                   KGKIVDLCTGNGIVPLLLSTRSKADILGVEIQERLHDMAVRSVEYNKLQDQIQIIHDDL
FT                   KNMPEKLGHNRYDVVTCNPPYFKTPKQTEQNMNEHLRIARHEIHCTLEDVISVSSKLLK
FT                   QGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIKGGRPDLKI
FT                   LPPLFVYDEQNEYTKEIRTILYGDK"
FT   gene            43743..44042
FT                   /gene="yazA"
FT                   /locus_tag="BSUW23_00180"
FT   CDS_pept        43743..44042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BSUW23_00180"
FT                   /product="GIY-YIG nuclease superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36094"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP4"
FT                   /protein_id="ADM36094.1"
FT                   /translation="METNNHFFYVVQCRDNSWYAGYTNDLQKRVKTHNDGKGAKYTKVR
FT                   RPVELIFAEVFTTKREAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL"
FT   gene            44032..44895
FT                   /gene="yabC"
FT                   /locus_tag="BSUW23_00185"
FT   CDS_pept        44032..44895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="BSUW23_00185"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36095"
FT                   /db_xref="GOA:E0TXP5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP5"
FT                   /protein_id="ADM36095.1"
FT                   /translation="MSFNGKSDMGILYLVPTPIGNLEDMTFRAIDTLKSVDAIAAEDTR
FT                   QTKKLCHVYEIETPLVSYHEHNKESSGHKIIEWLKSGKNIALVSDAGLPTISDPGAEIV
FT                   KDFTEIGGYVVPLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKELEGLKKRKET
FT                   IILYEAPHRLKETLSVMAEILGDREIAVTRELTKKYEEFIRGTISEVIEWANEDQIRGE
FT                   FCLVIEGSNNEESDEETQWWEALTAKEHVEHYISKGATSKEAIKKAAVDRNVPKREVYD
FT                   AYHIQQ"
FT   gene            complement(44944..45228)
FT                   /gene="abrB"
FT                   /locus_tag="BSUW23_00190"
FT   CDS_pept        complement(44944..45228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BSUW23_00190"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36096"
FT                   /db_xref="GOA:E0TXP6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP6"
FT                   /protein_id="ADM36096.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK"
FT   gene            45729..47723
FT                   /gene="metS"
FT                   /locus_tag="BSUW23_00195"
FT   CDS_pept        45729..47723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BSUW23_00195"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36097"
FT                   /db_xref="GOA:E0TXP7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP7"
FT                   /protein_id="ADM36097.1"
FT                   /translation="MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFD
FT                   VRYLTGTDEHGQKIQQKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHK
FT                   VVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGH
FT                   PVELIKEESYFFRMGKYADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGVKVPENPKHVVYVWIDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLR
FT                   EVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQT
FT                   LTSVAEETVKAYEKAMENMEFSVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELHS
FT                   VMYHLAESLRISAVLLQPFLTKTPEKMFEQLGITDEALKAWDSITTFGQLKDTKVQKGE
FT                   PLFPRLEAEEEIAYIKGKMQGSAPAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVI
FT                   QAEPVKKADRLLKLQLDLGFEKRQVVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELS
FT                   QGMILAGEADGVLKVVSIDQSLPKGTRIK"
FT   gene            47802..48569
FT                   /gene="yabD"
FT                   /locus_tag="BSUW23_00200"
FT   CDS_pept        47802..48569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="BSUW23_00200"
FT                   /product="metal-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36098"
FT                   /db_xref="GOA:E0TXP8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP8"
FT                   /protein_id="ADM36098.1"
FT                   /translation="MLFDTHAHLNAEQYDTDLEEVIERAKAEKVERIVVVGFDRPTITR
FT                   AMEMIEEYDFIYAAIGWHPVDAIDMTEEDLAWIKELSAHEKVVAIGEMGLDYHWDKSPK
FT                   DIQKEVFRKQIALAKEVNLPIIIHNRDATEDVVTILKEEGAEAVGGIMHCFTGSAEVAR
FT                   ECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPNDRLLIETDCPFLTPHPFRGKRNEPSYV
FT                   KYVAEQIAELKGMTFEEIASVTTENAKRLFRIN"
FT   gene            48815..50038
FT                   /gene="yabE"
FT                   /locus_tag="BSUW23_00205"
FT   CDS_pept        48815..50038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BSUW23_00205"
FT                   /product="putative cell wall shaping enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36099"
FT                   /db_xref="GOA:E0TXP9"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXP9"
FT                   /protein_id="ADM36099.1"
FT                   /translation="MKKLFSVKLSKSKVILVAACLLLAGSGTAYAAHELTKQSVSVSIN
FT                   GKKKHIRTHAKTVGDLLETLDIETRDEDKITPAKQTKITADMDVVYEAAKPVKLTINGK
FT                   EKTLWSTAKTVGALLDEQDVDVKEQDQIDPAIDTDISKDMKIKIEPAFQVTVNDAGKQK
FT                   KIWTTSTTVADFLKQQKMNIKDEDKIKPALDAKLTKGKADITITRIEKVTDVVEEKIAF
FT                   DVKKQEDASLEKGKEKVVQKGKEGKLKKHFEVVKENGKEVSRELVKEETAEQSKDKVIA
FT                   VGTKQSSPKIEQVSASGDSKTVVSRSNESTGKVMTVSSTAYTASCSGCSGHTATGVNLK
FT                   NNPNAKVIAVDPNVIPLGSKVHVEGYGYAIAADTGSAIKGNKIDVFFPEKSSAYRWGNK
FT                   TVKIKILN"
FT   gene            50183..50743
FT                   /gene="rnmV"
FT                   /locus_tag="BSUW23_00210"
FT   CDS_pept        50183..50743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BSUW23_00210"
FT                   /product="ribonuclease M5"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36100"
FT                   /db_xref="GOA:E0TXQ0"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ0"
FT                   /protein_id="ADM36100.1"
FT                   /translation="MKIKEIIVVEGRDDTARIKLAVDADTIETNGSAIDDQVIDQIRLA
FT                   QKTRGVIILTDPDFPGEKIRKTISEAVPGCKQAFLPKHLAKPKNKRGIGVEHASIESIR
FT                   ACLENVHEEMEAQPSDISAEDLIHAGLIGGSAAKRRRERLGDLLKIGYTNGKQLQKRLQ
FT                   MFQIKKSDFMSALDTVKREEQNE"
FT   gene            50736..51614
FT                   /gene="ksgA"
FT                   /locus_tag="BSUW23_00215"
FT   CDS_pept        50736..51614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BSUW23_00215"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36101"
FT                   /db_xref="GOA:E0TXQ1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ1"
FT                   /protein_id="ADM36101.1"
FT                   /translation="MNKDIATPIRTKEILKKYCFSFKKSLGQNFLIDTNILDRIVDHAE
FT                   VTEKTGVIEIGPGIGALTEQIAKRAKKVVAFEIDQRLLPILKDTLSPYDNVTVIHQDVL
FT                   KADVKSVIEEQFQDCDEIMVVANLPYYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMA
FT                   ADPSSKEYGSLSIAVQFYTEAKTVMTVPKTVFVPQPNVDSAVIRLILRDGPAVDVENEA
FT                   FFFQLIKASFAQRRKTLLNNLVNNLPEGKAQKSTIEQVLEKTNIDGKRRGESLSIEEFA
FT                   ALSNGLYKALF"
FT   gene            51776..52648
FT                   /gene="yabG"
FT                   /locus_tag="BSUW23_00220"
FT   CDS_pept        51776..52648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="BSUW23_00220"
FT                   /product="sporulation-specific protease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36102"
FT                   /db_xref="GOA:E0TXQ2"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ2"
FT                   /protein_id="ADM36102.1"
FT                   /translation="MQFQIGDMVARKSYQMDVLFRIIGIEQTSKGNSIAILHGDEVRLI
FT                   ADSDFSDLVAVKKDEQMMRKKKDESRMNESLELLRQDYKLLREKQEYYATSQYQHEEHY
FT                   FHMPGKVLHLDGDEAYLKKCLNVYKKIGVPVYGIHCHEKKMSASIEELLDKYRPDILVI
FT                   TGHDAYSKQKGSIDDLNAYRHSKHFVETVQNARKKTPHLDQLVIFAGACQSHFESLIRA
FT                   GANFASSPSRVNIHALDPVYIVAKISFTPFMERINVWEVLRNTLTREKGLGGIETRGVL
FT                   RIGMPYKSN"
FT   gene            52859..53119
FT                   /gene="veg"
FT                   /locus_tag="BSUW23_00225"
FT   CDS_pept        52859..53119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BSUW23_00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36103"
FT                   /db_xref="GOA:E0TXQ3"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ3"
FT                   /protein_id="ADM36103.1"
FT                   /translation="MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSV
FT                   FVIQLDQDENSFERVSYSYADILTETVELTFNDDAASSVAF"
FT   gene            53278..53463
FT                   /gene="sspF"
FT                   /locus_tag="BSUW23_00230"
FT   CDS_pept        53278..53463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BSUW23_00230"
FT                   /product="small acid-soluble spore protein (alpha/beta-type
FT                   SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36104"
FT                   /db_xref="GOA:E0TXQ4"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ4"
FT                   /protein_id="ADM36104.1"
FT                   /translation="MGRRRGVMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKR
FT                   AIEIAEQQMAQNQNNR"
FT   gene            53611..54480
FT                   /gene="ispE"
FT                   /locus_tag="BSUW23_00235"
FT   CDS_pept        53611..54480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BSUW23_00235"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36105"
FT                   /db_xref="GOA:E0TXQ5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ5"
FT                   /protein_id="ADM36105.1"
FT                   /translation="MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTE
FT                   LAEDEVRVSSHNRFVPDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSS
FT                   DAAATLRGLNRLWNLNLSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPH
FT                   CWVILAKPTIGVSTAEVYRQLKVDDVEHPDVHGMIEAIEEKSFQKMCSRLGNVLESVTL
FT                   DMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNALD"
FT   gene            54536..55393
FT                   /gene="purR"
FT                   /locus_tag="BSUW23_00240"
FT   CDS_pept        54536..55393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BSUW23_00240"
FT                   /product="pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36106"
FT                   /db_xref="GOA:E0TXQ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ6"
FT                   /protein_id="ADM36106.1"
FT                   /translation="MKFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLT
FT                   IIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVY
FT                   LTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDN
FT                   KVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEF
FT                   NANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDNLLKNG
FT                   ETES"
FT   gene            55390..55767
FT                   /gene="yabJ"
FT                   /locus_tag="BSUW23_00245"
FT   CDS_pept        55390..55767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="BSUW23_00245"
FT                   /product="putative enzyme resulting in alteration of gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36107"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ7"
FT                   /protein_id="ADM36107.1"
FT                   /translation="MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGD
FT                   IKEQTHQVFSNLKAVLEEAGASLETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
FT   gene            55963..56256
FT                   /gene="spoVG"
FT                   /locus_tag="BSUW23_00250"
FT   CDS_pept        55963..56256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BSUW23_00250"
FT                   /product="regulator required for spore cortex synthesis
FT                   (stage V sporulation)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36108"
FT                   /db_xref="GOA:E0TXQ8"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:E0TXQ8"
FT                   /protein_id="ADM36108.1"
FT                   /translation="MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSSTRGKIQDAVLNEYHRLGDTEALEFEEAGAS"
FT   gene            complement(56253..56375)
FT                   /locus_tag="BSUW23_00255"
FT   CDS_pept        complement(56253..56375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_00255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36109"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYH8"
FT                   /protein_id="ADM36109.1"
FT                   /translation="MKCKNFLLSTIKFEKSELKKDRRQKAFVSPFSSPCFLVIF"
FT   gene            56449..57819
FT                   /gene="gcaD"
FT                   /locus_tag="BSUW23_00260"
FT   CDS_pept        56449..57819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BSUW23_00260"
FT                   /product="bifunctional N-acetylglucosamine-1-phosphate
FT                   uridyltransferase/glucosamine-1-phosphate
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36110"
FT                   /db_xref="GOA:E0TYH9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYH9"
FT                   /protein_id="ADM36110.1"
FT                   /translation="MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEALKLS
FT                   LSKLVTIVGHGAEEVKKQLGDKSEYALQAEQLGTAHAVKQAQPFLADEKGVTIVICGDT
FT                   PLLTAETMEQMLKEHTQREAKATILTAVAEDPTGYGRIIRGENGAVQKIVEHKDASEEE
FT                   RLVTEINTGTYCFDNEALFRAIDLVSNDNAQGEYYLPDVIEILKNEGETVAAYQTDNFQ
FT                   ETLGVNDRVALSQAEQFMKERINKRHMQNGVTLIDPMNTYISPDAVIGSDTVIYPGTVI
FT                   KGEVQIGEDTIIGPHTEIMNSSIGSRTVIKQSVVNHSKVGNDVNIGPFAHIRPDSVIGN
FT                   EVKIGNFVEIKKTQFGDRSKASHLSYVGDAEVGTDVNLGCGSITVNYDGKNKYLTKIED
FT                   GAFIGCNSNLVAPVTVGEGAYVAAGSTVTEDVPGKALAIARARQVNKDDYVKNIHKK"
FT   gene            57842..58795
FT                   /gene="prs"
FT                   /locus_tag="BSUW23_00265"
FT   CDS_pept        57842..58795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BSUW23_00265"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36111"
FT                   /db_xref="GOA:E0TYI0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI0"
FT                   /protein_id="ADM36111.1"
FT                   /translation="MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGE
FT                   VQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEG
FT                   KNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKL
FT                   PEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS"
FT   gene            58880..59497
FT                   /gene="ctc"
FT                   /locus_tag="BSUW23_00270"
FT   CDS_pept        58880..59497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BSUW23_00270"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36112"
FT                   /db_xref="GOA:E0TYI1"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI1"
FT                   /protein_id="ADM36112.1"
FT                   /translation="MATLTAKERTDFTRSSLRNIRTSGHVPGIIYGKDTGNKPVSLDSV
FT                   ELIKTLRDEGKNTVITLDVSGEKHSVMVTDLQTDPLKNEITHADFQVVNMSEDIEVEVP
FT                   IHLTGEAIGVKNGGVLQQPLYALTVKAKPKAIPQTIEADISNLDVNEVLTIADLPAGGD
FT                   YSFNHESDEVVASILPPQQQETAEIDEEESADAQPEGENKEQ"
FT   gene            59604..60170
FT                   /gene="pth"
FT                   /locus_tag="BSUW23_00275"
FT   CDS_pept        59604..60170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BSUW23_00275"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36113"
FT                   /db_xref="GOA:E0TYI2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI2"
FT                   /protein_id="ADM36113.1"
FT                   /translation="MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGL
FT                   YGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNGDLTVIYDDLDLPTGKIRLRT
FT                   KGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFNKEEVPDIDGAID
FT                   KSVKACEASLSKPFLEVMNEFNAKV"
FT   gene            60230..60460
FT                   /gene="yabK"
FT                   /locus_tag="BSUW23_00280"
FT   CDS_pept        60230..60460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="BSUW23_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36114"
FT                   /db_xref="GOA:E0TYI3"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI3"
FT                   /protein_id="ADM36114.1"
FT                   /translation="MALHYYCRHCGVKVGSLESSLVSTDSLGFQHLTNEERNDMISYKE
FT                   NGDVHVSTICEDCQEALDRNPHYHEHHTFIQ"
FT   gene            60530..64063
FT                   /gene="mfd"
FT                   /locus_tag="BSUW23_00285"
FT   CDS_pept        60530..64063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BSUW23_00285"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36115"
FT                   /db_xref="GOA:E0TYI4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI4"
FT                   /protein_id="ADM36115.1"
FT                   /translation="MDNIQTFIKESDDFKSIINGLHEGLKEQLLAGLSGSARSVFTSAL
FT                   ANETNKPIFLITHNLYQAQKVTDDLTSLLEDRSVLLYPVNELISSEIAVASPELRAQRL
FT                   DVINRLTNGEAPIVVAPVAALRRMLPPVEVWKNSQMLIQVGHDIEPDQLASRLVEVGYE
FT                   RSDMVSAPGEFSIRGGIVDIYPLTSEHPVRIELFDTEVDSIRSFNSDDQRSIETLTSIN
FT                   IGPAKELIIRPEEKVRAMEKIDKGLAASLKKLKVDKQKEILHANISYDKERLSEGQTDQ
FT                   ELVKYLSYFYEKPASLLDYTPENTLLILDEVSRIHEMEEQLQKEEAEFITNLLEEGKIL
FT                   HDISLSFSFQKIVAEQKRPLLYYSLFLRHVHHTSPQNIVNVSSRQMQSFHGQMNVLAGE
FT                   MERFKKSNFTVVFLGTNKERTQRLSSVLADYEIEAAMTDSKKALVQGQVYIMEGELQSG
FT                   FELPLMKLAVITEEELFKNRVKKKPRKQKLTNAERIKSYSELQIGDYVVHINHGIGKYL
FT                   GIETLEINGIHKDYLNIHYQGSDKLYVPVEQIDQVQKYVGSEGKEPKLYKLGGSEWKRV
FT                   KKKVETSVQDIADDLIKLYAEREASKGYAFSPDHEMQREFESAFPYQETEDQLRSIHEI
FT                   KKDMERERPMDRLLCGDVGYGKTEVAIRAAFKAIGDGKQVALLVPTTILAQQHYETITE
FT                   RFQDYPINIGLLSRFRTRKEANETIKGLKNGTVDIVIGTHRLLSKDVVYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQIKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNGALVREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDAKVAYAHGKMTEN
FT                   ELETVMLNFLEGESDVLVSTTIIETGVDIPNVNTLIVFDADKMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRRDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLLGAQQHGF
FT                   IDSVGFDLYSQMLKEAIEERKGDTAKTVQFETEIDVELDAYIPETYIQDGKQKIDMYKR
FT                   FRSVATIEEKNELQDEMIDRFGNYPKEVEYLFTVAEMKVYAKHERVELIKQDKDAVRLT
FT                   ISEEASAEIDGQKLFELGNKYGRQIGLGMEGKKLKISIQTKGRSANEWLETVLGMLKGL
FT                   KGVKKQTISST"
FT   gene            64199..64735
FT                   /gene="spoVT"
FT                   /locus_tag="BSUW23_00290"
FT   CDS_pept        64199..64735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BSUW23_00290"
FT                   /product="transcriptional regulator for sigma-G-dependent
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36116"
FT                   /db_xref="GOA:E0TYI5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI5"
FT                   /protein_id="ADM36116.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLER
FT                   TMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHK
FT                   AVETAAGFLARQMEQ"
FT   gene            64917..66515
FT                   /gene="yabM"
FT                   /locus_tag="BSUW23_00295"
FT   CDS_pept        64917..66515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabM"
FT                   /locus_tag="BSUW23_00295"
FT                   /product="putative exporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36117"
FT                   /db_xref="GOA:E0TYI6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI6"
FT                   /protein_id="ADM36117.1"
FT                   /translation="MDDSIGVKRHWIWQGAFVLILAGVISKILSAVYRVPFQNIVGDVG
FT                   FYIYQQVYPFLGIAVMLSTSGFPVIISKLMNDYSEKSHHTILKISALFLSIIGVLLFLC
FT                   LYMGAVPIALFMGDSHLAVLIQVTAFAFLLFPLVALLRGGFQGRQDMLPSALSQMTEQF
FT                   LRVVVLLGLSFWLVKQGASLYTAGAAAASGSLAGSFVALIILGFFWFKAKRDTQTDRQK
FT                   ENVITTKELTKKLLLYSVTICVSSLLILFIQLVDALNLYALLSDGEASEEAKRLKGIYD
FT                   RGQPLLQLGSVFAVSIATSLVPYISKAVKNKELKIMKEKVTSSLKLCLVLGTGASAGLI
FT                   CILEPVNIMLFQNGEGTAALQVFSCSILFASLAVTAAAVLQGAGYTVFPAIAVGAGVAV
FT                   KWVLNTLLVPRYGIEGASLATAVSFAVVAGLNLFQLRQKEWLDKLKGILIPLIGSALLM
FT                   SAVLLAYMRLWTFLIPAAGRGVAVIESLSAVAIGGAVFIYCMMKLGIFTDEELNSVPFG
FT                   SKLSKIIRRREQNGG"
FT   gene            66505..67974
FT                   /gene="yabN"
FT                   /locus_tag="BSUW23_00300"
FT   CDS_pept        66505..67974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BSUW23_00300"
FT                   /product="putative fusion methylase and nucleotide
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36118"
FT                   /db_xref="GOA:E0TYI7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI7"
FT                   /protein_id="ADM36118.1"
FT                   /translation="MAGNITVVGLGAGDMDQLTIGIHRLLTKADTLYVRTKDHPLIQEL
FT                   EKETKNIRFFDDIYEKHDQFDAVYEEIADILFEEAQREDVVYAVPGHPFVAEKTVQLLT
FT                   ERQEGENVQVKVAGGQSFLDATFNALQIDPIEGFQFVDAGTLSADELEFKHHLIICQVY
FT                   DQMTASEVKLTLMEKLPDDYEVVIVTAAGSRDEKIQTVPLFELDRNVALNNLTSVYIPP
FT                   IKEEKLLYHEFPVFRSIIRELRGPNGCPWDKKQTHQSLKQYMIEECYELLEAIDEEDTD
FT                   HMIEELGDVLLQVLLHAQIGEDEGYFTIDDVIKGISEKMVRRHPHVFKDVKVQDENDVL
FT                   ANWEDIKKAEKNTSEASLLDSVPKTLPALSKAATLQKKAAKVGFDWEDVSDIWEKVSEE
FT                   MKEFSSEVSEDPHEQNLKAEFGDILFALVNVARFYKIEPEEALAMTNDKFRRRFSYIEE
FT                   TAKGKGIELSNMSLEDMDKLWNEAKETERRS"
FT   gene            67977..68237
FT                   /gene="yabO"
FT                   /locus_tag="BSUW23_00305"
FT   CDS_pept        67977..68237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="BSUW23_00305"
FT                   /product="putative ribosomal RNA binding protein; heat
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36119"
FT                   /db_xref="GOA:E0TYI8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI8"
FT                   /protein_id="ADM36119.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRIAINGNQAKASSDVKPGD
FT                   ELTVRFGQKLVTVQVNELKDTTKKEEAANMYTILKEEKLGE"
FT   gene            68316..68618
FT                   /gene="yabP"
FT                   /locus_tag="BSUW23_00310"
FT   CDS_pept        68316..68618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BSUW23_00310"
FT                   /product="spore protein involved in the shaping of the
FT                   spore coat"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36120"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYI9"
FT                   /protein_id="ADM36120.1"
FT                   /translation="MNSYYDQNGSSSVPEQHDVTMKGRKHLDISGVKQVESFDNEEFLL
FT                   ETVMGMLSVRGQNLQMKNLDVEKGIVSIKGRVFDLVYLDEQQGDKAKGFFSKLFK"
FT   gene            68615..69250
FT                   /gene="yabQ"
FT                   /locus_tag="BSUW23_00315"
FT   CDS_pept        68615..69250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="BSUW23_00315"
FT                   /product="membrane protein of the forespore"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36121"
FT                   /db_xref="GOA:E0TYJ0"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ0"
FT                   /protein_id="ADM36121.1"
FT                   /translation="MTLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAKTARWLLFIHD
FT                   ILFWIVQGLLFFYVLLHVNEGEFRLYIFLAVLLGVATYQSLCKRIYIKILKFVIYLVVS
FT                   VYQFFKKLIQHVLFRPVVWTCGAIIWLAAFLLKKIYRLIVFLLSCLYKIVMVLCFPIRF
FT                   IAKQCLKLLPVKMRLTFRRYFEKGAGFLKKKKKLLVTIRTTITRFLKR"
FT   gene            69268..69645
FT                   /gene="divIC"
FT                   /locus_tag="BSUW23_00320"
FT   CDS_pept        69268..69645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BSUW23_00320"
FT                   /product="cell-division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36122"
FT                   /db_xref="GOA:E0TYJ1"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ1"
FT                   /protein_id="ADM36122.1"
FT                   /translation="MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALV
FT                   FLTAIVLASSVWSQTSSLSAKEEKKVQLEKELKSLKTKQADLKEEISKLKDEDYVTELA
FT                   RRDLFMSGDGEIIFNVEKKSK"
FT   gene            69726..70112
FT                   /gene="yabR"
FT                   /locus_tag="BSUW23_00325"
FT   CDS_pept        69726..70112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BSUW23_00325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36123"
FT                   /db_xref="GOA:E0TYJ2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ2"
FT                   /protein_id="ADM36123.1"
FT                   /translation="MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLKD
FT                   SEDRLSSLKRNTESKRGGRGARRG"
FT   gene            70281..70357
FT                   /locus_tag="BSUW23_t20472"
FT                   /note="trnSL-Met1"
FT   tRNA            70281..70357
FT                   /locus_tag="BSUW23_t20472"
FT                   /product="tRNA-Met"
FT   gene            70367..70438
FT                   /locus_tag="BSUW23_t20474"
FT                   /note="trnSL-Glu1"
FT   tRNA            70367..70438
FT                   /locus_tag="BSUW23_t20474"
FT                   /product="tRNA-Glu"
FT   gene            70638..73121
FT                   /gene="spoIIE"
FT                   /locus_tag="BSUW23_00330"
FT   CDS_pept        70638..73121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BSUW23_00330"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36124"
FT                   /db_xref="GOA:E0TYJ3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ3"
FT                   /protein_id="ADM36124.1"
FT                   /translation="MEKAERRVNGPMTGQALEKLQSFFNRGTKLVTHHLHSLFFYKGFI
FT                   YVVIGFLLGRAFILSEVLPFALPFFGAMLLIRRDKALYAVLAVLTGALTISPKHSLLIL
FT                   AALLAFFVFSKVAAFITDDRVKALPIVVFFSMAAARAGFVYAQNGAFTTYDYVMAVVEA
FT                   GLSFILTLIFLQSLPVFTVKKVKQSLKIEEIICFMILIASVLTGLAGLSYQGMQAEHIL
FT                   ARYVVLSFSFIGGASIGCTVGVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAG
FT                   AAIGLIVGSLLISLYGEGSAGLMTTLYESLIAVGLFLLTPQSITKKVARYIPGTVEHLQ
FT                   EQQQYARKIRDVTAQKVDQFSNVFHALSESFATFYQASDEQTDDSEVDLFLSKITEHSC
FT                   QTCYKKNRCWVQNFDKTYDLMKQVMLETEEKEYASNRRLKKEFHQHCSKSKQVEELIED
FT                   ELAHHHAHLTLKKKVQDSRRLVAEQLLGVSEVMADFSREIKREREQHFLQEEQIIEALQ
FT                   HFGIEIQHVEIYSLEQGNIDIEMTIPFSGHGESEKIIAPMLSDILEEQILVKAEQHSPH
FT                   PNGYSHVAFGSTKSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGMGNGAR
FT                   AHFESNETIKLLEKILESGIDEKIAIKTINSILSLRTTDEIYSTLDLSIIDLQDASCKF
FT                   LKVGSTPSFIKRGDQVMKVQASNLPIGIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPK
FT                   HVENHDLWMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWA
FT                   SIPVPAIFQNKQEIS"
FT   gene            73206..73943
FT                   /gene="yabS"
FT                   /locus_tag="BSUW23_00335"
FT   CDS_pept        73206..73943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BSUW23_00335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36125"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ4"
FT                   /protein_id="ADM36125.1"
FT                   /translation="MNNGHLNQILLITDGCSNHGEDPLAMAAFAKEQGITVNVIGIMEE
FT                   NQIDPEAMKEVEGIALAGGGVHQVVYASQLSQTVQMVTKKAMTQTLQGVVNQELKQILG
FT                   KNVEMEELSPEKRGEVMEVVDELGETVHLQVLVLVDTSASMAPKLPTVKEALIDLSVSL
FT                   NSRIGNNEFAMCIFPGKKQEVELVLNWTPKLQSLSTLFAKLSTGGITPTGPAIREATQQ
FT                   FEKIRSRRSMLADDERRFDEFGI"
FT   gene            73909..74925
FT                   /gene="yabT"
FT                   /locus_tag="BSUW23_00340"
FT   CDS_pept        73909..74925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="BSUW23_00340"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36126"
FT                   /db_xref="GOA:E0TYJ5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ5"
FT                   /protein_id="ADM36126.1"
FT                   /translation="MMNDALTSLAYNLKPGTTIKGKWNGNTYTLRKQLGKGANGIVYLA
FT                   EASDGHVALKVSDDSLSITSEVNVLKSFSKAQSVTMGPSFFDTDDAYIPSANMKVSFYA
FT                   MEYIKGPLLLNYVSDKGAEWIPVLMIQLLSSLSLLHQQGWIFGDLKPDNLIVTGPPARI
FT                   RCIDVGGTTKEGRAIKEYTEFYDRGYWGYGTRKAEPSYDLFAVAMIMINSVHKKEFKKT
FT                   NQPKEQLRSLIEGHPLLKKYKKVLFSALNGDYQTADEMKKDMLDAGQKAVQRKQAVKAS
FT                   PQPVRRQRQQKPRQGKVTQTRYTPKQKPVKSGGLFETTLIVISVLALYFAYIIFFLI"
FT   gene            75029..76447
FT                   /gene="tilS"
FT                   /locus_tag="BSUW23_00345"
FT   CDS_pept        75029..76447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BSUW23_00345"
FT                   /product="tRNAile lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36127"
FT                   /db_xref="GOA:E0TYJ6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ6"
FT                   /protein_id="ADM36127.1"
FT                   /translation="MKSVKDFFNKHNLTLKGATIIVGVSGGPDSMALLHALHTLCGRSA
FT                   NIIAAHVDHRFRGAESEEDMRFVQAYCKAEQLACETAQINVTAYAREKGLNKQAAARDC
FT                   RYQFFEDIMLKHQADYLALAHHGDDQVETMLMKLAKGALGAGLAGMQPARRFGTGRIIR
FT                   PFLTITKEEILHYCRENSLSYRTDESNATDDYTRNRFRKTVLPFLKQESPDVHKRFQKV
FT                   SEALTEDEQFLQSLTKDEMNKVITSQSNTSVEINSSQLLALPMPLQRRGVQLILNYLYE
FT                   NVPSSFSAHHIQQFLDWAEKGGPSGVLDFPKGLKVVKSYQTCLFTFEQWQCKNVPFEYQ
FT                   ISGDANETAVLPNGFLIEAKHCADSPEEHGNAVFITSEKKVRFPLTIRTRKAGDRIKLK
FT                   GMNGSKKVKDIFIDKKLPLRERDNWPIVTDASGEIIWIPGLKKSIFEDLVIPNSDRIVL
FT                   QYRQHEKCRGQAKS"
FT   gene            76444..76986
FT                   /gene="hprT"
FT                   /locus_tag="BSUW23_00350"
FT   CDS_pept        76444..76986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BSUW23_00350"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36128"
FT                   /db_xref="GOA:E0TYJ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ7"
FT                   /protein_id="ADM36128.1"
FT                   /translation="MMKHDIEKVLISEEEIQEKVKELGTELTSEYQDTFPLAIGVLKGA
FT                   LPFMADLIKHIDTYLEMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDS
FT                   GLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAER
FT                   YRNLPYIGVLKPAVYES"
FT   gene            77084..78997
FT                   /gene="ftsH"
FT                   /locus_tag="BSUW23_00355"
FT   CDS_pept        77084..78997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BSUW23_00355"
FT                   /product="cell-division protein and general stress protein
FT                   (class III heat-shock)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36129"
FT                   /db_xref="GOA:E0TYJ8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ8"
FT                   /protein_id="ADM36129.1"
FT                   /translation="MNRVFRNTIFYLLILLVVIGVVSYFQTSNPKTENMSYSTFIKNLD
FT                   DGKVDSVSVQPVRGVYEVKGQLKNYDKDQYFLSHVPEGKGADQIFNALKKTDVKVEPAQ
FT                   ETSGWVTFLTTIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREAVL
FT                   KVHARNKPLDETVNLKSIAMRTPGFSGADLENLLNEAALVAARQNKKKIDARDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEGGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVML
FT                   PREDRYFQTKPELLDKIVGLLGGRVAEEIIFGEVSTGAHNDFQRATNIARRMVTEFGMS
FT                   EKLGPLQFGQSQGGQVFLGRDFNNEQNYSDQIAYEIDQEIQRIIKECYERAKQILTENR
FT                   DKLELIAQTLLKVETLDAEQIKHLVDHGTLPERNFSDDEKNDDVKVNILTKTEEKKDDT
FT                   KE"
FT   gene            79190..79966
FT                   /gene="coaX"
FT                   /locus_tag="BSUW23_00360"
FT   CDS_pept        79190..79966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BSUW23_00360"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36130"
FT                   /db_xref="GOA:E0TYJ9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYJ9"
FT                   /protein_id="ADM36130.1"
FT                   /translation="MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRS
FT                   LFEHSGLMFEQIDGIIISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEITRPDNIIGKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQEPKVIATGG
FT                   LAPLIANESDCIDIVDPFLTLKGLELIYERNRVGSV"
FT   gene            79978..80853
FT                   /gene="hslO"
FT                   /locus_tag="BSUW23_00365"
FT   CDS_pept        79978..80853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BSUW23_00365"
FT                   /product="Hsp33-like chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36131"
FT                   /db_xref="GOA:E0TYK0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK0"
FT                   /protein_id="ADM36131.1"
FT                   /translation="MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRT
FT                   MTASLMLGAMLKGDDKLTVKVEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKL
FT                   DVRRAVGTSGTLSVVKDLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLV
FT                   NPDNTILAAGGFIIQLMPGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEK
FT                   PEILETMPVKFHCSCSKERFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEE
FT                   LEGLRDQTTR"
FT   gene            80903..81796
FT                   /gene="yacD"
FT                   /locus_tag="BSUW23_00370"
FT   CDS_pept        80903..81796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BSUW23_00370"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36132"
FT                   /db_xref="GOA:E0TYK1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK1"
FT                   /protein_id="ADM36132.1"
FT                   /translation="MKSRTIWTIILGALLVCCISVAYTLTKSQAGASPSGESIATIGGK
FT                   SVTREEWLKEMEDRYGKSTLEDMINVRVVEQLAKKNNLKVSNNEIDREFLLVKAVNNSF
FT                   YEDEHTTEKEWKDQIRYNILLEELLTRDIDISNKELKSFYNKNKELYQFDDSYRIRHIV
FT                   VKDEEEAREVLKELKGGSSFEAVAAERSTDRYTSPYGGDLGFVTEASDNIPSAYIEEAQ
FT                   TLKEDEWSDEPIKVSNGYAVIQLKEKLKARTFSYDEVKDQIRRQIAMDQLGDKATVKTL
FT                   WKEADVSWFYGEKSTK"
FT   gene            81872..82798
FT                   /gene="cysK"
FT                   /locus_tag="BSUW23_00375"
FT   CDS_pept        81872..82798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BSUW23_00375"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36133"
FT                   /db_xref="GOA:E0TYK2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK2"
FT                   /protein_id="ADM36133.1"
FT                   /translation="MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVK
FT                   DRIGLAMIEAAEKEGKLKAGDTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIV
FT                   EQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQ
FT                   GIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKK
FT                   LGKGKKVLAIIPSNGERYLSTPLYQFD"
FT   gene            82963..84372
FT                   /gene="pabB"
FT                   /locus_tag="BSUW23_00380"
FT   CDS_pept        82963..84372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BSUW23_00380"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36134"
FT                   /db_xref="GOA:E0TYK3"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK3"
FT                   /protein_id="ADM36134.1"
FT                   /translation="MAQRRPAGKKVPFQKDSFLKQFEKLSQSRKQHVLLESARGGRYSI
FT                   AGLDPIATVKGKDGITTIKHGDEMLFKEGDPLRAFHSWFKTLETETDHELPDFQGGAIG
FT                   FLSYDYARYIENFKMLSLDDLETPDIYFLVFDDIAVYDHQEESLWLITHVNGTDNSADV
FT                   KLSELERMWLTELPAVPSREMKRETDGSFAAPFTEDGFSQAVEKIKQYIASGDVFQVNL
FT                   SIRQSQSLSVHPYQIYKTLREVNPSPYMAYLETPDFQIICGSPELLVSKKGKLLETRPI
FT                   AGTRSRGKTDEEDESLANELIHNEKERAEHVMLVDLERNDLGRVSRYGSVRVNEFMAIE
FT                   KYSHVMHIVSNVQGELQDGYDAVDIIHAVFPGGTITGAPKVRTMEIIEELEPTRRGLYT
FT                   GSIGWFGYNHDLQFNIVIRTIYATGGQAFMQSGAGVVIDSVPKHEYRESFKKAFAMQKA
FT                   LELSKEETKIR"
FT   gene            84386..84970
FT                   /gene="pabA"
FT                   /locus_tag="BSUW23_00385"
FT   CDS_pept        84386..84970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BSUW23_00385"
FT                   /product="para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36135"
FT                   /db_xref="GOA:E0TYK4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK4"
FT                   /protein_id="ADM36135.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELIVRRNDDITIEEIEELSPD
FT                   FLMISPGPCSPDEAGISLEAIKHFAGEIPIFGVCLGHQSIAQVFGGDVIRAERLMHGKT
FT                   SDIEHDGKTIFEGLKNPLVATRYHSLIVKSETLPSCFTVTAQTKEGEIMAIRHNDLPIE
FT                   GVQFHPESIMTSFGKEMLRNFIETYRKEVIA"
FT   gene            84970..85851
FT                   /gene="pabC"
FT                   /locus_tag="BSUW23_00390"
FT   CDS_pept        84970..85851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BSUW23_00390"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36136"
FT                   /db_xref="GOA:E0TYK5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK5"
FT                   /protein_id="ADM36136.1"
FT                   /translation="MIYVNGRYIEEKDEVLSPFDHGFLYGIGVFETFRLYEGYPFLLDW
FT                   HIERLERALKDLQIEYTVSKHEILEMLDKLLRLNKIKDGNARVRLDISAGISDKGFVAQ
FT                   TYDKPTVLCYVNQLEPESLPLQKEGKVLSIRRNTPEGAFRLKSHHYLNNMYAKREIGND
FT                   PRVEGIFLTEDGAVAEGIISNVFWRKGSCIYTPSLDTGILDGITRRFVMENAKKIGLEL
FT                   KTGRYELEALLTADEAWMTNSVLEIIPFTKIEEVNYAGQRGEAASALQTLYKKEIKNMI
FT                   HEKGGREWRSKR"
FT   gene            85833..86690
FT                   /gene="sul"
FT                   /locus_tag="BSUW23_00395"
FT   CDS_pept        85833..86690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="BSUW23_00395"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36137"
FT                   /db_xref="GOA:E0TYK6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK6"
FT                   /protein_id="ADM36137.1"
FT                   /translation="MAQQTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYD
FT                   SLDKALLHAKEMIDDGAHIIDIGGESTRPGAEYVSEDEEMSRVIPVIERITKELGVPIS
FT                   VDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLP
FT                   DMLSDLMESVKIAVEAGVEERNIILDPGIGFAKTYHDNLAVMNKLEILSGLGYPVLLAT
FT                   SRKRFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGG
FT                   VHHG"
FT   gene            86683..87045
FT                   /gene="folB"
FT                   /locus_tag="BSUW23_00400"
FT   CDS_pept        86683..87045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BSUW23_00400"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36138"
FT                   /db_xref="GOA:E0TYK7"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK7"
FT                   /protein_id="ADM36138.1"
FT                   /translation="MDKVFVEGMEFYGYHGVFKEENKLGQRFKVDLITELDLSKAGQTD
FT                   DLEQTINYAELYHVCKDIVEGEPVKLVETLAERIADTVLKKFQPVQQCTVKVIKPDPPI
FT                   PGHYKSVAIEITRKKS"
FT   gene            87042..87545
FT                   /gene="folK"
FT                   /locus_tag="BSUW23_00405"
FT   CDS_pept        87042..87545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BSUW23_00405"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36139"
FT                   /db_xref="GOA:E0TYK8"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK8"
FT                   /protein_id="ADM36139.1"
FT                   /translation="MNNIAYIALGSNIGDRETYLRQAVTLLHQHDAVTVTKVSSIYETD
FT                   PVGYEDQDEFLNMAVEIKTALNPFELLELTQHIENELGRTREVRWGPRTADLDILLFNR
FT                   ENIETEQLIVPHPRMYERLFVLAPLAEICPQVEKEATSAETDQEGVRVWKQKSGVDEFV
FT                   HSES"
FT   gene            87497..87715
FT                   /gene="yazB"
FT                   /locus_tag="BSUW23_00410"
FT   CDS_pept        87497..87715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazB"
FT                   /locus_tag="BSUW23_00410"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36140"
FT                   /db_xref="GOA:E0TYK9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYK9"
FT                   /protein_id="ADM36140.1"
FT                   /translation="MEAEIWGRRIRAFRKLKGYTQEGFAKALGISVSILGEIERGNRLP
FT                   SAAIIQGAADVLNISADELAPPEKDNE"
FT   gene            87729..88730
FT                   /gene="dusB"
FT                   /locus_tag="BSUW23_00415"
FT   CDS_pept        87729..88730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="BSUW23_00415"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36141"
FT                   /db_xref="GOA:E0TYL0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL0"
FT                   /protein_id="ADM36141.1"
FT                   /translation="MFKIGDIQLKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILYNNARTMGMLYIDEREKPLSLQIFGGKKETLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPDKIYEMVSAVVDAVDKPVTVKMRMGWDEDHIFAVENAKAVERA
FT                   GGKAVALHGRTRVQMYEGTANWDIIKDVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDG
FT                   VMIGRAALGNPWMIYRTVQYLETGELKEEPQVREKMAVCKLHLDRLINLKGENVAVREM
FT                   RKHAAWYLKGVRGNANVRNEINHCETREEFVQLLDAFTVEVEAKELQNAKVG"
FT   gene            88822..90321
FT                   /gene="lysS"
FT                   /locus_tag="BSUW23_00420"
FT   CDS_pept        88822..90321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BSUW23_00420"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36142"
FT                   /db_xref="GOA:E0TYL1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL1"
FT                   /protein_id="ADM36142.1"
FT                   /translation="MSQEEHNHEELNDQLQVRRDKMNQLRDNGIDPFGARFERTHQSQE
FT                   VISAYQDLTKEELEEKAIEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGDD
FT                   QYEIFKSSDLGDLIGVTGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRY
FT                   RQRYLDLIVNPDSKHTFIARSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITH
FT                   HNALDIPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMSLTENLVAHIAQEVLGTTTIQYGEEQIDLKPEWKRIHMVDAVKEATGVDFWEE
FT                   VTVEQAREYAKEHGIEIKDSMTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREAGNDEAHLMDEDFVE
FT                   ALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPQMRQR"
FT   gene            90696..92254
FT                   /locus_tag="BSUW23_r20636"
FT                   /note="rrnJ-16S"
FT   rRNA            90696..92254
FT                   /locus_tag="BSUW23_r20636"
FT                   /product="16S ribosomal RNA"
FT   gene            92416..95342
FT                   /locus_tag="BSUW23_r20652"
FT                   /note="rrnJ-23S"
FT   rRNA            92416..95342
FT                   /locus_tag="BSUW23_r20652"
FT                   /product="23S ribosomal RNA"
FT   gene            95400..95515
FT                   /locus_tag="BSUW23_r20620"
FT                   /note="rrnJ-5S"
FT   rRNA            95400..95515
FT                   /locus_tag="BSUW23_r20620"
FT                   /product="5S ribosomal RNA"
FT   gene            95761..96225
FT                   /gene="ctsR"
FT                   /locus_tag="BSUW23_00425"
FT   CDS_pept        95761..96225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BSUW23_00425"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36143"
FT                   /db_xref="GOA:E0TYL2"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL2"
FT                   /protein_id="ADM36143.1"
FT                   /translation="MGHNISDIIEQYLKRVLDQNGKEILEIKRSEIADKFQCVPSQINY
FT                   VINTRFTSERGYIVESKRGGGGYIRIIKIKMNNEVVLINNIISQINTHLSQAASDDIIL
FT                   RLLEDKVISEREAKMMVSVMDRSVLHIDLPERDELRARMMKAMLTSLKLK"
FT   gene            96416..96796
FT                   /gene="mcsA"
FT                   /locus_tag="BSUW23_00430"
FT   CDS_pept        96416..96796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BSUW23_00430"
FT                   /product="activator of protein kinase McsB"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36144"
FT                   /db_xref="GOA:E0TYL3"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL3"
FT                   /protein_id="ADM36144.1"
FT                   /translation="MDSSFQNAGTQLFSHSEQISACPKCGMTFQQFRKIGRFGCSECYK
FT                   TFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAH
FT                   VRDQIRSLEQSLKSKDSEEERE"
FT   gene            96796..97887
FT                   /gene="mcsB"
FT                   /locus_tag="BSUW23_00435"
FT   CDS_pept        96796..97887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BSUW23_00435"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36145"
FT                   /db_xref="GOA:E0TYL4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL4"
FT                   /protein_id="ADM36145.1"
FT                   /translation="MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRY
FT                   SNEEASSIIQQFEDQFSEQEIPGIGKFVLIRMNDAQALEKRVLVEKHLISPNLTESPFG
FT                   GCLLSENEEVSVMLNEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQ
FT                   ISNQITLGKSEQDIVDDLNSVAAQLIEQERSAREALYQTSKIELEDKVYRSYGVLSNCR
FT                   MIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIR
FT                   RAALIRERLHLEMNGKRQEDESI"
FT   gene            97884..100316
FT                   /gene="clpC"
FT                   /locus_tag="BSUW23_00440"
FT   CDS_pept        97884..100316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BSUW23_00440"
FT                   /product="class III stress response-related ATPase, AAA+
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36146"
FT                   /db_xref="GOA:E0TYL5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL5"
FT                   /protein_id="ADM36146.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGI
FT                   AAKALQALGLGSDKIQKEVESLIGRGQEMSQTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNETGSSATGTNSNANTPTL
FT                   DSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIINNEVPEILRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVD
FT                   QPSADESIQILKGLRDRYEAHHRVSITDDAIEAAVKLSDRYISDRFLPDKAIDLIDEAG
FT                   SKVRLRSFTTPPNLKELEQKLDEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEDTKK
FT                   SWKEKQGQENSEVTVDDIAMVVSSWTGVPVSKIAQTETDKLLNMESILHSRVIGQDEAV
FT                   VAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESIFGDEEAMIRIDMSE
FT                   YMEKHSTSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTILIMTSNVGASELKRNKYVGFNVQDETQNHKDMKDKVMGELK
FT                   RAFRPEFINRIDEIIVFHSLEKKHLTEIVSLMSDQLTKRLKEQDLSIELTDAAKAKVAE
FT                   EGVDLEYGARPLRRAIQKHVEDRLSEELLRGNIHKGQHIVLDVEDGEFVVKTTAKTN"
FT   gene            100408..101784
FT                   /gene="radA"
FT                   /locus_tag="BSUW23_00445"
FT   CDS_pept        100408..101784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BSUW23_00445"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36147"
FT                   /db_xref="GOA:E0TYL6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL6"
FT                   /protein_id="ADM36147.1"
FT                   /translation="MAKTKSKFICQSCGYESPKWMGKCPGCGAWNTMVEEMIKKAPANR
FT                   RAAFSHSVQTVQKPSPITSIETSEEPRVKTQLGEFNRVLGGGVVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLSDSSNSVLYISGEESVKQTKLRADRLGINSPSLHVLSETDMEYISSAI
FT                   QEMNPAFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMKIAKTKGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGSAGSSITASMEGTRPILVEIQALISPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAIAISIASSFRDTPPNPADCFIGEVGL
FT                   TGEVRRVSRIEQRVKEAAKLGFTRMIIPAANLDGWTKPKGIEVIGVANVAEALRTSLGG
FT                   "
FT   gene            101788..102870
FT                   /gene="disA"
FT                   /locus_tag="BSUW23_00450"
FT   CDS_pept        101788..102870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BSUW23_00450"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36148"
FT                   /db_xref="GOA:E0TYL7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL7"
FT                   /protein_id="ADM36148.1"
FT                   /translation="MEKEKKGAKHELDLSSILQFVAPGTPLRAGMENVLRANTGGLIVV
FT                   GYNDKVKEVVDGGFHINTAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATISS
FT                   SETGMRHRTAERVAKQTGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAIQTL
FT                   EKYKTILDKTINALNALEFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLI
FT                   KLQVIELITDMEEEAALFIKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYPA
FT                   STNLDDYVLPRGYRLLNKIPRLPMPIVENVVEAFGVLPRIIEASAEELDEVEGIGEVRA
FT                   QKIKKGLKRLQEKHYLDRQL"
FT   gene            102984..104084
FT                   /gene="yacL"
FT                   /locus_tag="BSUW23_00455"
FT   CDS_pept        102984..104084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BSUW23_00455"
FT                   /product="PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36149"
FT                   /db_xref="GOA:E0TYL8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL8"
FT                   /protein_id="ADM36149.1"
FT                   /translation="MLKRIVQAFFIIFGGVVGIFLIPELFVLLSIQDIPLITNAYTSAA
FT                   IGAIIFFLISIWGTEYVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPL
FT                   DNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGTADEEHEVQ
FT                   DKKLKILDTSVIIDGRIADICQTGFLEGIIVIPQFVLEELQHIADSSDVLKRNRGRRGL
FT                   DILNRIQKELDIEVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVA
FT                   VLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHID
FT                   VLVTSVLQTAAGRMIFAKPKLLEKAL"
FT   gene            104099..104797
FT                   /gene="ispD"
FT                   /locus_tag="BSUW23_00460"
FT   CDS_pept        104099..104797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BSUW23_00460"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36150"
FT                   /db_xref="GOA:E0TYL9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYL9"
FT                   /protein_id="ADM36150.1"
FT                   /translation="MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRP
FT                   CEKIILVINEREREHFQQLLTDYPFQTAIELVAGGDERQHSVYKGLKAVKQEKIVLVHD
FT                   GARPFIKHEQIDELIAEAEQAGAAILAVPVKDTIKRVQDLQVCETIERSSLWAVQTPQA
FT                   FRLSLLMKAHAEAEYRGFLGTDDASLVEEMEGGSVRVVEGSYTNIKLTTPDDLTSAGAI
FT                   MESESRNNHV"
FT   gene            104790..105266
FT                   /gene="ispF"
FT                   /locus_tag="BSUW23_00465"
FT   CDS_pept        104790..105266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BSUW23_00465"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36151"
FT                   /db_xref="GOA:E0TYM0"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM0"
FT                   /protein_id="ADM36151.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTV
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKP
FT                   KMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG"
FT   gene            105357..106808
FT                   /gene="gltX"
FT                   /locus_tag="BSUW23_00470"
FT   CDS_pept        105357..106808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BSUW23_00470"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36152"
FT                   /db_xref="GOA:E0TYM1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM1"
FT                   /protein_id="ADM36152.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVED
FT                   TDKKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQIARGEMPRYSGKHRNLTQEEQEKFIAEGRKPSIRFRVPEGK
FT                   IIAFNDIVKGEISFESDGIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIFQAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFI
FT                   GLLGWSPVGEEELFTKEQFIDIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVEL
FT                   TLPHLQKAGKVGAELSAEEQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAK
FT                   AVLEEEQVPEVLSTFAAKLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQ
FT                   THGPELPQSIELIGKETAIQRLKNI"
FT   gene            107112..107765
FT                   /gene="cysE"
FT                   /locus_tag="BSUW23_00475"
FT   CDS_pept        107112..107765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BSUW23_00475"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36153"
FT                   /db_xref="GOA:E0TYM2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM2"
FT                   /protein_id="ADM36153.1"
FT                   /translation="MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHAL
FT                   YKRKFYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQG
FT                   VTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVG
FT                   IPGRVVVQNGKKVRRDLNHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK"
FT   gene            107762..109162
FT                   /gene="cysS"
FT                   /locus_tag="BSUW23_00480"
FT   CDS_pept        107762..109162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BSUW23_00480"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36154"
FT                   /db_xref="GOA:E0TYM3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM3"
FT                   /protein_id="ADM36154.1"
FT                   /translation="MTITLYNTLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVYDTVRNYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPAISERFIKAYFEDVGAL
FT                   GCRKADLHPRVMENMDAIIDFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDEL
FT                   RSGARIRVGEKKEDALDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQID
FT                   IHAGGQDLTFPHHENEIAQSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDII
FT                   KQHDPQLLRFFMLSVHYRHPINYSEELLENTKSAFNRLKTAYSNLQHRLNSSTNLTEDD
FT                   DQWLEKVEEHRKAFEEAMDDDFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMF
FT                   DRIVSVLGFSLGEQELLDQEIEDLIEKRNEARRNRDFALSDQIRDQLKSMNIILEDTAQ
FT                   GTRWKRGE"
FT   gene            109166..109597
FT                   /gene="mrnC"
FT                   /locus_tag="BSUW23_00485"
FT   CDS_pept        109166..109597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrnC"
FT                   /locus_tag="BSUW23_00485"
FT                   /product="ribonuclease for 23S RNA maturation"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36155"
FT                   /db_xref="GOA:E0TYM4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM4"
FT                   /protein_id="ADM36155.1"
FT                   /translation="MLDFETIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDL
FT                   HKKSSRIVSAKSQAEILFFLQDQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYRYSTA
FT                   FEALLGHLFLEKKEERLSQLVAEAIQFGTSGRKTNESAT"
FT   gene            109581..110330
FT                   /gene="rlmB"
FT                   /locus_tag="BSUW23_00490"
FT   CDS_pept        109581..110330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="BSUW23_00490"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36156"
FT                   /db_xref="GOA:E0TYM5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM5"
FT                   /protein_id="ADM36156.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELA
FT                   KKQGITIQYVPRKKLDQMVTGQHQGVVAQVAAYEYAELDDLYKAAEERNEQPFFLILDE
FT                   LEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTL
FT                   EEMKERGIWVVGTDASAREDYRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAG
FT                   KVTSLNASVAAGLLMYEVYRKRNPLGE"
FT   gene            110337..110849
FT                   /gene="yacP"
FT                   /locus_tag="BSUW23_00495"
FT   CDS_pept        110337..110849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacP"
FT                   /locus_tag="BSUW23_00495"
FT                   /product="putative ribonuclease with PIN and NYN domains"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36157"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM6"
FT                   /protein_id="ADM36157.1"
FT                   /translation="MDILLVDGYNMIGAWPQLKDLKANSFEEARDVLIQKMAEYQSYTG
FT                   NRVIVVFDAHLVKGLEKKQTNHRVEVIFTKENETADERIEKLAQALNNIATQIHVATSD
FT                   YTEQWAIFGQGALRKSARELLREVEAIERRIERRVRKITSEKPAGKIALSEEVLKTFEK
FT                   WRRGDLD"
FT   gene            110912..111568
FT                   /gene="sigH"
FT                   /gene_synonym="spo0H"
FT                   /locus_tag="BSUW23_00500"
FT   CDS_pept        110912..111568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /gene_synonym="spo0H"
FT                   /locus_tag="BSUW23_00500"
FT                   /product="RNA polymerase sigma factor H"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36158"
FT                   /db_xref="GOA:E0TYM7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM7"
FT                   /protein_id="ADM36158.1"
FT                   /translation="MNLQNNKGKFNKEQFCQLEDEQVIEKVHVGDSDALDYLITKYRNF
FT                   VRAKARSYFLIGADREDIVQEGMIGLYKSIRDFKEDKLTSFKAFAELCITRQIITAIKT
FT                   ATRQKHIPLNSYVSLDKPIFDEESDRTLLDVISGAKTLNPEEMIINQEEFDDIEMKMGE
FT                   LLSDLERKVLVLYLDGRSYQEISDELNRHVKSIDNALQRVKRKLEKYLEIREISL"
FT   gene            111661..111810
FT                   /gene="rpmGB"
FT                   /locus_tag="BSUW23_00505"
FT   CDS_pept        111661..111810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /locus_tag="BSUW23_00505"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36159"
FT                   /db_xref="GOA:E0TYM8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM8"
FT                   /protein_id="ADM36159.1"
FT                   /translation="MRKKITLACKTCGNRNYTTMKSSASAAERLEVKKYCSTCNSHTAH
FT                   LETK"
FT   gene            111844..112023
FT                   /gene="secE"
FT                   /locus_tag="BSUW23_00510"
FT   CDS_pept        111844..112023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BSUW23_00510"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36160"
FT                   /db_xref="GOA:E0TYM9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYM9"
FT                   /protein_id="ADM36160.1"
FT                   /translation="MRIMRFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFILFFAL
FT                   LDTGISQLIRLIVE"
FT   gene            112203..112736
FT                   /gene="nusG"
FT                   /locus_tag="BSUW23_00515"
FT   CDS_pept        112203..112736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BSUW23_00515"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36161"
FT                   /db_xref="GOA:E0TYN0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYN0"
FT                   /protein_id="ADM36161.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDIKNGKKKVVKKKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPG
FT                   EAETILKRMGMDERKTDIDFELKETVKVIDGPFANFTGSIEEIDYDKSKVKVFVNMFGR
FT                   ETPVELEFTQIDKL"
FT   gene            112904..113329
FT                   /gene="rplK"
FT                   /locus_tag="BSUW23_00520"
FT   CDS_pept        112904..113329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BSUW23_00520"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36162"
FT                   /db_xref="GOA:E0TYN1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYN1"
FT                   /protein_id="ADM36162.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   gene            113424..114122
FT                   /gene="rplA"
FT                   /locus_tag="BSUW23_00525"
FT   CDS_pept        113424..114122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BSUW23_00525"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36163"
FT                   /db_xref="GOA:E0TYN2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYN2"
FT                   /protein_id="ADM36163.1"
FT                   /translation="MAKKGKKYAEAAKLVDRAKAYDVSEAVALVKKTNTAKFDATVEVA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDTDYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGV
FT                   KVDASTFNVK"
FT   misc_feature    114176..114301
FT                   /note="L10 leader; ribosomal protein gene, untranslated
FT                   leader; autoregulatory structure; BSUW23_misc_RNA_3"
FT   gene            114375..114875
FT                   /gene="rplJ"
FT                   /locus_tag="BSUW23_00530"
FT   CDS_pept        114375..114875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BSUW23_00530"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36164"
FT                   /db_xref="GOA:E0TYN3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E0TYN3"
FT                   /protein_id="ADM36164.1"
FT                   /translation="MSSAIETKKVVVEEITSKLKESKSTIIVDYRGLNVSEVTELRKQL
FT                   REANVEFKVYKNTMTRRAVEQAELDGLNDVLTGPNAIAFSTEDVVAPAKVLNEFAKQHE
FT                   ALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVADQKEE
FT                   QGA"
FT   gene            114919..115290
FT                   /gene="rplL"
FT                   /locus_tag="BSUW23_00535"
FT   CDS_pept        114919..115290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BSUW23_00535"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36165"
FT                   /db_xref="GOA:E0TZD7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZD7"
FT                   /protein_id="ADM36165.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKE
FT                   EAEELKAKLEEVGASVEVK"
FT   gene            115380..115985
FT                   /gene="ybxB"
FT                   /locus_tag="BSUW23_00540"
FT   CDS_pept        115380..115985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxB"
FT                   /locus_tag="BSUW23_00540"
FT                   /product="ribosomal RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36166"
FT                   /db_xref="GOA:E0TZD8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZD8"
FT                   /protein_id="ADM36166.1"
FT                   /translation="MSEHYYSEKPSVKSNKQTWSFRLRNKDFKFTSDSGVFSKKEVDFG
FT                   SRLLIDSFEEPEVEGSILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQ
FT                   NGITNVKIYQSDMFSNVDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIV
FT                   IQKKQGAPSAIEKLEELFDEVSVVQKKKGYYIIKAKKV"
FT   gene            116233..119814
FT                   /gene="rpoB"
FT                   /locus_tag="BSUW23_00545"
FT   CDS_pept        116233..119814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BSUW23_00545"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36167"
FT                   /db_xref="GOA:E0TZD9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZD9"
FT                   /protein_id="ADM36167.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEILDLVGENEYLRNTLD
FT                   KDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAEKGQILDRRTLDKVLPYLENGIGFRKLYPNGGVVED
FT                   EVTLQSIKIFAPTDQEGEQVINVIGNAYIEEEIKNITPADIISSISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSYAKVNRFGFIETPYRRVDPETGKVTGRIDYLTADEEDNYVVAQ
FT                   ANARLDDEGAFIDDSIVARFRGENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPEAPFVGTGMEYVSGKDSGAAVICKHPGIVERVEAKNVWVRR
FT                   YEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVVKGEILADGPSMELGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARYLGIHIAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDEEEIEMRDLEDEEDAKQA
FT                   DGLALSGDEEPEETASADVERDVVTKE"
FT   gene            119876..123475
FT                   /gene="rpoC"
FT                   /locus_tag="BSUW23_00550"
FT   CDS_pept        119876..123475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BSUW23_00550"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36168"
FT                   /db_xref="GOA:E0TZE0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE0"
FT                   /protein_id="ADM36168.1"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFK
FT                   NTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFP
FT                   YMNEPTKSNIEEKTPDRFFLEKGADVKAVIEQQPINAPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDED
FT                   KALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATITEIDGTVVEINEVRDKQQ
FT                   EIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVL
FT                   LEGNRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMMKYRKVKPVSNVQPTEDMVPVE"
FT   gene            123651..123899
FT                   /gene="rplGB"
FT                   /locus_tag="BSUW23_00555"
FT   CDS_pept        123651..123899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplGB"
FT                   /locus_tag="BSUW23_00555"
FT                   /product="putative ribosomal protein L7Ae-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36169"
FT                   /db_xref="GOA:E0TZE1"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE1"
FT                   /protein_id="ADM36169.1"
FT                   /translation="MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSV
FT                   VSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL"
FT   gene            124013..124429
FT                   /gene="rpsL"
FT                   /locus_tag="BSUW23_00560"
FT                   /note="spontaneous mutation to streptomycin resistance"
FT   CDS_pept        124013..124429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BSUW23_00560"
FT                   /product="30S ribosomal protein S12"
FT                   /note="streptomycin resistance mutation (K56R)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36170"
FT                   /db_xref="GOA:E0TZE2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE2"
FT                   /protein_id="ADM36170.1"
FT                   /translation="MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRG
FT                   VCTRVGTMTPRKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK"
FT   gene            124471..124941
FT                   /gene="rpsG"
FT                   /locus_tag="BSUW23_00565"
FT   CDS_pept        124471..124941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BSUW23_00565"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36171"
FT                   /db_xref="GOA:E0TZE3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE3"
FT                   /protein_id="ADM36171.1"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            124994..127072
FT                   /gene="fusA"
FT                   /locus_tag="BSUW23_00570"
FT   CDS_pept        124994..127072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BSUW23_00570"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36172"
FT                   /db_xref="GOA:E0TZE4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE4"
FT                   /protein_id="ADM36172.1"
FT                   /translation="MAREFSLDKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQ
FT                   LPIGAEDNFEGIIDLVENVAYFYEDDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELD
FT                   EELMDKYLEGEEITIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVAAIKGTRPDTNEEIERHSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEIATVYAGDIAAAVGLKDTTTGDTLCDEKDLVILES
FT                   MEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRTGAKVEGKFVRQSGGRGQFGHVWIEFEPNEE
FT                   GACFEFENAIVGGVVPREYIPAVQAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSN
FT                   EMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMFMDHYEEVPKSVSEEIIKKNKGE"
FT   gene            127192..128382
FT                   /gene="tufA"
FT                   /locus_tag="BSUW23_00575"
FT   CDS_pept        127192..128382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="BSUW23_00575"
FT                   /product="elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36173"
FT                   /db_xref="GOA:E0TZE5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE5"
FT                   /protein_id="ADM36173.1"
FT                   /translation="MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYD
FT                   FPGDDVPVIKGSALKALEGDADYEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQVKVGDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREEIQRGQVLAKPGTITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDV
FT                   TGIIHLPEGVEMVMPGDNTEMNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE"
FT   gene            128483..129439
FT                   /gene="ybaC"
FT                   /locus_tag="BSUW23_00580"
FT   CDS_pept        128483..129439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="BSUW23_00580"
FT                   /product="putative proline iminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36174"
FT                   /db_xref="GOA:E0TZE6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE6"
FT                   /protein_id="ADM36174.1"
FT                   /translation="MIPEKRSIAIMKELSIGNTKQMLMINGADVKNPLLLFLHGGPGAP
FT                   QIGYVRHYQKELEQHFTIVHWDQRGSGLSYSKRIPHHSMTISHFIKDTIQVTQWLLDHF
FT                   SKTKVYLAGHSWGTLLALHVLQQRPDLFYAYYGISQVVNPHYEESAAYQYIREISDPKR
FT                   AGIVFPLIRFIGAPPWKKDIQHLIYRLCVEMSRGGFTHQHRQSLAILFQMLTGKEYGIR
FT                   NMHSFLNGLYFSKKHLTDELYRFNAFRSVPSIKVPCCFISGRHDLIVPAEISKQYYCEL
FT                   EAPEKRWFQFEKSAHTPHIEEPSLFANTLSRHALYHL"
FT   gene            129677..129985
FT                   /gene="rpsJ"
FT                   /locus_tag="BSUW23_00585"
FT   CDS_pept        129677..129985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BSUW23_00585"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36175"
FT                   /db_xref="GOA:E0TZE7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE7"
FT                   /protein_id="ADM36175.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            130025..130654
FT                   /gene="rplC"
FT                   /locus_tag="BSUW23_00590"
FT   CDS_pept        130025..130654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BSUW23_00590"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36176"
FT                   /db_xref="GOA:E0TZE8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE8"
FT                   /protein_id="ADM36176.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKSTENDG
FT                   YEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSA
FT                   GEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK"
FT   gene            130682..131305
FT                   /gene="rplD"
FT                   /locus_tag="BSUW23_00595"
FT   CDS_pept        130682..131305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BSUW23_00595"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36177"
FT                   /db_xref="GOA:E0TZE9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZE9"
FT                   /protein_id="ADM36177.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVNDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEVLA"
FT   gene            131305..131592
FT                   /gene="rplW"
FT                   /locus_tag="BSUW23_00600"
FT   CDS_pept        131305..131592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BSUW23_00600"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36178"
FT                   /db_xref="GOA:E0TZF0"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF0"
FT                   /protein_id="ADM36178.1"
FT                   /translation="MKDPRDVLKRPVITERSADLMAEKKYTFEVDVRANKTEVKDAVES
FT                   IFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
FT   gene            131624..132457
FT                   /gene="rplB"
FT                   /locus_tag="BSUW23_00605"
FT   CDS_pept        131624..132457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BSUW23_00605"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36179"
FT                   /db_xref="GOA:E0TZF1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF1"
FT                   /protein_id="ADM36179.1"
FT                   /translation="MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYI
FT                   LAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
FT   gene            132515..132793
FT                   /gene="rpsS"
FT                   /locus_tag="BSUW23_00610"
FT   CDS_pept        132515..132793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BSUW23_00610"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36180"
FT                   /db_xref="GOA:E0TZF2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF2"
FT                   /protein_id="ADM36180.1"
FT                   /translation="MARSLKKGPFVDGHLMTKIEKLNETDKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVFISEDMVGHKLGEFAPTRTYKGHASDDKKTRR"
FT   gene            132810..133151
FT                   /gene="rplV"
FT                   /locus_tag="BSUW23_00615"
FT   CDS_pept        132810..133151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BSUW23_00615"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36181"
FT                   /db_xref="GOA:E0TZF3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF3"
FT                   /protein_id="ADM36181.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASP
FT                   IIEKVLKSAIANAEHNYELDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            133155..133811
FT                   /gene="rpsC"
FT                   /locus_tag="BSUW23_00620"
FT   CDS_pept        133155..133811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BSUW23_00620"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36182"
FT                   /db_xref="GOA:E0TZF4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF4"
FT                   /protein_id="ADM36182.1"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVESLRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK"
FT   gene            133813..134247
FT                   /gene="rplP"
FT                   /locus_tag="BSUW23_00625"
FT   CDS_pept        133813..134247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BSUW23_00625"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36183"
FT                   /db_xref="GOA:E0TZF5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF5"
FT                   /protein_id="ADM36183.1"
FT                   /translation="MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLF
FT                   EISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESNES"
FT   gene            134237..134437
FT                   /gene="rpmC"
FT                   /locus_tag="BSUW23_00630"
FT   CDS_pept        134237..134437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BSUW23_00630"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36184"
FT                   /db_xref="GOA:E0TZF6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF6"
FT                   /protein_id="ADM36184.1"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKAIARMKTVIREREIASNK"
FT   gene            134460..134723
FT                   /gene="rpsQ"
FT                   /locus_tag="BSUW23_00635"
FT   CDS_pept        134460..134723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BSUW23_00635"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36185"
FT                   /db_xref="GOA:E0TZF7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF7"
FT                   /protein_id="ADM36185.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            134764..135132
FT                   /gene="rplNA"
FT                   /locus_tag="BSUW23_00640"
FT   CDS_pept        134764..135132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplNA"
FT                   /locus_tag="BSUW23_00640"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36186"
FT                   /db_xref="GOA:E0TZF8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZF8"
FT                   /protein_id="ADM36186.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVI"
FT   gene            135169..135480
FT                   /gene="rplX"
FT                   /locus_tag="BSUW23_00645"
FT   CDS_pept        135169..135480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BSUW23_00645"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36187"
FT                   /db_xref="GOA:E0TZF9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:E0TZF9"
FT                   /protein_id="ADM36187.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
FT   gene            135507..136046
FT                   /gene="rplE"
FT                   /locus_tag="BSUW23_00650"
FT   CDS_pept        135507..136046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BSUW23_00650"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36188"
FT                   /db_xref="GOA:E0TZG0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG0"
FT                   /protein_id="ADM36188.1"
FT                   /translation="MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
FT   gene            136069..136254
FT                   /gene="rpsNA"
FT                   /locus_tag="BSUW23_00655"
FT   CDS_pept        136069..136254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsNA"
FT                   /locus_tag="BSUW23_00655"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36189"
FT                   /db_xref="GOA:E0TZG1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG1"
FT                   /protein_id="ADM36189.1"
FT                   /translation="MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            136286..136684
FT                   /gene="rpsH"
FT                   /locus_tag="BSUW23_00660"
FT   CDS_pept        136286..136684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BSUW23_00660"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36190"
FT                   /db_xref="GOA:E0TZG2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG2"
FT                   /protein_id="ADM36190.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFVEDSKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   ILSTSQGVLTDKEARAKQAGGEVLAYVW"
FT   gene            136714..137253
FT                   /gene="rplF"
FT                   /locus_tag="BSUW23_00665"
FT   CDS_pept        136714..137253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BSUW23_00665"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36191"
FT                   /db_xref="GOA:E0TZG3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG3"
FT                   /protein_id="ADM36191.1"
FT                   /translation="MSRVGKKLLEIPSDVTVTLNDDNTVAVKGPKGELTRTFHPDMEIK
FT                   VEDNVLTVTRPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKL
FT                   VLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGI
FT                   RYEGEVVRRKEGKSAK"
FT   gene            137286..137648
FT                   /gene="rplR"
FT                   /locus_tag="BSUW23_00670"
FT   CDS_pept        137286..137648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BSUW23_00670"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36192"
FT                   /db_xref="GOA:E0TZG4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG4"
FT                   /protein_id="ADM36192.1"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQII
FT                   DDVNGVTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHG
FT                   RVKALADAAREAGLKF"
FT   gene            137673..138173
FT                   /gene="rpsE"
FT                   /locus_tag="BSUW23_00675"
FT   CDS_pept        137673..138173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BSUW23_00675"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36193"
FT                   /db_xref="GOA:E0TZG5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG5"
FT                   /protein_id="ADM36193.1"
FT                   /translation="MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTG
FT                   VIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAEEVAKLRGKSVEE
FT                   LLG"
FT   gene            138187..138366
FT                   /gene="rpmD"
FT                   /locus_tag="BSUW23_00680"
FT   CDS_pept        138187..138366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BSUW23_00680"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36194"
FT                   /db_xref="GOA:E0TZG6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG6"
FT                   /protein_id="ADM36194.1"
FT                   /translation="MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRG
FT                   MINKVSHLVSVKEQ"
FT   gene            138397..138837
FT                   /gene="rplO"
FT                   /locus_tag="BSUW23_00685"
FT   CDS_pept        138397..138837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BSUW23_00685"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36195"
FT                   /db_xref="GOA:E0TZG7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG7"
FT                   /protein_id="ADM36195.1"
FT                   /translation="MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISK
FT                   LNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI"
FT   gene            138839..140134
FT                   /gene="secY"
FT                   /locus_tag="BSUW23_00690"
FT   CDS_pept        138839..140134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BSUW23_00690"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36196"
FT                   /db_xref="GOA:E0TZG8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG8"
FT                   /protein_id="ADM36196.1"
FT                   /translation="MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEVLQ
FT                   AQSQMGVFDLLNTFGGGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNLANGMLIEKSGISTYLIIALVLTGGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVASIPKTIGQIYETQFVGSNDQLFIHIVKVALLVI
FT                   AILAVIVGVIFIQQAVRKIAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFL
FT                   ITPRTIASFFGTNDVTKWIQNYFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRNYRGFMKN"
FT   gene            140189..140842
FT                   /gene="adk"
FT                   /locus_tag="BSUW23_00695"
FT   CDS_pept        140189..140842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BSUW23_00695"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36197"
FT                   /db_xref="GOA:E0TZG9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZG9"
FT                   /protein_id="ADM36197.1"
FT                   /translation="MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPL
FT                   GLEAKSYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYG
FT                   KPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGVCDKDGGELYQRADD
FT                   NEETVSKRLEVNMKQTQPLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGLKK"
FT   gene            140839..141585
FT                   /gene="mapA"
FT                   /locus_tag="BSUW23_00700"
FT   CDS_pept        140839..141585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mapA"
FT                   /locus_tag="BSUW23_00700"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36198"
FT                   /db_xref="GOA:E0TZH0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH0"
FT                   /protein_id="ADM36198.1"
FT                   /translation="MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAE
FT                   RFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITETGFDILTRV"
FT   gene            141623..141847
FT                   /gene="ybzG"
FT                   /locus_tag="BSUW23_00702"
FT   CDS_pept        141623..141847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzG"
FT                   /locus_tag="BSUW23_00702"
FT                   /product="putative ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36199"
FT                   /db_xref="GOA:E0TZH1"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH1"
FT                   /protein_id="ADM36199.1"
FT                   /translation="MIGQKVWMNIGRTEFILSLSLGLLTIINVLTADGEKRTLHSPKKK
FT                   NINHLTLYDCVSPEVQNSINETGRVTNFF"
FT   gene            141896..142114
FT                   /gene="infA"
FT                   /locus_tag="BSUW23_00705"
FT   CDS_pept        141896..142114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BSUW23_00705"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36200"
FT                   /db_xref="GOA:E0TZH2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH2"
FT                   /protein_id="ADM36200.1"
FT                   /translation="MAKDDVIEVEGTIVETLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            142148..142261
FT                   /gene="rpmJ"
FT                   /locus_tag="BSUW23_00710"
FT   CDS_pept        142148..142261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BSUW23_00710"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36201"
FT                   /db_xref="GOA:E0TZH3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH3"
FT                   /protein_id="ADM36201.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            142284..142649
FT                   /gene="rpsM"
FT                   /locus_tag="BSUW23_00715"
FT   CDS_pept        142284..142649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BSUW23_00715"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36202"
FT                   /db_xref="GOA:E0TZH4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH4"
FT                   /protein_id="ADM36202.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAQQVLKEAGVSEDTRV
FT                   RDLTEEELGKIRDVIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            142670..143065
FT                   /gene="rpsK"
FT                   /locus_tag="BSUW23_00720"
FT   CDS_pept        142670..143065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BSUW23_00720"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36203"
FT                   /db_xref="GOA:E0TZH5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH5"
FT                   /protein_id="ADM36203.1"
FT                   /translation="MAAARKSNTRKRRVKKNVESGIAHIRSTFNNTIVTITDTHGNALS
FT                   WSSAGALGFRGSRKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            143242..144186
FT                   /gene="rpoA"
FT                   /locus_tag="BSUW23_00725"
FT   CDS_pept        143242..144186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BSUW23_00725"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36204"
FT                   /db_xref="GOA:E0TZH6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH6"
FT                   /protein_id="ADM36204.1"
FT                   /translation="MIEIEKPKIETVEISDDAKFGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGE
FT                   GTVTAADITHDSDVEILNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVANYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
FT   gene            144264..144626
FT                   /gene="rplQ"
FT                   /locus_tag="BSUW23_00730"
FT   CDS_pept        144264..144626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BSUW23_00730"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36205"
FT                   /db_xref="GOA:E0TZH7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH7"
FT                   /protein_id="ADM36205.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
FT   gene            144757..145602
FT                   /gene="ybxA"
FT                   /locus_tag="BSUW23_00735"
FT   CDS_pept        144757..145602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxA"
FT                   /locus_tag="BSUW23_00735"
FT                   /product="ABC efflux transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36206"
FT                   /db_xref="GOA:E0TZH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH8"
FT                   /protein_id="ADM36206.1"
FT                   /translation="MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNG
FT                   SGKSTLARALNGLILPESGNIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDD
FT                   VAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDI
FT                   IILDEATSMLDPIGREEVLETVRHLKGQGMATVISITHDLNEAAKADRIIVMNGGKKYA
FT                   EGLPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM
FT                   "
FT   gene            145578..146447
FT                   /gene="ybaE"
FT                   /locus_tag="BSUW23_00740"
FT   CDS_pept        145578..146447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="BSUW23_00740"
FT                   /product="ABC efflux transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36207"
FT                   /db_xref="GOA:E0TZH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZH9"
FT                   /protein_id="ADM36207.1"
FT                   /translation="MDITIKDVEHRYQMKTPFERLALYDINASIKEGSYVAVIGHTGSG
FT                   KSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKELKTLRKKVGIVFQFPEHQLFEETVL
FT                   KDISFGPMNFGVKKEDAEQKAREMLKLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMD
FT                   PEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTILVTHSMEDAAAYADEMIVMHKG
FT                   TIQASGSPHDLFLKGEEMAGWGLDLPETIKFQRQLEAALGVRFKEPMLTIEDAAAEIRA
FT                   LFQGEKTL"
FT   gene            146444..147241
FT                   /gene="ybaF"
FT                   /locus_tag="BSUW23_00745"
FT   CDS_pept        146444..147241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaF"
FT                   /locus_tag="BSUW23_00745"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36208"
FT                   /db_xref="GOA:E0TZI0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI0"
FT                   /protein_id="ADM36208.1"
FT                   /translation="MMDSMIIGKYVPGSSLVHRLDPRTKLITIFLFVCIVFLANNVQTY
FT                   ALLGLFTVGVVSLTRVPFSFLMKGLKPIIWIVIFTFLLHILMTHEGPVIFQLGVFKVYE
FT                   GGLVQGIFISLRFVYLILMTTLLTLTTTPIEITDGMEQLLNPLKKIKLPVHELALMMSI
FT                   SLRFIPTLMEETDRIMKAQMARGVDFTSGPVKDRVKAIVPLLVPLFVSAFKRAEELAVA
FT                   MEARGYQGGEGRTKYRKLVWTGKDTSVIVSLMILAALLFFLRT"
FT   gene            147251..147994
FT                   /gene="truA"
FT                   /locus_tag="BSUW23_00750"
FT   CDS_pept        147251..147994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BSUW23_00750"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36209"
FT                   /db_xref="GOA:E0TZI1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI1"
FT                   /protein_id="ADM36209.1"
FT                   /translation="MRLKCTISYDGHLFNGYQVQPGKRTVQDELEKALAVLHKSKDRIP
FT                   VVSSGRTDSGVHAAGQVIHFDTPLSIPAEKWPYALNALLPDDIAVKQAEIADDGFHARF
FT                   SAVKKEYRYFVYTEKHPDVFKRHYAYHFSYHLNVQNMREAAKHLLGTHDFTSFCAVKTE
FT                   VQDKVRTIYELDWAETDDGLQMRITGSGFLYNMVRIIAGTLLDAGIGKISPDDVKSMLE
FT                   AKDREAAGRTAPGHGLYLWNVFYDN"
FT   misc_feature    148051..148107
FT                   /note="L13 leader; ribosomal protein gene, untranslated
FT                   leader; autoregulatory structure; BSUW23_misc_RNA_4"
FT   gene            148156..148593
FT                   /gene="rplM"
FT                   /locus_tag="BSUW23_00755"
FT   CDS_pept        148156..148593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BSUW23_00755"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36210"
FT                   /db_xref="GOA:E0TZI2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI2"
FT                   /protein_id="ADM36210.1"
FT                   /translation="MRTTPMANASTIERKWLVVDAAGKTLGRLSTEVASILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG"
FT   gene            148614..149006
FT                   /gene="rpsI"
FT                   /locus_tag="BSUW23_00760"
FT   CDS_pept        148614..149006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BSUW23_00760"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36211"
FT                   /db_xref="GOA:E0TZI3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI3"
FT                   /protein_id="ADM36211.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSPALI
FT                   EDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRATLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            complement(149112..149369)
FT                   /locus_tag="BSUW23_00765"
FT   CDS_pept        complement(149112..149369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_00765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36212"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI4"
FT                   /protein_id="ADM36212.1"
FT                   /translation="MIYVIRFTLISSNSVISKELLFLRAMKQLKNRQGDLTKGRPVVRM
FT                   SWTDDITIKNFDQISKQLTGSDMKAIMIITVRALISKHFA"
FT   gene            149490..150257
FT                   /gene="ybaJ"
FT                   /locus_tag="BSUW23_00770"
FT   CDS_pept        149490..150257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="BSUW23_00770"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36213"
FT                   /db_xref="GOA:E0TZI5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI5"
FT                   /protein_id="ADM36213.1"
FT                   /translation="MNALVDHNSKAWDQKVETGNEWTVAVEQHVIEQAKTGNWDIRVTP
FT                   MKDVPRDWFPPVNGLKVLCLASGGGQQGPILAAAGADVTVLDNSEKQLDQDRMVAKRDD
FT                   LKIHTVKGSMDDLSQFKDESFDVIVHPVANVFVEDVLPVWKEAHRVLKRNGVLISGFVN
FT                   PVVFLFDVELEQQGILKVKHSIPYADSDDLPKHKVKKLMENNEALEFGHSLEDQIKGQI
FT                   DAGFIVTGFYEDKGGFVLDQYIHTYSATRSVKV"
FT   gene            150454..150897
FT                   /gene="ybaK"
FT                   /locus_tag="BSUW23_00775"
FT   CDS_pept        150454..150897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BSUW23_00775"
FT                   /product="putative alkylated deoxynucleotide
FT                   triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36214"
FT                   /db_xref="GOA:E0TZI6"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI6"
FT                   /protein_id="ADM36214.1"
FT                   /translation="MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLEPLFPF
FT                   LHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGESMQSISARSAREEEELRMEFFDYLY
FT                   NWTHEQYATFDKNTVYEAAHKFIKDWWTEGFVQREKQCKLRMR"
FT   gene            150957..151670
FT                   /gene="cwlD"
FT                   /locus_tag="BSUW23_00780"
FT   CDS_pept        150957..151670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BSUW23_00780"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36215"
FT                   /db_xref="GOA:E0TZI7"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI7"
FT                   /protein_id="ADM36215.1"
FT                   /translation="MRKKLKWLGFLLGFIVLLFLFKYQFSNNDSWNPWSLPLSGKIIYL
FT                   DPGHGGPDGGAVGGKLLEKDVTLEVAFRVRDYLQEQGALVIMTRESDTDLAPEGTKGYS
FT                   RRKAEDLRQRVKLINHSEAELYISIHLNAIPSQKWSGAQSFYYGKFAENEKVAKYIQDE
FT                   LRRNLENTTRKAKRIHGIYLMQNVTKPGALVEVGFLSNPNEARLLGKSKYQDKVASSIY
FT                   KGILRYFTEKGDPPE"
FT   gene            151766..152824
FT                   /gene="salA"
FT                   /locus_tag="BSUW23_00785"
FT   CDS_pept        151766..152824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salA"
FT                   /locus_tag="BSUW23_00785"
FT                   /product="Mrp family regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36216"
FT                   /db_xref="GOA:E0TZI8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI8"
FT                   /protein_id="ADM36216.1"
FT                   /translation="MIREDEVRKLVGEMREPFLQRPLGELDAVKEIKIKPEKRHVSVKV
FT                   ALAKTGTAEQMQIQQEIVNILKGAGAETVGLRFEELPEETVAKFRAPSAEKKTLLNMDN
FT                   PPVFLAVASGKGGVGKSTVSVNLAISLARLGKKVGLIDADIYGFSVPDMMGITVRPTIE
FT                   GEKLLPVERFGVKVMSMGFFVEENAPVVWRGPMLGKMLNNFFHEVEWGEVDYIVLDLPP
FT                   GTGDVALDVHTMLPSCKEIIVSTPHPTAAFVAARAGSMAIKTDHEVVGVIENMAYYESA
FT                   KTGEREYVFGKGGGDKLAEELHVPLLGRIPLKQPDWDQDQFAPSVYDENHPIGEIYQDI
FT                   AKKIVTKMSVQV"
FT   gene            complement(152859..153416)
FT                   /gene="gerD"
FT                   /locus_tag="BSUW23_00790"
FT   CDS_pept        complement(152859..153416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BSUW23_00790"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36217"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZI9"
FT                   /protein_id="ADM36217.1"
FT                   /translation="MSKAKMLLMSCFLLLSVTACAPKDQAADMDYDQTKKMVVDILKTD
FT                   DGKKAIKELLNDDAMNEALVIDQDAIKGTIEKTLTSKKGEEFWKNIFEDTDFAQGFAKT
FT                   LQTEHEKVIKKLMKDPDYQKMLMGVMQDPGMNKKYSELAKSQEFRSYLEEVINETLSSP
FT                   LYKKQFEDEMKKAAKDTAKESE"
FT   gene            153526..154122
FT                   /gene="kbaA"
FT                   /locus_tag="BSUW23_00795"
FT   CDS_pept        153526..154122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BSUW23_00795"
FT                   /product="KinB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36218"
FT                   /db_xref="GOA:E0TZJ0"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZJ0"
FT                   /protein_id="ADM36218.1"
FT                   /translation="MKSRGLVRFFFSILAVGAVITSIVGFALKWGEYRGLFLAFEAGQI
FT                   FSVLFWFIGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMY
FT                   VRFLFFGESGESLAGYAWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWF
FT                   PALRVNDEDWLYLMLFPLMACNAFQLLMLPKFAAK"
FT   gene            complement(154123..154887)
FT                   /gene="ybaN"
FT                   /locus_tag="BSUW23_00800"
FT   CDS_pept        complement(154123..154887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="BSUW23_00800"
FT                   /product="polysaccharide deacetylase involved in
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36219"
FT                   /db_xref="GOA:E0TZJ1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZJ1"
FT                   /protein_id="ADM36219.1"
FT                   /translation="MNHFYVWHIKRVKQFIIILIAAFAAASFFYIQRAVPLPVFSTDTG
FT                   PKAIYKGETDSKDIALTFDISWGDEKAKPILDTLKANGIKNATFFLSASWAERHPDTVA
FT                   RIVKDGHQIGSMGYAYKNYANLESSEIKKDINRAQTSFEKLGIKDIQLLRPPTGQFNKN
FT                   VLTVAKQYNYTVVHYSVNSQDWTNPGVDKIIDNVTKQVSGGDIILLHASDSAKQTEEAL
FT                   PDIIHQLKEKGLKNVTVGDLISNSDAKSAEVK"
FT   gene            155238..156796
FT                   /locus_tag="BSUW23_r20638"
FT                   /note="rrnI-16S"
FT   rRNA            155238..156796
FT                   /locus_tag="BSUW23_r20638"
FT                   /product="16S ribosomal RNA"
FT   gene            156958..159886
FT                   /locus_tag="BSUW23_r20654"
FT                   /note="rrnI-23S"
FT   rRNA            156958..159886
FT                   /locus_tag="BSUW23_r20654"
FT                   /product="23S ribosomal RNA"
FT   gene            159941..160056
FT                   /locus_tag="BSUW23_r20622"
FT                   /note="rrnI-5S"
FT   rRNA            159941..160056
FT                   /locus_tag="BSUW23_r20622"
FT                   /product="5S ribosomal RNA"
FT   gene            160101..160175
FT                   /locus_tag="BSUW23_t20476"
FT                   /note="trnI-Asn"
FT   tRNA            160101..160175
FT                   /locus_tag="BSUW23_t20476"
FT                   /product="tRNA-Asn"
FT   gene            160178..160250
FT                   /locus_tag="BSUW23_t20478"
FT                   /note="trnI-Thr"
FT   tRNA            160178..160250
FT                   /locus_tag="BSUW23_t20478"
FT                   /product="tRNA-Thr"
FT   gene            160312..160386
FT                   /locus_tag="BSUW23_t20480"
FT                   /note="trnI-Gly"
FT   tRNA            160312..160386
FT                   /locus_tag="BSUW23_t20480"
FT                   /product="tRNA-Gly"
FT   gene            160419..160495
FT                   /locus_tag="BSUW23_t20482"
FT                   /note="trnI-Arg"
FT   tRNA            160419..160495
FT                   /locus_tag="BSUW23_t20482"
FT                   /product="tRNA-Arg"
FT   gene            160522..160598
FT                   /locus_tag="BSUW23_t20484"
FT                   /note="trnI-Pro"
FT   tRNA            160522..160598
FT                   /locus_tag="BSUW23_t20484"
FT                   /product="tRNA-Pro"
FT   gene            160606..160681
FT                   /locus_tag="BSUW23_t20486"
FT                   /note="trnI-Ala"
FT   tRNA            160606..160681
FT                   /locus_tag="BSUW23_t20486"
FT                   /product="tRNA-Ala"
FT   gene            160851..162409
FT                   /locus_tag="BSUW23_r20640"
FT                   /note="rrnH-16S"
FT   rRNA            160851..162409
FT                   /locus_tag="BSUW23_r20640"
FT                   /product="16S ribosomal RNA"
FT   gene            162571..165494
FT                   /locus_tag="BSUW23_r20656"
FT                   /note="rrnH-23S"
FT   rRNA            162571..165494
FT                   /locus_tag="BSUW23_r20656"
FT                   /product="23S ribosomal RNA"
FT   gene            165552..165667
FT                   /locus_tag="BSUW23_r20624"
FT                   /note="rrnH-5S"
FT   rRNA            165552..165667
FT                   /locus_tag="BSUW23_r20624"
FT                   /product="5S ribosomal RNA"
FT   gene            165899..166309
FT                   /locus_tag="BSUW23_00815"
FT   CDS_pept        165899..166309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_00815"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36220"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZJ2"
FT                   /protein_id="ADM36220.1"
FT                   /translation="MMVKKLSRLTVATEVGEYRTEAAGLISDYVYHPQDLTVDEVRRIN
FT                   QGRKFEVIFDTVGNQLPLIRQGRKDCAHEFDDMYEMKVRPFQLLSNGVMIVGTGKARQI
FT                   TEKTPLKNYEAAIQELTGIDPLSNERKDITAV"
FT   gene            166581..168017
FT                   /gene="ybaR"
FT                   /locus_tag="BSUW23_00820"
FT   CDS_pept        166581..168017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaR"
FT                   /locus_tag="BSUW23_00820"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36221"
FT                   /db_xref="GOA:E0TZJ3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0TZJ3"
FT                   /protein_id="ADM36221.1"
FT                   /translation="MNNSFTLKQQWFGNIRKDILAGILVALALIPEAIGFSIIAGVDPM
FT                   VGLYASFCIAIIISIFGGRPGMISAATGSMAVVMVSLVADHGLQYLFAATILTGIIQVI
FT                   LGISKIARLMKFIPRSVMIGFVNALAILIFSAQLPQFEGASWSMYAMLAGSLVIIYVLP
FT                   RFTTAVPSPLVAIIVMTIIAVTFHVDVRTVGDMGNISSSLPHFLIPDVPFTFETLQIIF
FT                   PYSIALAFVGLLESLLTAQIIDEMTDTDSDKNKESRGQGIANIVTGFFGGMAGCAMIGQ
FT                   SVINTKAGGRGRLSAFVAGAFLMFLIAVLSTVVVKIPMAALVAVMVMVSVGTFDWSSLK
FT                   GLKKAPLTDSIVMVVTVITVVVTDDLSKGVFVGVLLSAVFFVAKISKLKIVSYEEDQKL
FT                   RTYQVKGQIFFASVTDLTNAFIYQEDIERVVIDLTEAHVWDDSGAAALDKIVAKFKEQG
FT                   IEAEVKGLNKASKALMKQMT"
FT   gene            168125..169084
FT                   /gene="ybaS"
FT                   /locus_tag="BSUW23_00825"
FT   CDS_pept        168125..169084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="BSUW23_00825"
FT                   /product="putative sodium dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36222"
FT                   /db_xref="GOA:E0U051"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E0U051"
FT                   /protein_id="ADM36222.1"
FT                   /translation="MTLQKLNRVLGKVMPLLTPTSVVLGVLLSQFLNGYESAVPWIFAF
FT                   ITFAGSLSANFQSLRHALSHPLPMILALFVLHIFMPLFAWGSGHLIFKGDPLTITGLTL
FT                   AVVIPTGITSLIWAAMYKGNVGLTLSIILVDTVLSPLIVPLSLSLLAGAQVHMDVWGMM
FT                   KGLIVMVVIPSFLGMLFNQISPPERTASVSSSLSPFSKLCLMAVIAINSSAIAPYFKAV
FT                   DLRFVGIAATVFFIALTGYAAAWLIGKMMKRRQEEIVSLIFTGGMRNISAGAVLAVTFF
FT                   PSQVAVPVVIGMLFQQILAALFGYMLNRFELKPVLQKA"
FT   gene            complement(169101..169850)
FT                   /gene="ybbA"
FT                   /locus_tag="BSUW23_00830"
FT   CDS_pept        complement(169101..169850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="BSUW23_00830"
FT                   /product="putative iron-chelator esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36223"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U052"
FT                   /protein_id="ADM36223.1"
FT                   /translation="MNGSLSEHKAGKRRFTLYLPPSYSPDNSRRFPAVYVQDGSSLFQD
FT                   QIELLESTFQQRRLPELVLIGIEPENRLDEYTPWPAASLSDRFPDFGGMGYDYLSDITN
FT                   RFIPFIEENWNVTREPQSRGMIGASLGGLISMFALLRYPSMFEKIGSISGSYWYENAAE
FT                   TIHLSSLKPGTARVFMSVGSEEGREKQSIQRHMLQNTKQVYQSLKEKGFTEDQLCFSIE
FT                   KGAVHHRKYFCKQFTIALEWLYGKNRS"
FT   gene            complement(169847..170857)
FT                   /gene="feuC"
FT                   /locus_tag="BSUW23_00835"
FT   CDS_pept        complement(169847..170857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuC"
FT                   /locus_tag="BSUW23_00835"
FT                   /product="iron-uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36224"
FT                   /db_xref="GOA:E0U053"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0U053"
FT                   /protein_id="ADM36224.1"
FT                   /translation="MAKKYAVIIALILVVSYFSLTSGSFSVRPAELLSTLFQINPNPQY
FT                   EILLFDLRLPRVVMAAIIGLGLGIAGAVIQAITRNGLADPGILGINAGAGAGIVAFMLL
FT                   FQGQKEVTSIAAAMGMPFFGLIGGLIAAILIYIFAWHRGNLDSGRIILVGIAINSGFSA
FT                   LSLFLSLKMDPQDYQMAMVWKNGSIWSANWTYITAVLPWMLVFIPILIAKSRLLDTIRF
FT                   DEDTVRSLGISSNKEKTILLIACVAIISACVSVAGSMAFVGLIAPHISRRLAGVEHRDI
FT                   LPLSGLIGMLLVISADFAGKLFFQPAEVPAGIILAILGVPYFLYLLFKQKKGGNA"
FT   gene            complement(170850..171854)
FT                   /gene="feuB"
FT                   /locus_tag="BSUW23_00840"
FT   CDS_pept        complement(170850..171854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuB"
FT                   /locus_tag="BSUW23_00840"
FT                   /product="iron-uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36225"
FT                   /db_xref="GOA:E0U054"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0U054"
FT                   /protein_id="ADM36225.1"
FT                   /translation="MYSKQWTRIILITSPFAIALSLLLSILYGAKHLSTDIVFTSLIHF
FT                   DPGNTDHQIIWHSRIPRAAGALLIGAALAVSGALMQGITRNYLASPSIMGVSDGSAFII
FT                   TLCMVLLPQSSSFEMIIYSFIGSALGAVLVFSLAAMMPNGFSPVQLAIIGTVTSMLLSS
FT                   LSAAMSIYFQISQDLSFWYSARLHQMSPDFLKLAAPFFLIGIVMAISLSKKVTAVSLGD
FT                   DISKSLGQKKKTIKIMAMLSVIILTGSAVALAGKIAFVGLVVPHITRFLVGSDYSRLIP
FT                   CSCILGGIFLTLCDLASRFINYPFETPIEVVTSIIGVPFFLYLIKRKGGEQNG"
FT   gene            complement(171873..172826)
FT                   /gene="feuA"
FT                   /locus_tag="BSUW23_00845"
FT   CDS_pept        complement(171873..172826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuA"
FT                   /locus_tag="BSUW23_00845"
FT                   /product="iron hydroxamate-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36226"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E0U055"
FT                   /protein_id="ADM36226.1"
FT                   /translation="MKKISLTLLILLLVLTAAACGNKNESTASKASGTASEKKKIEYLD
FT                   KTYEVTVPTDKIAITGSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEATGEKT
FT                   EPNIEKILEMKPDVILASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLAQLTGKE
FT                   KKAKKIIANYEQDLKETKTKINEKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGL
FT                   KAPDEVKAAKAQELISLEKLSEMNPDHIFVQFSDDENADKPEALKDLEKNPIWKSLKAV
FT                   KEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLTQN"
FT   gene            complement(172917..174506)
FT                   /gene="ybbB"
FT                   /locus_tag="BSUW23_00850"
FT   CDS_pept        complement(172917..174506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="BSUW23_00850"
FT                   /product="putative transcriptional regulator (AraC/XylS
FT                   family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36227"
FT                   /db_xref="GOA:E0U056"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E0U056"
FT                   /protein_id="ADM36227.1"
FT                   /translation="MQNTVIYHPIQIEYLKKTSDLFSEQQLADSFVLIFHLKGNGHISI
FT                   GTNISPLQKKTLYVCPPNETFGFTPAAQGHIDACLIRLQSYVKETGQDILTPCIETELA
FT                   KLKLVNVSHIENLAVRLQELIALWNESSQLSQLKCVIEVQSLIYDLFTANLSDQTDTHS
FT                   AIEKTKQYIETHADTKITLAQLSQMAGISAKHYSESFKKWTGQSVTEFITKTRITRAKR
FT                   LMARSNCKLKEIAHQTGYQDEFYFSRIFKKHTGCSPTSYMKKRRKKIAAYGRGTIGHLI
FT                   PLNHIPFAAALHPKWTSYYYQHYSTDIPVQLSAYRFNEKWEENLNTLSQAEPDVIFSMD
FT                   SISPAEKNRLNCIAEVIYLPSEESWRTHFLQTASFLKEESEAEKWLAAYDQQAAAGKKT
FT                   LQHAQKLRFLFLRLHKQNFYLAHNRSVREVFFGDLGFHSARTKDTSSDQAISLENIAND
FT                   QADCIMLFLFKEPETLAYYQQLQQTEAWQNLSAVRNNRVYLLSFDPWNEYSAYGHERIV
FT                   QQTISLLSGDCP"
FT   gene            complement(174697..175941)
FT                   /gene="ybbC"
FT                   /locus_tag="BSUW23_00855"
FT   CDS_pept        complement(174697..175941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="BSUW23_00855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36228"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:E0U057"
FT                   /protein_id="ADM36228.1"
FT                   /translation="MRKTIFTFLTGLMMIGTITAVSASPDSKNQTAKKPKVQTGIDTLF
FT                   PDYKKQLKGKRIGLITNPTGVNASLKSSVDILYENPDIKLTALFGPEHGVRGDAQAGDE
FT                   VGSYIDEKTGIPVYSLYGKTKKPTPEMLKNVDVLMFDIQDVGTRYYTYIYTMAYAMEAA
FT                   KENGIPFMVLDRPNPQGGIHIEGPVLEPEYASFVGLYPIPLKHGMTIGELALLFNKEFD
FT                   INADLTVVKMKHWKRKMDFNDTRLPFVLPSPNMPTVESTLVYPATGLIEGTNISEGRGT
FT                   TKPFELIGAPFIKSTELEETLNSLNLPGVTFRAASFTPTFSKHQGTLCHGVQLYVTDRE
FT                   KFEAVKTGLSLIKTIHDLYPEHFEFLSTGSFDKLAGNGWIRTKIENGASIEDIIASYEK
FT                   PLQQFGKTRKKYLIY"
FT   gene            complement(175955..177883)
FT                   /gene="ybbD"
FT                   /locus_tag="BSUW23_00860"
FT   CDS_pept        complement(175955..177883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="BSUW23_00860"
FT                   /product="putative beta-hexosaminidase, putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36229"
FT                   /db_xref="GOA:E0U058"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E0U058"
FT                   /protein_id="ADM36229.1"
FT                   /translation="MKPVFPLILSAVLFFSCFLGASQTKATSSSGSADAKQIVNRMTLD
FT                   EKLGQMLMPDFRNWQKEGESSPQAFTEMNEEVAGLIKKYQFGGVILFAENVKTTQQTVQ
FT                   LTDAYQKASPKIPLMLSIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGTIIGKE
FT                   LSALGINTDFSPVMDINNNPDNPVIGVRSFSSNRELTARLGLYTMKGLQRQDIASALKH
FT                   FPGHGDTDVDSHYGLPLVSHSQERLREVELYPFQRAIDAGADMVMTAHVQFPAFDDTTY
FT                   KSKLDGSDILVPATLSKKVMTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAIK
FT                   AGVDIALMPASVTSLKEEQKYARVIQALEEAVKNGDIPEHQINKSVERIISLKIKRGMY
FT                   PARNDDSIKEKIDKAQKIVGSKHHLKAEKKIAEKAVTVLKNEQHTLPFKPKKDSRILIV
FT                   APYEEQTASIEQTIRDLVKRKKIKPVSLSKMNFANQVFNAEHEKQVKEADYIITGSYVV
FT                   KNDPVVNDGVIDDTISDSSKWATVFPRAVMKATLQHNKPFVLMSLRNPYDAANFEEAKA
FT                   LIAVYGFKGYANGRYLQPNIPAGVMAIFGQVKPKGTLPVDIPSVTKPGDILYPYGYGLN
FT                   IKTGKPL"
FT   gene            complement(177911..179074)
FT                   /gene="ybbE"
FT                   /locus_tag="BSUW23_00865"
FT   CDS_pept        complement(177911..179074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbE"
FT                   /locus_tag="BSUW23_00865"
FT                   /product="putative protein precursor; beta-lactamase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36230"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/TrEMBL:E0U059"
FT                   /protein_id="ADM36230.1"
FT                   /translation="MIERDIAAGFPGAVLVVVKDGRIIKKEAYGYSKKYEGSELLRRPT
FT                   KMKTRTMFDLASNTKMYATNFALQRLVTQGKLDVYEKISAYLPDFKDQPGDLIKGKDKI
FT                   RVIDVLHHQSGLPSSFYFYTPEKAGMYYSQERDKTVEYLTKIPLDYHTGTKHVYSDIGY
FT                   MLLGCIVEKLTGKPLDVYAEQELYKPLKLKHTLYNPLQKGFKPKQFAATERMGNTRDGV
FT                   IHFPNIRTNTLQGEVHDEKAFYSMDGVSGHAGLFSNADDMAILLQVMLNKGSHRNISLF
FT                   DQKTADLFTAPSATDPTFALGWRRNGSKSMEWMFGPYASENAYGHTGWTGTVTIVDPTF
FT                   NLGIALLTNKKHSPVADPEENPNVFEGDQFPTGSYGSVITAIYEAME"
FT   gene            complement(179292..180659)
FT                   /gene="ybbF"
FT                   /locus_tag="BSUW23_00870"
FT   CDS_pept        complement(179292..180659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbF"
FT                   /locus_tag="BSUW23_00870"
FT                   /product="putative sugar phosphotransferase enzyme II"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36231"
FT                   /db_xref="GOA:E0U060"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E0U060"
FT                   /protein_id="ADM36231.1"
FT                   /translation="MSKENNYNHLAKKILELCGGKSNISSYTHCMTRLRITPYDESKAD
FT                   AQALRELDGVLGVVEAETIQIILGTGVVNHVTAAFSKLVSAEEGVDVKEAAAKKKADIN
FT                   RKNATPFKLFLRKIASIFIPLIPALVASGLITGITKAIIQAGWLSAESQIAIILTVIGS
FT                   GLFTYLGILVGINASKEFGGTPALGALAGILIMNPEIAKISLFGEQLLPGRGGLIGVLF
FT                   AAIFIAYTEQFIRRFIPQSLDIIVTPTVSLLITGIVTYVVFMPLGGFISDAITSGLLSI
FT                   LDIGGIAAGFILGATFLPLVVTGLHQGLTPVHMELINSIGNDPLLPILAMGGAGQVGAA
FT                   FAIFVKTKKSTLRKAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAY
FT                   FQVATIAIGVSGLPLSFLVLSSQIILYIIGLFISYAAGFLLTYAFGYKEEMASQFD"
FT   gene            complement(180685..181536)
FT                   /gene="ybbH"
FT                   /locus_tag="BSUW23_00875"
FT   CDS_pept        complement(180685..181536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbH"
FT                   /locus_tag="BSUW23_00875"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36232"
FT                   /db_xref="GOA:E0U061"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E0U061"
FT                   /protein_id="ADM36232.1"
FT                   /translation="MATGGLAIIQSMKHKLPPSERKLADYILTHPHKAIESTVSEISAL
FT                   ANSSDAAVIRLCKSLGLKGFQDLKMRVAGDLAKPAVQGYRDIAPREPLSSISEKAAGNA
FT                   IQAIQDTSDLMDYKELERAVSLLLKAHTVHFIGVGASGIVAKDAQQKWLRIHKQATAFT
FT                   DTHLVASLIANADKDDIVFAISFSGETQEIIELITMAKEKGITTISLTQFSQTSVSALA
FT                   DVPLYTTHSNEALIRSAATSSRLAQLFMIDVLFLGMAAEQYEETTGYIDKTKAAIQSMR
FT                   KK"
FT   gene            complement(181550..182467)
FT                   /gene="murQ"
FT                   /locus_tag="BSUW23_00880"
FT   CDS_pept        complement(181550..182467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="BSUW23_00880"
FT                   /product="N-acetylmuramic acid-6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36233"
FT                   /db_xref="GOA:E0U062"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:E0U062"
FT                   /protein_id="ADM36233.1"
FT                   /translation="MSKPLNLHRLTTESRNSQTAEIHKANTLGILKMINNEDLKVAAAV
FT                   QQVLPDIKTAVDCAYDSFQNGGRLIYTGAGTSGRLGVMDAVECPPTYSVSPDQVIGIMA
FT                   GGPKAFLQAAEGIEDSEKAGAEDLKNIQLTSNDTVIAIAASGRTPYAAGALTYARKVGA
FT                   HTIALTCNENSAISKDADHSIEVVVGPEAITGSTRMKAATAHKMILNMISTAVMVKIGK
FT                   VYENLMVDVNVSNKKLKERAISIIQSLTNASYDTARHTLEKANHHVKTAIVMLKTSTDQ
FT                   EQAKTLLDETNGFIDKAIEHYHSR"
FT   gene            complement(182577..183059)
FT                   /gene="ybbJ"
FT                   /locus_tag="BSUW23_00885"
FT   CDS_pept        complement(182577..183059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="BSUW23_00885"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36234"
FT                   /db_xref="GOA:E0U063"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0U063"
FT                   /protein_id="ADM36234.1"
FT                   /translation="MTQDISLSFYKPEHLPELQSFTLKNDDKRFTSLPKEVLTQALSIR
FT                   DRYPVVILKDDLPVGFFILHTSKETLAPYSNNPFALLLSSLSLHAVHHGKGYAKKAMLQ
FT                   LPSFVSGYFPWCDEIILAVNHLNTRAKHLYMKSGFLDKGRRRIGPLGEQLILHYFL"
FT   gene            complement(183072..183527)
FT                   /gene="ybbK"
FT                   /locus_tag="BSUW23_00890"
FT   CDS_pept        complement(183072..183527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="BSUW23_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36235"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:E0U064"
FT                   /protein_id="ADM36235.1"
FT                   /translation="MILVSSCLGGIECRYNGSHAASEKIRKLIDENEAVMACPELLGGF
FT                   STPREPAEIIGGTGEDVLNGTAKIVTVSGEDVTELYMEGAAKTLAYAKEINASTVILKE
FT                   NSPSCGSGFIYNGTFSGQKIPGSGVTAALLKQAGYHVISENQLDDIL"
FT   gene            183708..183782
FT                   /locus_tag="BSUW23_t20488"
FT                   /note="trnSL-Glu2"
FT   tRNA            183708..183782
FT                   /locus_tag="BSUW23_t20488"
FT                   /product="tRNA-Glu"
FT   gene            183786..183861
FT                   /locus_tag="BSUW23_t20490"
FT                   /note="trnSL-Val1"
FT   tRNA            183786..183861
FT                   /locus_tag="BSUW23_t20490"
FT                   /product="tRNA-Val"
FT   gene            183866..183938
FT                   /locus_tag="BSUW23_t20492"
FT                   /note="trnSL-Thr1"
FT   tRNA            183866..183938
FT                   /locus_tag="BSUW23_t20492"
FT                   /product="tRNA-Thr"
FT   gene            183960..184044
FT                   /locus_tag="BSUW23_t20494"
FT                   /note="trnSL-Tyr1"
FT   tRNA            183960..184044
FT                   /locus_tag="BSUW23_t20494"
FT                   /product="tRNA-Tyr"
FT   gene            184052..184126
FT                   /locus_tag="BSUW23_t20496"
FT                   /note="trnSL-Gln2"
FT   tRNA            184052..184126
FT                   /locus_tag="BSUW23_t20496"
FT                   /product="tRNA-Gln"
FT   gene            184352..184915
FT                   /gene="sigW"
FT                   /locus_tag="BSUW23_00895"
FT   CDS_pept        184352..184915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="BSUW23_00895"
FT                   /product="RNA polymerase sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36236"
FT                   /db_xref="GOA:E0U065"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E0U065"
FT                   /protein_id="ADM36236.1"
FT                   /translation="MEMMIKKRIKQVKKGDQDAFADIVDIYKDKIYQLCYRMLGNVHEA
FT                   EDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNLTIDRIRKKKPDYYLDAEVAGTEGL
FT                   TMYSQIAADGVLPEDAVVSLELSNTIQQKILKLPDKYRTVIVLKYIDELSLIEIGEILN
FT                   IPVGTVKTRIHRGREALRKQLRDL"
FT   gene            184929..185555
FT                   /gene="rsiW"
FT                   /locus_tag="BSUW23_00900"
FT   CDS_pept        184929..185555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="BSUW23_00900"
FT                   /product="anti-sigma(W) factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36237"
FT                   /db_xref="GOA:E0U066"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E0U066"
FT                   /protein_id="ADM36237.1"
FT                   /translation="MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEME
FT                   KSIALVRSTSHVEAPADFTANVMAKLPKEKKRASVKRWFRTHPVIAAAAVFIILMGGGF
FT                   FNSWHNDQNFSVSKQPNLVVHNHTVTVPEGETVKGDVTVKNGKLIIKGKIDGDVTVVNG
FT                   EKYMASAGQVTGQIEEINQLFDWTWYKMKSAGKSVVNALNPKGKE"
FT   gene            185722..186543
FT                   /gene="ybbP"
FT                   /locus_tag="BSUW23_00905"
FT   CDS_pept        185722..186543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="BSUW23_00905"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36238"
FT                   /db_xref="GOA:E0U067"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:E0U067"
FT                   /protein_id="ADM36238.1"
FT                   /translation="MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIV
FT                   VIVLVRMASQYLGLSTLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   VEEAQQKTIEAITKAINYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNNEIAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVS
FT                   EETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG"
FT   gene            186536..187990
FT                   /gene="ybbR"
FT                   /locus_tag="BSUW23_00910"
FT   CDS_pept        186536..187990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /locus_tag="BSUW23_00910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36239"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:E0U068"
FT                   /protein_id="ADM36239.1"
FT                   /translation="MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTS
FT                   TTDEATLTDIPVKAYYDDENYVVTGVPQTVNVTIKGSTSAVKKARQTKNFEIYADMENL
FT                   KTGTHKVELKAKNVSDGLTISINPSVTTVTIQERTTKSFPVEVEYYNKSKMKKGYSPEQ
FT                   PIVSPKNVQITGSKNVIDNISLVKASVNLENADETIEKEAKVTVYDKDGNALPVDVEPS
FT                   VIKITVPVTSPSKKVPFKIERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDGV
FT                   SLDLSKINKDSDIEADIPLPDGAKKISPSKVTLHIEVDSEADQKFENVSIKTVGLSSSQ
FT                   NIEFLDPESQAIDVTAKGSPANIKKLKKSDIELYVNVSDLDDGEHSVKLEVNGPQNVTW
FT                   SLGQKSAKIKLTSKKSNTSTNDNSSNTSGNQDDTDKQTNNQKNNQQEDTTNTDKDSNDQ
FT                   KQDENKDQNQDQDEDESTADSQSTSE"
FT   gene            188009..189355
FT                   /gene="glmM"
FT                   /locus_tag="BSUW23_00915"
FT   CDS_pept        188009..189355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BSUW23_00915"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36240"
FT                   /db_xref="GOA:E0U069"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E0U069"
FT                   /protein_id="ADM36240.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFKVGRFGGYVLTKDKQRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQEAEIERLMDEPEDRLPRPVGADLGLVNDYFEGGQKYLQFL
FT                   KQTADEDFTGIHVALDCAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALSAFVKEKNADLGLAFDGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVV
FT                   STVMSNLGFYKALEKEGIKSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
FT                   GLLSAIMLMNTLKATGKPLSELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCDEYVNRIVEVVRSEMGLE"
FT   gene            189528..189653
FT                   /locus_tag="BSUW23_miscRNA5"
FT   ncRNA           189528..189653
FT                   /locus_tag="BSUW23_miscRNA5"
FT                   /product="glmS riboswitch leader"
FT                   /note="ribozyme that cleaves itself when there is a
FT                   sufficient concentration of glucosamine-6-phosphate;
FT                   BSUW23_misc_RNA_5"
FT                   /ncRNA_class="ribozyme"
FT   gene            189787..191589
FT                   /gene="glmS"
FT                   /locus_tag="BSUW23_00920"
FT   CDS_pept        189787..191589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BSUW23_00920"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36241"
FT                   /db_xref="GOA:E0U070"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:E0U070"
FT                   /protein_id="ADM36241.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEQGIHVF
FT                   KEKGRIADLREVVDANIEAKAGIGHTRWATHGEPSYLNAHPHQSALGRFTLVHNGVIEN
FT                   YVQLKQEYLQDVELKSDTDTEVVVQVIEQFVNGGLDTEEAFRKTLTLLKGSYAIALFDN
FT                   ENRETIFVAKNKSPLLVGLGDTFNVVASDAMAMLQVTNEYVELMDKEMVIVTDDQVVIK
FT                   NLDGDVISRASYIAELDASDIEKGTYPHYMLKETDEQPVVMRKIIQTYQDENGKLSVPG
FT                   DIAAAVAEADRIYIIGCGTSYHAGLVGKQYIEMWANVPVEVHVASEFSYNMPLLSKKPL
FT                   FIFLSQSGETADSRAVLVQVKALGHKALTITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAVLASVAADKNGIDIGFDLVKELGIAANAMEALCDQKDEMEMIAREYLT
FT                   VSRNAFFIGRGLDYFVCVEGALKLKEISYIQAEGFAGGELKHGTIALIEQGTPVFALAT
FT                   QEHVNLSIRGNVKEVAARGANTCIISLKGLDDADDRFVLPEVNPALAPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            192364..193881
FT                   /gene="ndhF"
FT                   /locus_tag="BSUW23_00925"
FT   CDS_pept        192364..193881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="BSUW23_00925"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36242"
FT                   /db_xref="GOA:E0U071"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:E0U071"
FT                   /protein_id="ADM36242.1"
FT                   /translation="MLVSLSLSSLLTLFFMTLIASGISGLLFLHPRVPLGYIRIHIGIL
FT                   ALPPLVSLVNLANKSVEGNVGPWYFDSLAWLMTFFVLTIGLIIQRFSVRYLMGDRSYRK
FT                   YFTLFTFTTGAASIAWLSGDLRLMVIFWGATLVGLTLLIRLNSAWQVASEAAKVSGRLF
FT                   LLSWFSLFFAMIWLFQVTGQWQLSLVLTNESLAQLGGWERTGINLLIVLAVIIPAAQWP
FT                   FQRWLIESIVAPTPVSAIMHAGLVNAGGIILARFSPLFNGGIASIILLMLASISVLIGT
FT                   GISLVQVDYKRQLVGSTIGQMGFMLIQCALGAYIAAIIHLILHGLFKATLFLQAGSAVR
FT                   RHEGSARANEGTSYLWIMAGRILSLVIGVAFWLVAPGEGYQFISALILGWSLSVSWTQL
FT                   VAFGEGRIGRIAGLTFLGGGAFVYFIIHNLFYKWLHTSVFQSVQPPMSAVIIVVCLLLF
FT                   GSALGTWVARHRSSVLFAVLYLWLVRLGEAKPKTVESHPDYLKQFLS"
FT   gene            193896..196514
FT                   /gene="ybcC"
FT                   /locus_tag="BSUW23_00930"
FT   CDS_pept        193896..196514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /locus_tag="BSUW23_00930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36243"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/TrEMBL:E0U072"
FT                   /protein_id="ADM36243.1"
FT                   /translation="MGITSVLTKENVKKKDTEIDFQDRDINVLIESASRVIAPLWPIST
FT                   FAARSPWMGLENQPFDQVASWLKQTRDVDIYPSASMIRSAKNKGEIDEDFVKMGLQRWL
FT                   DSHSFNIPRDVAERFCHAGLQLDPLPSSLLSSHKLEKLVNEFSGLDHIENFFMQPISSY
FT                   IENQDGEKLVNILDHHVIKWCKLYLDDSQAGWTMPNREEGFYRAWQQLIQYDPALSKKQ
FT                   RERLKGWPQEAHMALQEALFALEIPESEIQTYLEGHLLSLPGWAGMMLWRSQQSSHEHA
FT                   LLTEYLAVRISMEWALIKPYLPLNTQRSGKEISITPLLAAWIHWGSLTLEEWSQMPANE
FT                   QNEYLSFAYSFDEKLRRKLWLEAWEQTHTDRLSQKIISKQRETDGKKSAIAQLAFCIDV
FT                   RSEPFRRQLEKAGPFETIGVAGFFGVPIATCELGSKHSHASLPVIQKPQNKIKEFVDED
FT                   VLEKYNQRKQAVHSVSHTFKTMKQNVLTSLLLPELSGPWLSLQMVARSFVPRKADRFIR
FT                   HLRETWLRKPDTKLSLHHDDDTEAEIPVGFTEEEKVNYARQALKMMGLTENFAPLVVIC
FT                   GHGSQSTNNPYTAALDCGACGGAAGGFNARVLAALCNLSEVREVLLTEGMKIPEDTVFA
FT                   AAEHHTTVDELHWIYVPELSEAAQEAFERIEAVMPKVSHNANAERLAQLPNFQSKLKNP
FT                   KAEAHRFAGDWSEIRPEWGLARNAAFIIGQRELTKDCDLEGRAFLHNYDWKQDESGELL
FT                   ANIIAGPGTVAQWINLQYYASTVAPHYYGSGSKATQTVTAGLGVMQGNASDLLAGLPWQ
FT                   SVMQSDHEAYHSPLRLLIVIQAPKEYVERLLNNDSAFLEKVQNGWVRLASVDPEGHWEN
FT                   W"
FT   gene            196587..197105
FT                   /gene="ybcF"
FT                   /locus_tag="BSUW23_00935"
FT   CDS_pept        196587..197105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="BSUW23_00935"
FT                   /product="putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36244"
FT                   /db_xref="GOA:E0U073"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E0U073"
FT                   /protein_id="ADM36244.1"
FT                   /translation="MNVDKNKKVLFLTDIENGLEPILQEVTHTPAENMLTIQSYGADIS
FT                   HPYGEIMRSVIIAIYQEDVEEVFVVGTKDKRTSTGHILTQLETMKDKLQTLDYLFQNCR
FT                   PEFSGGTFDEWLNGNENSSDAIEKSVDIIRHHPLVPSYVKVRGLLVHHKGGKSSIEEVP
FT                   TVKTASSLT"
FT   gene            197186..197476
FT                   /gene="ybcH"
FT                   /locus_tag="BSUW23_00940"
FT   CDS_pept        197186..197476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="BSUW23_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36245"
FT                   /db_xref="UniProtKB/TrEMBL:E0U074"
FT                   /protein_id="ADM36245.1"
FT                   /translation="MDSNLTDFVMKAIEEINPFDRESIECMKKVIRKAIDFYHLKTYEE
FT                   VEETHVGSVRFLHVHSIMEENMLSKIVVVIRNGETDLDIEGVYEGHVVREY"
FT   gene            197532..197906
FT                   /gene="ybcI"
FT                   /locus_tag="BSUW23_00945"
FT   CDS_pept        197532..197906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="BSUW23_00945"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36246"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:E0U075"
FT                   /protein_id="ADM36246.1"
FT                   /translation="MKKSKGSFESEISKSITQWEKDYLGRGSVSVKTDILRDMIIVNLK
FT                   GILTPAEYAVCGSKEGMLSIKQTRSELVESGIEGLKDIILTITGEEVKSFHTDLSSRTG
FT                   ERVMVFKLFNDLEKNLEKIL"
FT   gene            198595..199572
FT                   /gene="ybdG"
FT                   /locus_tag="BSUW23_00950"
FT   CDS_pept        198595..199572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="BSUW23_00950"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36247"
FT                   /db_xref="GOA:E0U076"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U076"
FT                   /protein_id="ADM36247.1"
FT                   /translation="MKTLWKVLKVFFGSLAALVFLVSVSVFMYHHYQLNKEAALLKGKG
FT                   TLVDVDGKKMNVYEEGSGKDTFVFMSGSGIAAPVYEMKGVYRKFSKENKIAVVDRAGYG
FT                   YSDVSHDDRDIDTVLEQTRKALMKSGNKPPYILMPHSISGIEAIYWAQKYPKEIKAIIA
FT                   MDIGLPQQYVTYKLSRIDRLKVRGFHLLTSIGVHRFMPSAVYNPEVIRQSFLTDEEKEI
FT                   YKAINFKQFFNADMEHELLQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNR
FT                   KDYEAFAAQFNTAEIKELRGTHSIYLYQPDQIYKLSMEFMRKVR"
FT   gene            199574..200245
FT                   /gene="ybdJ"
FT                   /locus_tag="BSUW23_00955"
FT   CDS_pept        199574..200245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="BSUW23_00955"
FT                   /product="two-component response regulator (YbdK)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36248"
FT                   /db_xref="GOA:E0U077"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0U077"
FT                   /protein_id="ADM36248.1"
FT                   /translation="MKGYHILIVEDDVTIGDLLQKILQREGYHVMWKTDGADVLTVIQK
FT                   VDLVIMDVMLPGEDGYQMSAKIKKLGLRIPVIFLSARNDMDSKLQGLQIGEDYMVKPFD
FT                   PRELLLRMQNMLEHHYGTFTQIKHLYIDAETKKVFNESLHDEVLFTAIERKIFFYLYDN
FT                   RDSTLTKEHFFEYLWQLEDRNPNIVNVHIKKIRAKIKDQAGEIIENIYGEGYRLNTVVK
FT                   K"
FT   gene            200326..201234
FT                   /gene="ybdK"
FT                   /locus_tag="BSUW23_00960"
FT   CDS_pept        200326..201234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="BSUW23_00960"
FT                   /product="two-component sensor histidine kinase (paired
FT                   with YbdJ)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36249"
FT                   /db_xref="GOA:E0U078"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U078"
FT                   /protein_id="ADM36249.1"
FT                   /translation="MSVIYDSMFKSINHDMPFHRSFAYPAMLVVFLLSLLLLAFLFSKS
FT                   IHSLLHKINLLNQTIRHLASDQKVPDKIEVKRADEIGELTKSVNLLIERTTYRELELRQ
FT                   QEGIKKELLQKLRHDINTPLTALRLQLFYLEGQCHDQAVFESLYQQIHYIAELTNEFNL
FT                   YSAETLERSYIINEEVSLNELLETAVKKWDYLYSMNGIELLYKPADQDMIWVSNRLWMQ
FT                   RLFDNIFQNTLKHSKAKKMEVMIEHGTVSICDDGIGFDRDENSEGLGLKIIEDICRLLH
FT                   ITYLLKTDKTGTHFNLKNDKL"
FT   misc_feature    201460..214182
FT                   /note="rhizocticin biosynthetic gene cluster"
FT   gene            complement(201460..202350)
FT                   /gene="rhiA"
FT                   /locus_tag="BSUW23_00965"
FT   CDS_pept        complement(201460..202350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiA"
FT                   /locus_tag="BSUW23_00965"
FT                   /product="probable transcriptional regulator of the
FT                   rhizocticin synthesis genes"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36250"
FT                   /db_xref="GOA:E0U079"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U079"
FT                   /protein_id="ADM36250.1"
FT                   /translation="MNLHALRLFYTVAEEGNVTCAAKKLNISQPAVTAQIKKLEKEIGL
FT                   TLLSPRGRGIYLTQTGLQLAKQAKRLFSLQNEIESYLEHLKEGSVGKLHIVATSLPANF
FT                   LLPKWISRFKGEYPDVDVEITTVNSTEAISQLVNYKADIGIIGGNRTFNKHISSTLLLE
FT                   DEMVFISNNKHKYAEQTTTLAEIVKEPFVFREEGSFSRELLFSLCNLFNVNKPCTGLQM
FT                   NGLNETINTVIEGYGITFVSFLEVNRYISRGDVKRINVEHVDVTNPISLCWRNDDVIST
FT                   SAFNFIELIRKEKME"
FT   gene            202505..203806
FT                   /gene="rhiB"
FT                   /locus_tag="BSUW23_00970"
FT   CDS_pept        202505..203806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiB"
FT                   /locus_tag="BSUW23_00970"
FT                   /product="threonine synthase"
FT                   /note="distantly related to the major threonine synthase,
FT                   ThrC; possibly involved in rhizocticin self-resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36251"
FT                   /db_xref="GOA:E0U080"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E0U080"
FT                   /protein_id="ADM36251.1"
FT                   /translation="MKLVCIDCGQEMSSDDFKYQCSCGGLVDIVHDFSHYDTDHLKHVF
FT                   HERLSERMSVFASGVWRYKELIYPDLPVESIVTKYEGNTGLYRSEMLSKYTGVRKVYLK
FT                   AQSENPSGSFKDNGMTVAVSHGKHLGYEKYACTSTGNTSSSLGMYASIANASSYVFVPD
FT                   KEISINKVLQTAAYGGNVFSIPGTYDDGIRFLEKYSGDFGFYICNSINPFRIEGQKSII
FT                   YEIAQYLDWKLPDWIIVPGGALSNATALGKGLRDLYALNFIDKIPRVAIIQAEGASPFH
FT                   QMISKNKETIDPEPFPYTRASALNIGNPPSWKKARKVLEDTNGITVSVTDEDILDAKAI
FT                   IDRTGVGCEPASASTAAGLRQLRSQQVIDKDESVLCILTGNILKDTGALHDYHFGKDLN
FT                   GKFKNNIKSAELSFGKIKSAMETIRDLNGLLKIH"
FT   gene            203843..205069
FT                   /gene="rhiC"
FT                   /locus_tag="BSUW23_00975"
FT   CDS_pept        203843..205069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiC"
FT                   /locus_tag="BSUW23_00975"
FT                   /product="putative amino acid ligase of ATP-grasp
FT                   superfamily"
FT                   /note="probable ATP-dependent formation of peptide or
FT                   thioester bonds in rhizocticin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36252"
FT                   /db_xref="GOA:E0U081"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:E0U081"
FT                   /protein_id="ADM36252.1"
FT                   /translation="MSILILNKTSYSKSPYDLWLKDLEEPVVMLTSTERLHECKNYDQI
FT                   ESFDEYPVNGCIEIRALELHETYSFNTIIAMSEYDLLRAGKLRTHLGLKGQSYESALLF
FT                   RDKVLMKQRLEEQGIPVPHYRKIESPVDLYLFVQQFGFPVVVKPIDGSGSVDTKVLKNE
FT                   KDMMKYLSKGLDGNVEVETFVDGDMYHIDGLMIDGHITLNWPSRYINGCLAFQEEQFLA
FT                   SYQLGADNPLTSRLIGIVEKALKALPSPKTTTFHAEVFHTPDDKLVFCEIASRTGGGLI
FT                   REAIQQGFGFDLNEVCVKKQCGLPYDIPDYSQLKIGPKQLGGWILIPPKYGRLVKIPSI
FT                   PFENWVTKQKVSAREGEVFQGASSSVDVVSSYLIKGNSEDVLINRIHQVASWCSENMIW
FT                   EGKSTCSLK"
FT   gene            205054..206277
FT                   /gene="rhiD"
FT                   /locus_tag="BSUW23_00980"
FT   CDS_pept        205054..206277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiD"
FT                   /locus_tag="BSUW23_00980"
FT                   /product="probably exporter of rhizocticins from the cell"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36253"
FT                   /db_xref="GOA:E0U082"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U082"
FT                   /protein_id="ADM36253.1"
FT                   /translation="MFSQIKEFFGLHPVIKFLLLGTLVTKAAKSMTTPFLAIYLHQETG
FT                   EGFGVIGLVIGLGYFATTIGGIIGGTLSDRIGRKSVMLCSIFIWSVVFFLFGIVHTILW
FT                   FSLLNILSGLCHSFFEPVSKALMVELADRKKRLSIFSLRYLAINIGGALGPLLGTYLGL
FT                   VSSGTPFIITGSVYLCYALLLFFMMNKLLLQNKSNSKKEFHLPFIFKTLKKDIALRFYI
FT                   AGGIFLLFSYSQMESTLLQYLNLDFVNGVKIFSTLITINAVTVIILQLPLTRLFERYKS
FT                   MTTISAGSVCCIIGNIGFALSNGWLTFCISMFILTVGEILCFPSMNVLMDELAPDSMRG
FT                   TYYGAQNFYNVGEFIGPWLGGIILSLFGGTTIFLVAALSICFALTAYRIGNRKHRFVQL
FT                   YEAEVMNK"
FT   gene            206313..206816
FT                   /gene="rhiE"
FT                   /locus_tag="BSUW23_00985"
FT   CDS_pept        206313..206816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiE"
FT                   /locus_tag="BSUW23_00985"
FT                   /product="putative phosphonopyruvate decarboxylase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36254"
FT                   /db_xref="GOA:E0U083"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E0U083"
FT                   /protein_id="ADM36254.1"
FT                   /translation="MNSTAERMLSTLTENNYTHFTGVPCSLLKGFFRLLESKEAIEKQN
FT                   ITFIPSIREDSALGVASGMYLGGRKCVMLMQNSGLGYCLNVLTSFNFIYDIPILLLISW
FT                   RGAYGNDAVEHDIIGEKLTDLLDSVDIPYKELDYENSEGTILDALFLIEKTNRPVAILI
FT                   KDEI"
FT   gene            206828..207388
FT                   /gene="rhiF"
FT                   /locus_tag="BSUW23_00990"
FT   CDS_pept        206828..207388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiF"
FT                   /locus_tag="BSUW23_00990"
FT                   /product="putative phosphonopyruvate decarboxylase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36255"
FT                   /db_xref="GOA:E0U084"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E0U084"
FT                   /protein_id="ADM36255.1"
FT                   /translation="MNKHDAIQLILGQFPSAYLVSTCGHISRDLYNINDRARNFYMVGS
FT                   MGMAAPVGLGLSTVYPDVPLVVLDGDGSFLMNMGIITMIGHQKPKNFIHVVLDNGMHES
FT                   TGGQRTVPLVNVTDIALQVGYEYAIEINSGQKSFDLPNEGPGLIHIKVEPRSEKIGKRV
FT                   HWTPQEIVQRFTNELTLENEVSV"
FT   gene            207385..208398
FT                   /gene="rhiG"
FT                   /locus_tag="BSUW23_00995"
FT   CDS_pept        207385..208398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiG"
FT                   /locus_tag="BSUW23_00995"
FT                   /product="putative aldolase class II"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36256"
FT                   /db_xref="GOA:E0U085"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0U085"
FT                   /protein_id="ADM36256.1"
FT                   /translation="MKMQLIDCTLRDGGNFNNWFFSAEDINQIILHLDKANVNIIEIGY
FT                   IGGSGSNKEKSVGSLANCTPELLEQLPKTIHSHLAAMVVPSVCELHLLDNLNPQLIPWI
FT                   RVASYPHNAEDALPYIEYLKNRGFHVSFNVMAASYIEEKDMAELAKKSHVFGADVFYMA
FT                   DSFGNLTPDGVRKRVAAAFDQADCPVGFHGHNNLGLAFTNALEAMDAGATFIDTSLCGM
FT                   ARGAGNLPTEQFVSAIHHWDKFGDIPYKLHPILTAAEYVLSSILSSPMKISTPEIISGI
FT                   SNIHYYFYDLVISKCREVNLDPLQVSTLLGQTLPKRVDMSYIESVIDQNFRQESAK"
FT   gene            208395..209285
FT                   /gene="rhiH"
FT                   /locus_tag="BSUW23_01000"
FT   CDS_pept        208395..209285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiH"
FT                   /locus_tag="BSUW23_01000"
FT                   /product="phosphoenolpyruvate mutase"
FT                   /note="probably catalyzes first step in rhizocticin
FT                   biosynthetic pathway, the conversion of PEP to PnPy;
FT                   COG2513 PEP phosphonomutase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36257"
FT                   /db_xref="GOA:E0U086"
FT                   /db_xref="InterPro:IPR012698"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0U086"
FT                   /protein_id="ADM36257.1"
FT                   /translation="MKAKKLRELLYSNQVVRVMGAHNGLSAKLAEQAGFHAIWASGLEI
FT                   SASYAVPDANILTMTENLQAAVVMNESTSIPIICDCDSGYGSVNNVIRMVKEYERNGIA
FT                   GICIEDKQFPKLNSFVKGSQKLADIDEFSNKIRAAKDVQKNPDFVVIARIEALIAGQGM
FT                   DEALNRAYAYEAAGADAILIHSKENQPNEIKEFVKQFTGAVPIVIVPTTYPHITVKEME
FT                   LLGINMVIYANHGLRSSIKAMQETFSQILLDGNTVGVEDNIVSMKTVFELQGMYDMRKQ
FT                   EDMYNSGTSVISTIK"
FT   gene            209308..210396
FT                   /gene="rhiI"
FT                   /locus_tag="BSUW23_01005"
FT   CDS_pept        209308..210396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiI"
FT                   /locus_tag="BSUW23_01005"
FT                   /product="hypothetical protein"
FT                   /note="possibly involved in rhizocticin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36258"
FT                   /db_xref="UniProtKB/TrEMBL:E0U087"
FT                   /protein_id="ADM36258.1"
FT                   /translation="MISDQYNIVSLAYLHSKINFFIEPSLSLDHVFDFFSTHFFINRGR
FT                   HEEDRLADVYMTHNKEEFQTIDFNNGEDIYIRKSATDYFTIPCKRVTVEGIEYVKCTKT
FT                   DTILSFDKENKKIIISTQLQNAEQDELVLIEFIRDLVLKNEENHGVAVVHATSALKDDK
FT                   ATLIIGSKGKGKSTLLLELVSKHGYKLISGDKTFLWMEDGKLRASGWPDYPHLGLGTLS
FT                   KYPEFVEHFGLSNKIESVKENLWSTEHKMAIDPVFFKKVIPFAEPGTSFMVECMIYPDL
FT                   FPSTECGIKQVSNHGELIVPHIERIFTKGNTMWNHYIRPVHQNELERKINQCIELAGKL
FT                   SAFEVSGSGILEGSVFSERYAL"
FT   gene            210432..210830
FT                   /gene="rhiN"
FT                   /locus_tag="BSUW23_01010"
FT   CDS_pept        210432..210830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiN"
FT                   /locus_tag="BSUW23_01010"
FT                   /product="hypothetical protein"
FT                   /note="possibly involved in rhizocticin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36259"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E0U088"
FT                   /protein_id="ADM36259.1"
FT                   /translation="MVEITIQSKGFNHSYDITEQVTDALSQLEPSSGLAKVCVTGSTVG
FT                   LTVMRYEPGTIHDLLQCLESIASKNKQYEHFNTTGDPNGFSHVWSSMIGTSVMVPYKNH
FT                   KLACSDSHRVVLFDFDLREAERKIYVDR"
FT   gene            210830..212011
FT                   /gene="rhiJ"
FT                   /locus_tag="BSUW23_01015"
FT   CDS_pept        210830..212011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiJ"
FT                   /locus_tag="BSUW23_01015"
FT                   /product="hypothetical aminotransferase"
FT                   /note="possibly involved in rhizocticin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36260"
FT                   /db_xref="GOA:E0U089"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E0U089"
FT                   /protein_id="ADM36260.1"
FT                   /translation="MNILGELFEMRKLRMATPGPTQVPQEILLAGAQEMIHHRSRQMED
FT                   IINEINRELPDLFLTKQDIYILLSSGTGAMEAAVSNSFNRGDKVLVVSNGYFGERFTDI
FT                   CTVFGLEVITVSSPWGTSVNIEEVERAYKQHPDIKGVLTVYSETSTGAVNDVKAIGSLF
FT                   RDTEVLVIVDAISGLISHELSMDDWGLDIVLAASHKGFMMPPGLAFVAISPKAWKVINE
FT                   IQPSTYYFSFKRFKKFYPMAPSSPGVSLLLALKKSLDLLKAEGLSNATRRHARIARATQ
FT                   RGLEALGFHLFVQSPHVRSHTVTAALAPSGIDAALLLKKLNKEYGLTITGGQGEFKGKM
FT                   IRIGHIGAIDEIDLFGIFGIMELVLTEMGYQVQSGISMTALSDALGGGVIHHA"
FT   gene            212004..212261
FT                   /gene="rhiK"
FT                   /locus_tag="BSUW23_01020"
FT   CDS_pept        212004..212261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiK"
FT                   /locus_tag="BSUW23_01020"
FT                   /product="glutaredoxin"
FT                   /note="possibly involved in rhizocticin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36261"
FT                   /db_xref="GOA:E0U090"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0U090"
FT                   /protein_id="ADM36261.1"
FT                   /translation="MLKLYQREPCPYCKPVREKLTELNVTYINVNLPKDRALRTELIEK
FT                   TGVPYIPALIDEEDNVIISGKLEYNQHVLDYIEKKFGQNR"
FT   gene            212277..212924
FT                   /gene="rhiL"
FT                   /locus_tag="BSUW23_01025"
FT   CDS_pept        212277..212924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiL"
FT                   /locus_tag="BSUW23_01025"
FT                   /product="putative metallophosphoesterase"
FT                   /note="possibly involved in rhizocticin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36262"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E0U091"
FT                   /protein_id="ADM36262.1"
FT                   /translation="MRYAFITDIHGKRDNLEKVLEHIQTFSSIHEIICLGDVFEVKVPK
FT                   KDLKDFQFQCMEQVLDLDWELMNLLKDIRVIKGNQEERILSLIPEKEFPKDFYNFLIHM
FT                   PLEIHLTPMVRLTHGHTFDWTGEEDYWRPSNVHYWSSPWIFYGHNHQNVLFEVKEIENN
FT                   PYYERKSIINGKPITLDSASRYLINIGDMKYDHPSWMLLDTLENQITYNILY"
FT   gene            212941..214182
FT                   /gene="rhiM"
FT                   /gene_synonym="rizA"
FT                   /locus_tag="BSUW23_01030"
FT   CDS_pept        212941..214182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiM"
FT                   /gene_synonym="rizA"
FT                   /locus_tag="BSUW23_01030"
FT                   /product="amino acid ligase of ATP-grasp superfamily"
FT                   /note="capable of ligating L-arginine to 19 other amino
FT                   acids, including 2-amino-5-phosphonopentanoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36263"
FT                   /db_xref="GOA:E0U092"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E0U092"
FT                   /protein_id="ADM36263.1"
FT                   /translation="MLRILLINSDKPEPIQFFQKDKETNDSINISVITRSCYAPLYSHW
FT                   ADHVYIVDDVTDLTVMKSLMLEILKVGPIDHIVSTTEKSILTGGFLRSYFGIAGPGFET
FT                   ALYMTNKLAMKTKLKMEGIPVADFLCVSQVEDIPAAGEKLGWPIIVKPALGSGALNTFI
FT                   IHSLDHYEDLYSTSGGLGELKKNNSLMIAEKCIEMEEFHCDTLYADGEILFVSISKYTV
FT                   PLLKGMAKIQGSFILSQNDPVYAEILELQKSVAQAFRITDGPGHLEIYRTHSGELIVGE
FT                   IAMRIGGGGISRMIEKKFNISLWESSLNISVYRDPNLTVNPIEGTVGYFSLPCRNGTIK
FT                   EFTPIEEWEKLAGILEVELLYQEGDVVDEKQSSSFDLARLYFCLENENEVQHLLALVKQ
FT                   TYYLHLTEDHMMNQ"
FT   gene            214281..214517
FT                   /gene="ybzI"
FT                   /locus_tag="BSUW23_01035"
FT   CDS_pept        214281..214517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzI"
FT                   /locus_tag="BSUW23_01035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36264"
FT                   /db_xref="UniProtKB/TrEMBL:E0U093"
FT                   /protein_id="ADM36264.1"
FT                   /translation="MISICLKKSLKRSSTSQAARVIAIADTGITAATAAQVKEDTTTVM
FT                   AAVIAISAGATAAVNLKKSSCSVLGQGFFYVTD"
FT   gene            complement(214502..215272)
FT                   /gene="ybdM"
FT                   /locus_tag="BSUW23_01040"
FT   CDS_pept        complement(214502..215272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="BSUW23_01040"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36265"
FT                   /db_xref="GOA:E0U094"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E0U094"
FT                   /protein_id="ADM36265.1"
FT                   /translation="MALKQLKKLLFDRPLKDGVILNHQYRIEECLGMGGYGLVYLCTDV
FT                   HTQTSYVLKQLRPTKAKKEKERVRFQQEIKLLKSIHHPQIPDFKDDFIIDGQAYYVMQF
FT                   FDGENIEELLFFQKQPFTELMALQLISQLLEIVEYLHERLIFHSDIRTPNMIINNGRLC
FT                   LIDFGLTKQLTPEETEEVKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTK
FT                   EVTLLLKKLLGIEEEYQNTALIREDLNRAIQSVT"
FT   gene            complement(215396..216250)
FT                   /gene="ybdN"
FT                   /locus_tag="BSUW23_01045"
FT   CDS_pept        complement(215396..216250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="BSUW23_01045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36266"
FT                   /db_xref="UniProtKB/TrEMBL:E0U095"
FT                   /protein_id="ADM36266.1"
FT                   /translation="MKKWLFPFVIMLAVFFTFTYSASAAGVTAITGNNSFDTAAPIGYW
FT                   KYKNIDTTILEAGQDEAYFTFTAYKGEKVYVRSTYQSAYTGMKIEIYDKNRVPVSQGTE
FT                   VINPNTFSSFIYANADAQNTTDPFYVKVSRGTYTGNMYFTLSIEDRIKSGSGTFQFSGV
FT                   AENKGNTTLSPSGSDSSVIKVDLTNQSGIPRDAIVTRVQTTATQTPSQGNTRHFIMTSE
FT                   NNEWRRALVNSSTSGSYDISLSDQLSVAKVWSFKYNTLATARSTMSNVKAKIDYEYDVT
FT                   KQF"
FT   gene            216386..217570
FT                   /gene="ybdO"
FT                   /locus_tag="BSUW23_01050"
FT   CDS_pept        216386..217570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="BSUW23_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36267"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="UniProtKB/TrEMBL:E0U096"
FT                   /protein_id="ADM36267.1"
FT                   /translation="MRLNRQFIRTQLMAQNILNRNAAATRENTSENTATVLEQAYSRPE
FT                   SRSSNEGINQFNYSKASVTGNNGTFSKVYQSANDRTVTDTGEETVIQSKNPYESESDIR
FT                   IKILDEKYSRMNAINKTKSDPLGYIKDKYQNSKSPYFRSDLSAAERQAAYDNETEWLFK
FT                   GKAQNYNLQDAAFRNVMFNGEVEAENEKVYQRSQVNQQLQVLLNRNHIHIPQGTELTFT
FT                   ITPIDYKVQVSGTDDQALIEQIEQVLQSGDNSKELFLHIMKSLSGDSTQFSEEAYQKYQ
FT                   AAREMYEVTGYHLKDLEVIDGRYVTPDGRDLLDVYQEELEKDPLQKQTASYAISHYRSE
FT                   LSKMAEAGYDAIPDFIISIDYSNGSLRDVGQSKSYGTGDTKWLETLKLQTGVNY"
FT   gene            217887..219275
FT                   /gene="ybxG"
FT                   /locus_tag="BSUW23_01055"
FT   CDS_pept        217887..219275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BSUW23_01055"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36268"
FT                   /db_xref="GOA:E0U097"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E0U097"
FT                   /protein_id="ADM36268.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHNYIHPLAGYMTAWSNWFQWIIVGMS
FT                   EIIAVGSYMKYWFPDLPAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMI
FT                   IAGFGIIFFGFGNGGDAIGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRSAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAA
FT                   AGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIG
FT                   LAIGVVLNYVAPPKIFVYVYSASVLPGMIPWFIILISHIGFRKAKGATLDKHPFKMPFA
FT                   PFTNYLTIAFLLMVLVGMWFNDDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSS
FT                   QAAE"
FT   gene            219388..219636
FT                   /gene="csgA"
FT                   /locus_tag="BSUW23_01060"
FT   CDS_pept        219388..219636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /locus_tag="BSUW23_01060"
FT                   /product="sporulation-specific SASP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36269"
FT                   /db_xref="InterPro:IPR020255"
FT                   /db_xref="UniProtKB/TrEMBL:E0U098"
FT                   /protein_id="ADM36269.1"
FT                   /translation="MDVTLGYLRESLSNHLENEVCQRICKKMLGKRYVNEEEFVKDLDD
FT                   NEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL"
FT   gene            219651..219842
FT                   /gene="ybxH"
FT                   /locus_tag="BSUW23_01065"
FT   CDS_pept        219651..219842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxH"
FT                   /locus_tag="BSUW23_01065"
FT                   /product="YbxH"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36270"
FT                   /db_xref="InterPro:IPR035314"
FT                   /db_xref="UniProtKB/TrEMBL:E0U099"
FT                   /protein_id="ADM36270.1"
FT                   /translation="MGAIERSGYTFQPEFSVVRQNGAIHVYRHGEFVEEIEFEFNGEYP
FT                   DHDLIEELVNHYCFEHDI"
FT   gene            complement(219872..220675)
FT                   /gene="ybxI"
FT                   /locus_tag="BSUW23_01070"
FT   CDS_pept        complement(219872..220675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxI"
FT                   /locus_tag="BSUW23_01070"
FT                   /product="exported beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36271"
FT                   /db_xref="GOA:E0U0A0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A0"
FT                   /protein_id="ADM36271.1"
FT                   /translation="MKKWIYVVLVLSIAGIGGFSVHASSSAHKKHLNVSQMNVDDEFND
FT                   TVGTFIFHDVQKDKTFVYNRERANKRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGV
FT                   KREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFW
FT                   LQSSLTISPLEQEAFLEKLVNEELPFDKSVMKTVKRMMIQEEGDHYTLYGKTGTRLTDM
FT                   GLGWFVGFIKTEHGSYIFVTNVDDSGTKAKNITVDILKKYGLITS"
FT   gene            220849..222102
FT                   /gene="cypC"
FT                   /locus_tag="BSUW23_01075"
FT   CDS_pept        220849..222102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypC"
FT                   /locus_tag="BSUW23_01075"
FT                   /product="fatty acid beta-hydroxylating cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36272"
FT                   /db_xref="GOA:E0U0A1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A1"
FT                   /protein_id="ADM36272.1"
FT                   /translation="MNEQIPHDKSLDNSVALMREGYLFIKNRKEHYHSDLFQARLLGKT
FT                   FICMSGAEAAKIFYDTERFQRQGALPKRVQKSLFGVNAIQTMDGDAHIHRKLLFLSLMT
FT                   PPHQKRLAELMTEEWEAAVTRWEKADQVVLFEEAKEILCRVACYWAGVPLKETEVKERA
FT                   DDFIDMVDAFGAVGPRHWKGRRARPRAEEWIERMIEDVRAGLLKIPAGTALHEMAFHTQ
FT                   EDGNQLDSRMAAIELINVLRPIVAISYFLVFSALALHKHPKYKEWLRSGSSREREMFVQ
FT                   EVRRYYPFGPFLGALVKKDFEWNNCEFKKGTSVLLDVYGTNHDPRLWDNPDEFRPERFA
FT                   EWEENPFDLIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVNQIEYEVPEQSLHYSLAR
FT                   MPSLPESGFVMSGIRRKR"
FT   gene            complement(222143..222403)
FT                   /gene="ybyB"
FT                   /locus_tag="BSUW23_01080"
FT   CDS_pept        complement(222143..222403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybyB"
FT                   /locus_tag="BSUW23_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36273"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A2"
FT                   /protein_id="ADM36273.1"
FT                   /translation="MKQKLLLSGLAVSTVSITSYLLKDPSNRQKAKEFIHSMKMKITKQ
FT                   PDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQYYDEKKK"
FT   gene            222776..224404
FT                   /gene="ybeC"
FT                   /locus_tag="BSUW23_01085"
FT   CDS_pept        222776..224404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeC"
FT                   /locus_tag="BSUW23_01085"
FT                   /product="putative H+/amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36274"
FT                   /db_xref="GOA:E0U0A3"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A3"
FT                   /protein_id="ADM36274.1"
FT                   /translation="MAIDIQTLLFEFLGGLGIFLIGIKFMGDGLQKSAGDRLRNILDRF
FT                   TSNPLMGVLAGIIVTVLIQSSSGTTVITVGLVSAGFMTLRQAIGVIMGANIGTTVTAFI
FT                   IGIDIGAYALPIIAVGGFLLFFFKHKNVQNAGQIVFGFGALFYGLELMSGGMKPLRSLE
FT                   AFHDLTVSMSSNPVLGVVIGTLFTVLVQSSSATIGILQGLFSDGLIDINGALPVLFGDN
FT                   IGTTITAVLASLGASVAARRAAATHVLFNLIGTAIFLILLKPFTGLILSLQTSMGLDPK
FT                   MTIAFAHGIFNTTNTIIQLPFVGILALVVTKLIPGKDSMLEYKSHLDPIFIEQSPSIAL
FT                   GQAKEEVLQMGNFAVQGLEVTKQFLVTKQPKYAANAYQIEDAVNNLDRKITDYLIELSS
FT                   SSLSEHESEEHHMLMDTVRDIERIGDHFENVIELIEYQQAHRVVITESAMADLTEMMDL
FT                   TISTVKASIEALHHNDVKIAEQVIEKEDEIDKMERKLRKKHIIRLNEGLCTGQAGIVFV
FT                   DMISNLERIGDHAVNIAEAVIGENQ"
FT   gene            complement(224430..225320)
FT                   /gene="glpQ"
FT                   /locus_tag="BSUW23_01090"
FT   CDS_pept        complement(224430..225320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="BSUW23_01090"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36275"
FT                   /db_xref="GOA:E0U0A4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A4"
FT                   /protein_id="ADM36275.1"
FT                   /translation="MRKNRILALVLLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRG
FT                   ASGYVPEHTILSYETAQKMKADYIELDLQMTKDGKLIVMHDEKLDRTTNGTGWVKDHTL
FT                   ADIKKLDAGSWFNKAYPEKAKPQYAGLKVPTLEEVLDRFGKHANYYIETKTPDTYPGME
FT                   EKLIASLQKHKLLDKHAKRGQVMIQSFSKESLVKIHQLQPNLPTVQLLEAKQMASMTDA
FT                   DLEEIKTYAVGAGPDYKALNAENVSMIRSHGLLLHPYTVNTEADMRRLLDWGVTGVFTN
FT                   YPDIFQHVKKDYKKS"
FT   gene            complement(225419..226753)
FT                   /gene="glpT"
FT                   /locus_tag="BSUW23_01095"
FT   CDS_pept        complement(225419..226753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BSUW23_01095"
FT                   /product="glycerol-3-phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36276"
FT                   /db_xref="GOA:E0U0A5"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A5"
FT                   /protein_id="ADM36276.1"
FT                   /translation="MLNIFKPAPHIERLDDSKMDAAYKRLRLQVFIGIFIGYAGYYLLR
FT                   KNFAFAIPYLQEQGFSKTELGLVLAAVSIAYGFSKFIMGMVSDRCNPRYFLATGLFLSA
FT                   IVNILFVSMPWVTSSVTIMFIFMFINGWFQGMGWPPCGRTMAHWFSISERGTKMSIWNV
FT                   AHNIGGGILAPLVTLGIAMFVTWKSVFFFPAIIAIIISFLIVLLVRDTPQSCGLPPIEE
FT                   YRNDYPKHAFKNQEKELTTKEILFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLT
FT                   EAKGFSPEDSRWSYFLYEYAGIPGTILCGWISDRFFKSRRAPAGVLFMAGVFIAVLVYW
FT                   LNPAGHPLVDNIALISIGFLIYGPVMLIGLQAIDLAPKKAAGTAAGLTGFFGYIGGSAF
FT                   ANAIMGFVVDRFDWNGGFIMLISSCILAIVFLALTWNTGKRAEHV"
FT   gene            227048..227296
FT                   /gene="ybeF"
FT                   /locus_tag="BSUW23_01100"
FT   CDS_pept        227048..227296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="BSUW23_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36277"
FT                   /db_xref="GOA:E0U0A6"
FT                   /db_xref="InterPro:IPR020258"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A6"
FT                   /protein_id="ADM36277.1"
FT                   /translation="MDELDIAFGILPLGIILLSVAGTCVCKNVYLMPVLSLIISLVFTF
FT                   TIFNESFLGWVVVYSLVSLALSYITLIVMRKRKASGK"
FT   gene            227388..228305
FT                   /gene="ybfA"
FT                   /locus_tag="BSUW23_01105"
FT   CDS_pept        227388..228305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BSUW23_01105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36278"
FT                   /db_xref="GOA:E0U0A7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A7"
FT                   /protein_id="ADM36278.1"
FT                   /translation="MKTSESTVGLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IYNTPHCTAKTLQDKLGLDRGYVSRILKQFEKEDLIYKQKSKDDARHHYIYVTETGKTI
FT                   YKKLEEKANEQVELMLKEIDQKDQHKLAEAMAEIEAILSQSLSTRTSDISIRDYFLSDD
FT                   LQLLIEKQRHFYEEAHGWDDTFLAYLHETFDAEIENIWIAESSGKFAGSVGLVKHDEKT
FT                   VQLRWFLVDAAFRGRGLGTQLLEHLVAYCRDMKFERVFLWTVSTMAEARPLYEKIGFRV
FT                   SEVKKEAPLWGQRLTEERWDLELS"
FT   gene            228302..229555
FT                   /gene="ybfB"
FT                   /locus_tag="BSUW23_01110"
FT   CDS_pept        228302..229555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="BSUW23_01110"
FT                   /product="putative carboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36279"
FT                   /db_xref="GOA:E0U0A8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A8"
FT                   /protein_id="ADM36279.1"
FT                   /translation="MKRLHYAWIIVSVTFLILLAVQGVRLSFGAFVEPWERQFSMDRGT
FT                   ISLISTISFIVYGISQPVIGRLVDKWGARAVLSWSALLTGVSIFLTCFVTSPWQLFLLY
FT                   GLGVSLGVGGASNVAASVLVVNWFSKKRGLAFGIMEAGFGAGQMLLVPGSLMLIHWFSW
FT                   KLTVVVLGLLLIVIVFPAALLMLRNNPSEKNAEPIGGLAATEKETTPKSTALSVTGMFR
FT                   MRQFWFLILPFLICGFTTVGLMDTHLIPFSHDHGFSTTVTSAAVSLLAGFNIAGILLSG
FT                   IVADRWSSRKILCFLYAVRALSIVILIYSHEPYLLLAFAILFGLVDFATVAPTQMLATQ
FT                   YFQNYSIGLMIGWLSLAHQIGSALGAYVPGVIYTVTGEYTLAFYLSIGMLVLASVMNVM
FT                   LREPAAVTRDSAAVVEKV"
FT   gene            complement(229588..230013)
FT                   /gene="ybfE"
FT                   /locus_tag="BSUW23_01115"
FT   CDS_pept        complement(229588..230013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="BSUW23_01115"
FT                   /product="YbfE"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36280"
FT                   /db_xref="GOA:E0U0A9"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0A9"
FT                   /protein_id="ADM36280.1"
FT                   /translation="MNIDLQTYKETETAAKFILEGKKDAKEILAFLNKQDSIMLNQLKV
FT                   FFSEPQLTLIHSIKTVIYGTLVTLFLYFATNELPHAWSLLARLFFVVVGFIWLASCFKN
FT                   GKAIQISQNFKQKSENARIVGMIDFVLEQKYKNSISE"
FT   gene            complement(230075..230986)
FT                   /gene="ybfF"
FT                   /locus_tag="BSUW23_01120"
FT   CDS_pept        complement(230075..230986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="BSUW23_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36281"
FT                   /db_xref="GOA:E0U0B0"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B0"
FT                   /protein_id="ADM36281.1"
FT                   /translation="MKNDQIVFEKTKNIAHDIDQMQNQQEIIDYLFRQDSLTLNQLKHY
FT                   YSEPSLPLQFLVKVAVLCMFISMTLASFLFIQAKEVFTNPILSDISPAAFSIFTVICIF
FT                   MTYTKVIKRGNKNKGKASLIQRSEFYEKNKLINTILYKKYKMDQQNIQVNKPTASDNED
FT                   SMNFNAVLNHVLTISKNDKELLGYLHTKDNAVLSQLKAYFSARPFSLSHYMSLMFCGSI
FT                   IVVYATTLFSGQINYIDIPDIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRA
FT                   EYLRMKGVIDFVLTERYNKKIM"
FT   gene            complement(231147..232073)
FT                   /gene="ybfH"
FT                   /locus_tag="BSUW23_01125"
FT   CDS_pept        complement(231147..232073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfH"
FT                   /locus_tag="BSUW23_01125"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36282"
FT                   /db_xref="GOA:E0U0B1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B1"
FT                   /protein_id="ADM36282.1"
FT                   /translation="MSIQRETSGHIAAIVTILIWGTTFISTKVLLDDFTPMEILFYRFL
FT                   MGFIALILVRPTIIPFKNWRQELLFAGAGLFGVTLYFLLENIALTYTYASNVGMIVSVI
FT                   PMITAVLAHFLLEGEKLRLTFFIGFGAALIGLLLITFNGNVVLRLNPFGDIMAVGAALV
FT                   FGGYSIFMKKLSAYDYHIIELTQRVFLYGLLFMVPALFLFDFHFDLSRFSSASNILNML
FT                   FLGIGASALCFATWNYSVGVLGAVKSSAYIYMVPVITITAAILILHENMTWIALLGGAL
FT                   TLLGLYISELKLKPKAKLMGNGCNTDV"
FT   gene            complement(232070..232897)
FT                   /gene="ybfI"
FT                   /locus_tag="BSUW23_01130"
FT   CDS_pept        complement(232070..232897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfI"
FT                   /locus_tag="BSUW23_01130"
FT                   /product="putative transcriptional regulator (AraC/XylS
FT                   family, cupin family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36283"
FT                   /db_xref="GOA:E0U0B2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B2"
FT                   /protein_id="ADM36283.1"
FT                   /translation="MQNETRTLQLDPHLNIEAYRFKGIMQKFPNHFHDYYVIGFIEKGQ
FT                   RYLACQDQEYIINPGDLLLFNPRDTHSCEQIDGRTLDYRCINVMPDVMEKAVKEITGAG
FT                   HLPYFSQHVLFRHELTTSLQELHILISKEKQALRKEELFLHLLEELIRHYSDVTFLSSI
FT                   PEPSDEVKMVCEFLEEHYAENVTLNDLSELTGWSKYHLLRSFTKQKGITPNSYLETIRI
FT                   NQAKKLLEQGVRPIDAAFQTGFSDQSHMTKFFKRQVGLTPKQYMKIFEKELQR"
FT   gene            233128..234282
FT                   /gene="purT"
FT                   /locus_tag="BSUW23_01135"
FT   CDS_pept        233128..234282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BSUW23_01135"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36284"
FT                   /db_xref="GOA:E0U0B3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B3"
FT                   /protein_id="ADM36284.1"
FT                   /translation="MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVA
FT                   HNSYVVDMLDREQIRTIIEKEKPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTM
FT                   DREGIRRLAAETLGLATAGYEFANTYDEFVQAAAQIGFPCVVKPLMSSSGKGQSVCRSE
FT                   ADLESCWETAMEGGRVKNGRVIVEEFIPFESEITLLTVRAVNGTTFCEPIGHVQKDGDY
FT                   IESWQPHDMTEQQMEEAKHIAKAITDELGGYGLFGVELFLAKDKVYFSEVSPRPHDTGL
FT                   VTLVTQNLSEFALHVRAILGFPITEITQLSPGASRPLKAPEESADYTVGGLENALAVPK
FT                   TQVRVFGKPITKAGRRMAVALSAADTVETARENAKKALDQLSIK"
FT   gene            234424..235362
FT                   /gene="mpr"
FT                   /locus_tag="BSUW23_01140"
FT   CDS_pept        234424..235362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="BSUW23_01140"
FT                   /product="extracellular metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36285"
FT                   /db_xref="GOA:E0U0B4"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B4"
FT                   /protein_id="ADM36285.1"
FT                   /translation="MKLVPTFRKRGFAYLTVLCLALAAAVSFGVPAKATENPQISVSNT
FT                   GKEADVTKNQTSKEEQVSAPYEGTGKTSKSLYGQTEQEKNIQTLQPSSIIGTDERVRIS
FT                   STTSFPYRATVQLSIKYPNTSSTYGCTGFLVNPNTVVTAGHCVYSQDHGWASSITAAPG
FT                   RNDSSYPYGTYSGTMFYSVKGWTESKNTNYDYGAVKLNGSPGNTVGWYGYRTTNSSSPV
FT                   GLSSSVTGYPCDKVFGTMWSDTKPIRSAETYKLTYTTDTYGCQSGSPVYRNYSDTGQTA
FT                   IAIHTNGGSSYNLGTRVTNDVFNNIQYWANQ"
FT   gene            235325..235723
FT                   /gene="ybfJ"
FT                   /locus_tag="BSUW23_01145"
FT   CDS_pept        235325..235723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfJ"
FT                   /locus_tag="BSUW23_01145"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36286"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019730"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B5"
FT                   /protein_id="ADM36286.1"
FT                   /translation="MYSTIFNIGQINKYSKLAIFMSILFLCGCSSQTHSAQKETAIPVT
FT                   LHVEDAKGLPVEAVQVTIVKAPASDQEPSTEIGEILGKTDKNGDIKWDTGKKGDYSVAL
FT                   TKGETSVTHHISLTEDKKDKIIPLVFKE"
FT   gene            235896..236780
FT                   /gene="ybfK"
FT                   /locus_tag="BSUW23_01150"
FT   CDS_pept        235896..236780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfK"
FT                   /locus_tag="BSUW23_01150"
FT                   /product="carboxylesterase NP"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36287"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B6"
FT                   /protein_id="ADM36287.1"
FT                   /translation="MTQDSMQLAAAESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTH
FT                   IIASGPKDAPSLILLHGGLFSSAMWYPNIAEWSSQYRTYAVDIIGDKNKSIPSAALDTR
FT                   ADCAEWLKDVFDSLGLETAHLAGLSLGGSHIVNFLLQAPERVERAVVMSPAEAFISFHP
FT                   DVYKYAAGLTGSRGANEYIKWITDSRYDLHPVLQRQIVTGVEWQDEQRSLKPTANGFPY
FT                   VFTDRELKSITVPILLMFGEYEVMYHQQMALERASVLVPGIQAEIVKNAGHLLSLERPE
FT                   YVNQRVLSFLSGE"
FT   gene            236979..237512
FT                   /gene="pssA"
FT                   /locus_tag="BSUW23_01155"
FT   CDS_pept        236979..237512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BSUW23_01155"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36288"
FT                   /db_xref="GOA:E0U0B7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B7"
FT                   /protein_id="ADM36288.1"
FT                   /translation="MNYIPCMITIGNFTCGLLAIHSLLYHNIHSAVLFIFTGMFLDFFD
FT                   GMAARKLNAVSDMGKELDSFADLVTFGVAPSMLAYSVSLYALPFIGILCALTYSICGML
FT                   RLSKFNIEQSKLPTFIGMPIPFAGMCLVILSFVYNPVLLAIGTCGLSYLMVSKIKFPHF
FT                   KKHAAENLESERWN"
FT   gene            237503..237991
FT                   /gene="ybfM"
FT                   /locus_tag="BSUW23_01160"
FT   CDS_pept        237503..237991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /locus_tag="BSUW23_01160"
FT                   /product="putative membrane phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36289"
FT                   /db_xref="GOA:E0U0B8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B8"
FT                   /protein_id="ADM36289.1"
FT                   /translation="MELVQQLIADYGYIAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTD
FT                   VLNYELSILISFVGALLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMNKYG
FT                   PYSLIFGYFIPGVRHMTCYFSGIGKMNLKTYIAFAAIGAFLWCFIFITIGRVIGIIHV"
FT   gene            237984..238793
FT                   /gene="psd"
FT                   /locus_tag="BSUW23_01165"
FT   CDS_pept        237984..238793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BSUW23_01165"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36290"
FT                   /db_xref="GOA:E0U0B9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0B9"
FT                   /protein_id="ADM36290.1"
FT                   /translation="MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKH
FT                   FRLNWDDVDGSAADYGSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVGTINPNQT
FT                   FTVKGKDYSFAELTGCKSADHQYNGGYFIVLYLSPRHYHRFHSPISCRYQKLAELGNRS
FT                   YPVNQLGLKYGRDVLSKNYRFVYELNGGTRNVLMIPVGAMNINSIVQTSTRDELEIGEE
FT                   LGYFSFGSTVILIFEKDAFQPSANLTEGQEVQVGELIGYEEKKEELV"
FT   gene            238830..239108
FT                   /gene="ybfN"
FT                   /locus_tag="BSUW23_01170"
FT   CDS_pept        238830..239108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="BSUW23_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0C0"
FT                   /protein_id="ADM36291.1"
FT                   /translation="MEKQIISWITDYQNTGDEAVLRQVREACWPIVEGVLQEKATDEEQ
FT                   ASDFREKGIERFPFIISKYQADVQLPVETFLRNTYRFYFHQVMRGSS"
FT   gene            239212..240552
FT                   /gene="ybfO"
FT                   /locus_tag="BSUW23_01175"
FT   CDS_pept        239212..240552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfO"
FT                   /locus_tag="BSUW23_01175"
FT                   /product="putative exported hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36292"
FT                   /db_xref="GOA:E0U0T9"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0T9"
FT                   /protein_id="ADM36292.1"
FT                   /translation="MKRMIVKTVLPLLIVCLVFTSFSASARAASEEKHWNRWIERHAHP
FT                   LDSSDASNKDLRFLKKVLKGKRIVQLGETTHGAGEINATKVRMIKYLHEELGYDVLAFE
FT                   SGFSDTNASYLNMDQLTSKGTMKNSIYAVWHTEDVVELFDYMKEQKEKGDPLILTGFDI
FT                   QSMKNSFNDAANQWVKAVDPEKAELLSQSENDFSTLVTNSNTFDEFTQKKEALVKNYQE
FT                   LIKFAETHASELKAHLPKEPKAYEMFMHSLQLRIDVMEMYMLEEMKEKLKDYPDNIEDF
FT                   SFYMRDRMMAEQFQWVAETLYPKKKIIVWGHNYHLRKQNTKMIKDWVQLNGPNMGDYLP
FT                   ERLKKQTYTIGIYAYSGASLDSSDNKTVTPVTSPLPSGSLEALLKTADHPAVFVDFLHT
FT                   KNKKGTSWMYTPRTALYWGFMEEQMILKEQYDGVIWLEHITPSVIIK"
FT   gene            240805..241773
FT                   /gene="ybfQ"
FT                   /locus_tag="BSUW23_01180"
FT   CDS_pept        240805..241773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfQ"
FT                   /locus_tag="BSUW23_01180"
FT                   /product="putative enzyme with rhodanese domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36293"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U0"
FT                   /protein_id="ADM36293.1"
FT                   /translation="MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEG
FT                   INGTVSGTVEQTEKYMETMKADPRFADMVFKIDEAEDHAFKKIFVRHKKELVTLRLEDD
FT                   VDPNETTGQHLKPAEFYEKMQDPNTIVIDARNDYEYDLGHFRGAVRPDIEAFRELPEWI
FT                   EEHKDMLEGKQILTYCTGGVRCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQGKLWD
FT                   GQCYVFDERISVPVNRVEHVIVGKDYFTGEPCERYVNCANPSCNKKMICTPENEYKYMR
FT                   SCSHECRTNPRNLYVSEHNMTEEEVNARLAAIEKEEHAAAE"
FT   gene            complement(241809..243053)
FT                   /gene="gltP"
FT                   /locus_tag="BSUW23_01185"
FT   CDS_pept        complement(241809..243053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="BSUW23_01185"
FT                   /product="proton/glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36294"
FT                   /db_xref="GOA:E0U0U1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U1"
FT                   /protein_id="ADM36294.1"
FT                   /translation="MRKLIAFQILIALAVGAVVGHFFPDFGMALRPVGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGSMKKMGSLGIKTIIWFEVITTLVLGLGLVLANVLKPGVGLDLS
FT                   HLAKKDINELSGYTDKVVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIG
FT                   KASEPVMNFFESTAQIMFKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVF
FT                   LGLFLILFVLFPLVGLIFHIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCP
FT                   KRVVSFVVPSGLSLNCDGSSLYLSVSFIFLAQAFHVDMTLSQQLLMMLVLVMTSKGIAA
FT                   VPSGSLVVLLATANAVGLPAEGVAIIAGVDRVMDMARTGVNVPGHAMACIVVSKWEKAF
FT                   REKEWASANGQTESV"
FT   gene            complement(243196..244260)
FT                   /gene="nagPA"
FT                   /locus_tag="BSUW23_01190"
FT   CDS_pept        complement(243196..244260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagPA"
FT                   /locus_tag="BSUW23_01190"
FT                   /product="phosphotransferase system (PTS)
FT                   glucosamine-specific enzyme IICBA component"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36295"
FT                   /db_xref="GOA:E0U0U2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U2"
FT                   /protein_id="ADM36295.1"
FT                   /translation="MISAALTSMLTGITEPVEFSFLFVAPVLYLINSILAGVIFVVCDL
FT                   FHVRHGYTFSGGGIDYVLNYGLSTNGWVVIPVGIVFAFIYYYLFRFAILKWNLKTPGRE
FT                   TDEADQTEAKAPVAKDQLAFHVLQALGGQQNIANLDACITRLRVTVHQPSQVSKDELKR
FT                   LGAVGVLEVNNNFQAIFGTKSDALKDDIKTIMAGGVPDTAATLETETDKQQKPASGETF
FT                   IYPLKGETVSLTDVPDQVFSEKMMGEGFAIDPSEGKVVAPADGEIVSIFPTKHAIGFMS
FT                   AGGTEILIHVGIDTVKLSGEGFEAHVTSGQAVKQGELLLTFDLDYIKQHAASAVTPVIF
FT                   TNVSEEDMKHIQMK"
FT   gene            complement(244260..245090)
FT                   /gene="nagPB"
FT                   /locus_tag="BSUW23_01195"
FT   CDS_pept        complement(244260..245090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagPB"
FT                   /locus_tag="BSUW23_01195"
FT                   /product="phosphotransferase system (PTS)
FT                   glucosamine-specific enzyme IICBA component"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36296"
FT                   /db_xref="GOA:E0U0U3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U3"
FT                   /protein_id="ADM36296.1"
FT                   /translation="MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKD
FT                   AGGVVFDNLPLIFAVGVAIGLAGGEGVAGLAAVIGYFILTVTLDNMGKLLGLQPPYEGA
FT                   EHLIDMGVFGGIIIGLLAAYLYKRFSSIELHPVLGFFSGKRFVPIITSISSLVIGVIFS
FT                   FVWPLIQNGINAASSLIADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPST
FT                   GSTVTGDLTRFFAGDPTAGRFMMGDFPYMIFCLPAIALAIIHTARPEKKKRSPA"
FT   gene            complement(245111..245860)
FT                   /gene="nagBB"
FT                   /locus_tag="BSUW23_01200"
FT   CDS_pept        complement(245111..245860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagBB"
FT                   /locus_tag="BSUW23_01200"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36297"
FT                   /db_xref="GOA:E0U0U4"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U4"
FT                   /protein_id="ADM36297.1"
FT                   /translation="MKIIIAEHYEELCKLSANIIKEQIQAKKDAVLGLATGSTPVGLYK
FT                   QLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPSHIHIPQG
FT                   DNPQLEAECKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQ
FT                   ANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPA
FT                   SILQKHNHVTVIADQKAAQKLKNTSYS"
FT   gene            246079..246786
FT                   /gene="ybgA"
FT                   /locus_tag="BSUW23_01205"
FT   CDS_pept        246079..246786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="BSUW23_01205"
FT                   /product="putative transcriptional regulator (GntR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36298"
FT                   /db_xref="GOA:E0U0U5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U5"
FT                   /protein_id="ADM36298.1"
FT                   /translation="MTALYSVIKFKIIELIKSGKYQANDQLPTESEFCEQYDVSRTTVR
FT                   LALQQLELEGYIKRIQGKGTFVSAAKIQTPIPHKITSFAEQMRGLRSESKVLELVVIPA
FT                   DHSIAELLKMKENEPVNKLVRVRYAEGEPLQYHTSYIPWKAAPGLAQEECTGSLFELLR
FT                   TKYNIEISRGTESIEPILTDETISGHLLTNVGAPAFLSESLTYDKNEEVVEYAQIITRG
FT                   DRTKFTVEQSYQS"
FT   gene            246821..247096
FT                   /gene="ybgB"
FT                   /locus_tag="BSUW23_01210"
FT   CDS_pept        246821..247096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgB"
FT                   /locus_tag="BSUW23_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36299"
FT                   /db_xref="GOA:E0U0U6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U6"
FT                   /protein_id="ADM36299.1"
FT                   /translation="MFLLTNGKVLWGAVIAAFILSIVFYPFLPAEMPIHYDGTNSPDMT
FT                   VNKLAGIVILPVLMVVFAWAQKINWQFVIAVYILLICHIVVLYLAV"
FT   gene            247177..248379
FT                   /gene="ilvE"
FT                   /locus_tag="BSUW23_01215"
FT   CDS_pept        247177..248379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="BSUW23_01215"
FT                   /product="ketomethiobutyrate-branched-chain/aromatic amino
FT                   acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36300"
FT                   /db_xref="GOA:E0U0U7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U7"
FT                   /protein_id="ADM36300.1"
FT                   /translation="MIIKNILKFIGVERRIIKEEAVYLFNFKKTEYLNNYIVKGVLIRL
FT                   NKLIEREKTAFHKEKPDPSSLEFGKYFTDYMFVMDYEEGMGWYHPRIEPYAPLTLDPSS
FT                   SVFHYGQAVFEGLKAYRTEDGRVLLFRPDQNIKRLNRSCERMSMPPLDEELVLEALTQL
FT                   VELEKDWVPKEKGTSLYIRPFVIATEPSLGVKASKSYTFMIVLSPVGSYYGDDQLKPVR
FT                   IYVEDEYVRAVNGGVGSAKTSGNYAASLQAQRKANELGYDQVLWLDAIEKKYVEEVGSM
FT                   NIFFVINGEAVTPALSGSILSGITRASAIELIRSWGIPVREERVSIDEIYAASARGELT
FT                   EVFGTGTAAVVTPVGELNIHGKTVIVGDGQIGDISKKLYETITNIQLGKVKGPFNWTVE
FT                   V"
FT   gene            complement(248415..249827)
FT                   /gene="ybgF"
FT                   /locus_tag="BSUW23_01220"
FT   CDS_pept        complement(248415..249827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="BSUW23_01220"
FT                   /product="putative aminoacid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36301"
FT                   /db_xref="GOA:E0U0U8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U8"
FT                   /protein_id="ADM36301.1"
FT                   /translation="MKSAHNKNETNFQRSMKSRHLFMLSLGGVIGTGLFLSSGYTIQQA
FT                   GPAGTILAYLVGAGIVYLVMLCLGELSVAMPVTGAFHTYAAKYIGPGTGFTVAWLYWLT
FT                   WTVALGSEFTAAGLLMQRWFPHTSVWMWSAVFALFIFLLNAFSVKFFAESEFWFSSIKV
FT                   LAIILFILLGGSAMFGIIPIQGGEAAPMLSNFTAEGGLFPNGFVPILMTMLSVNFAFSG
FT                   TELIGIAAGESVDPDKTIPKAIKTTVWRLSLFFVGTIFVLSGLIPIQDAGVIKSPFVAV
FT                   FDRVGVPYAADIMNFVILTAILSAANSGLYASSRMLWSLSKEKTLHPTFAKLTSKGTPF
FT                   NALVFSMIGGILSLLSSVIAPDTVYVVLVSLSGFAVVVVWMGIAASQFMFRKRYVEAGN
FT                   KVADLTYRTPLYPFVPIAAFLLCLASVIGIAFDPNQRIALYCGIPFMAICYAVYYAKNR
FT                   MSQPTADITHSK"
FT   gene            complement(249948..250895)
FT                   /gene="mmuM"
FT                   /locus_tag="BSUW23_01225"
FT   CDS_pept        complement(249948..250895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmuM"
FT                   /locus_tag="BSUW23_01225"
FT                   /product="homocysteine methyltransferase"
FT                   /EC_number="2.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36302"
FT                   /db_xref="GOA:E0U0U9"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0U9"
FT                   /protein_id="ADM36302.1"
FT                   /translation="MNPIQHILDTYPLIVLDGAMATELERKGCDLNDSLWSAKILMEEP
FT                   DLIKQIHTDYFAAGADCAITASYQSTFEGFAARGLSEAKARRLIEMSVSIAAVARDEFW
FT                   ALEENRLNRPKPIIAASVGPYGAYLADGSEYRGHYGITEDELVEFHRPRMKALIEAGAD
FT                   VLACETIPCLTEAKAIVRLLKEFPETYAWISFSAKDGLHISDGTPAADCASWLDEHHQI
FT                   AAIGINCTPLQHIPSLIEELKKHTSKPIIVYPNSGEQYDPETKTWNGAACAEPYGQSAR
FT                   MWHEKGAKLIGGCCRTKPEDIKEIAAWAHALKTT"
FT   gene            complement(251020..252456)
FT                   /gene="glnT"
FT                   /locus_tag="BSUW23_01230"
FT   CDS_pept        complement(251020..252456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnT"
FT                   /locus_tag="BSUW23_01230"
FT                   /product="glutamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36303"
FT                   /db_xref="GOA:E0U0V0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V0"
FT                   /protein_id="ADM36303.1"
FT                   /translation="MQQILEHIVGIANDLLWSKLLIVLLLSLGIYFTFRLKFLQVRMLK
FT                   EMVKVLREGAASRSKNSISPFQAFCISMAARVGTGNITGIAIAIALGGPGAIFWMWIIA
FT                   IIGSASSFVESTLAQIYKVKDANGFRGGPAYYMEKGLNKRWMGALFAVLITLSFGIVFN
FT                   SVQSNTVSLAFENAFGTNRLTLGLILIAVFGTIIFGGVKRIAKLAESIVVVLAVLYIGV
FT                   AFFVIFTNITQLPDVIALIVKNAFGFDQAAGGALGAALMQGVRRGIFSNEAGMGSAPNA
FT                   AATATTSHPVKQGLIQALGVLSDTLVICTSTAFIILFSDAYHTPGLSGIALTQASLSSH
FT                   VGSWASGFLAILILLFGFCALIGNYYYGETNIGFLNKSKKLIFVYRIGVLAMIVFGCVA
FT                   KVQLVWDLADLFMGLMVVVNLIAIFLLSKVVFAALQDYTRQKKAGKDPVFYKSVLKNHN
FT                   GIECWPLSDTQTDTHNKQIS"
FT   gene            complement(252478..253461)
FT                   /gene="glsA"
FT                   /locus_tag="BSUW23_01235"
FT   CDS_pept        complement(252478..253461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BSUW23_01235"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36304"
FT                   /db_xref="GOA:E0U0V1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V1"
FT                   /protein_id="ADM36304.1"
FT                   /translation="MKELIKEPQIEIDTASQLHDWVEHYRPFAANGQSANYIPALGKVN
FT                   DSQLGICILEPDGTMIHAGDWNVPFTLQSISKVISFIAACMSRGIPYVLDRVDVEPTGD
FT                   AFNSIIRLEINKPGKPFNPMINAGALTIASLLPGESAHNKLEFLYSVMETLVGKRPRIH
FT                   EEVFQSEWETAHRNRALAYYLKETNFLEADVEETLEVYLKQCAMESTTEDIALIGLILA
FT                   HDGYHPIRRQQVIPKDVAKLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPP
FT                   SARREQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELSIF"
FT   gene            complement(253577..253681)
FT                   /locus_tag="BSUW23_01240"
FT   CDS_pept        complement(253577..253681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36305"
FT                   /db_xref="GOA:E0U0V2"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V2"
FT                   /protein_id="ADM36305.1"
FT                   /translation="MAENLQISFDPEHEVFINLTAYFQNVFVVFCMIL"
FT   gene            253705..254994
FT                   /gene="glnJ"
FT                   /locus_tag="BSUW23_01245"
FT   CDS_pept        253705..254994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnJ"
FT                   /locus_tag="BSUW23_01245"
FT                   /product="two-component sensor histidine kinase [GlnL] for
FT                   glutamine degradation"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36306"
FT                   /db_xref="GOA:E0U0V3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V3"
FT                   /protein_id="ADM36306.1"
FT                   /translation="MIIIKLERFFEKDGYILALMLITVPLAGELKFYPLNEEFRVSFGA
FT                   PVFFFFLSLLRHVPAVLPGLLTGAAVFVFRVFLELWGGGHNGLTPILYDQASGFFFYMT
FT                   YACLFSVLKANRFRERPVMLGFIGFMIEIVSDCVELAVQFLIFHTVVTPEKVTDIAVIA
FT                   ISHTFIVMSFYTVLKLYETQSREKQTRQQHEHMLMIVSNLYEETVHLKKTLKTTEKVTN
FT                   DSYQLYREVKGKDDQLSGRILRLAGEIHEVKKDNQRIFAGLSKLISNESLRDYMRASDL
FT                   LQLVIRMNEKYAEALEKQIDFHCSIEGEHDEYHVFIVLSIINNLTANAVEAMGKEGMIS
FT                   LRLRRPNESMVEFQVEDNGPGISEKIGDIVFDPGFTSKYDEFGTPSTGIGLSYVKEIVT
FT                   ELDGDIMFDNQQRGVVFAIRLPVRHLIQKG"
FT   gene            255005..255949
FT                   /gene="glnL"
FT                   /locus_tag="BSUW23_01250"
FT   CDS_pept        255005..255949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="BSUW23_01250"
FT                   /product="two-component response regulator [GlnJ] for
FT                   glutamine utilization"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36307"
FT                   /db_xref="GOA:E0U0V4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V4"
FT                   /protein_id="ADM36307.1"
FT                   /translation="MRFFIADDDRAVRSILRQIIEDEDLGEAAGEADDGSQVEGHMLQF
FT                   KQIDILLIDLLMPGRDGIETIRQLQNTYSGKIVMISQVEAKEMVGEAYSLGIEYFIHKP
FT                   INRIEIVTVLQKVKERIELEQSIGAIQHSLSRLVNRTEQKARPQQHSDSGLKEAGTFLL
FT                   SELGMMGEGGAHDLMAVLQYLAEHEQSEPYEKHIPSLKLIFTQVAERKLGAGASETEVN
FT                   REMKASEQRIRRAIIHSLHHFASLGTTDFSNPKFETYASKFFDFPVVSQKMKELQSKDA
FT                   KPLAPARVNMKKFIHVFFLEAKLLHETMKQRRI"
FT   gene            256016..256162
FT                   /locus_tag="BSUW23_01255"
FT   CDS_pept        256016..256162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36308"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V5"
FT                   /protein_id="ADM36308.1"
FT                   /translation="MFFYKISENKDIDLLFICLTIKQKRYREGADAKPELIKALSVRGC
FT                   INK"
FT   gene            256178..257104
FT                   /gene="ycbC"
FT                   /locus_tag="BSUW23_01260"
FT   CDS_pept        256178..257104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbC"
FT                   /locus_tag="BSUW23_01260"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /EC_number="4.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36309"
FT                   /db_xref="GOA:E0U0V6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V6"
FT                   /protein_id="ADM36309.1"
FT                   /translation="MSRMRKAPAGILGFPVAPFNSQGKLEEEALFQNIEFLVEEGLEAI
FT                   FIACGSGEFQSLSQKEYEQMVEVAISAAGGKVPVYTGVGGNLSTALEWAQLSAKKGADG
FT                   YLILPPYLVHGEQEGLYQYAKTIIESTDLNAILYQRDNTILSLEQIKRLTEFEQLVGVK
FT                   DGVGNMDLNINLVYTLGDRLGWLNGMPMAEVTMPAYLPIGFHSYSSAISNYIPHISRMF
FT                   YDALKNGNDELVKELYQHVILPINDIRKQRKGYAVSLIKAGMEIMGLNVRNTARPPVGP
FT                   VEKEHYQQLEAILKQAADRFPKKAATV"
FT   gene            257134..258600
FT                   /gene="ycbD"
FT                   /locus_tag="BSUW23_01265"
FT   CDS_pept        257134..258600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbD"
FT                   /locus_tag="BSUW23_01265"
FT                   /product="2,5-dioxovalerate dehydrogenase
FT                   (alpha-ketoglutaric semialdehyde dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36310"
FT                   /db_xref="GOA:E0U0V7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V7"
FT                   /protein_id="ADM36310.1"
FT                   /translation="MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNS
FT                   TADDVERAVAAANKAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIP
FT                   IWKVAPALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAE
FT                   HEGVDAVTFTGSNQVGKIIGQTALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGA
FT                   FRSTGQKCTATSRVIVQSGVYGRFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNC
FT                   LSYIEKGKQEGASLLIGGEKLEDGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALI
FT                   KVDSMKDALDIANDVKFGLSASIFTQNIGLMLSFIDEIDAGLVRINAESAGVELQAPFG
FT                   GMKQSSSHSREQGEAAKDFFTAIKTVFVKP"
FT   gene            258685..260052
FT                   /gene="gudP"
FT                   /locus_tag="BSUW23_01270"
FT   CDS_pept        258685..260052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudP"
FT                   /locus_tag="BSUW23_01270"
FT                   /product="glucarate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36311"
FT                   /db_xref="GOA:E0U0V8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V8"
FT                   /protein_id="ADM36311.1"
FT                   /translation="MKKDYANVSPADKKTSVRWFIVFMLFLVTSINYADRATLSITGDS
FT                   VQHDLGLDSVAMGYVFSAFGWAYVIGQLPGGWLLDRFGSKTVIALSIFFWSFFTLLQGA
FT                   IGFFSAGTAIILLFALRFLVGLSEAPSFPGNGRVVASWFPSSERGTASAFFNSAQYFAI
FT                   VIFSPLMGWLTHSFGWHSVFVVMGAAGILLAVIWLKTVYEPKKHPKVNKAELAYIEQGG
FT                   GLISMDDSKSKQETESKWPYIKQLLTNRMLIGVYIAQYCITTLTYFFLTWFPVYLVQAR
FT                   GMSILEAGFVASLPALCGFAGGVLGGIVSDILLKKGRSLTFARKAPIIVGMLLSCSMVV
FT                   CNYTDSAWLVVVIMSLAFFGKGFGALGWAVVSDTSPKECAGLSGGLFNTFGNIASITTP
FT                   IIIGYIVNATGSFNGALVFVGANAIAAILSYLLLVGPIKRVVLKKQEQDPDQSLPV"
FT   gene            260089..261456
FT                   /gene="gudD"
FT                   /locus_tag="BSUW23_01275"
FT   CDS_pept        260089..261456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BSUW23_01275"
FT                   /product="glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36312"
FT                   /db_xref="GOA:E0U0V9"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0V9"
FT                   /protein_id="ADM36312.1"
FT                   /translation="MSSPIQEQVQKEKRSNIPSICEMKVIPVAGHDSMLLNLSGAHSPF
FT                   FTRNIVILTDSSGNQGVGEVPGGEQICRTLELAEPLVVGKSVGAYQSILQTVRKQFADQ
FT                   DRGGRGIQTFDLRTTVHAVTALEAALLDLLGKFLQEPVAALLGEGKQRDEVKMLGYLFY
FT                   IGDRKRTTLPYQSDEQSDCGWFRLRHEEALTPEAIVRLAESAQERYGFQDFKLKGGVLG
FT                   GEDEIEAVTALAKRFPEARITLDPNGAWSLEEAIALCKGKHDVLAYAEDPCGDENGYSA
FT                   REVMAEFRRATGLPTATNMIATDWREMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   DWGLTWGSHSNNHFDISLAMFTHVAAAAPGRITAIDTHWIWQDGQRLTKQPFEISDGCV
FT                   KVPTKPGLGVDIDMEQVEKAHELYRKMNLGARNDAIPMRFLISNWEFDRKRPCLVR"
FT   gene            261526..262227
FT                   /gene="ycbG"
FT                   /locus_tag="BSUW23_01280"
FT   CDS_pept        261526..262227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbG"
FT                   /locus_tag="BSUW23_01280"
FT                   /product="transcriptional regulator (GntR family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36313"
FT                   /db_xref="GOA:E0U0W0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W0"
FT                   /protein_id="ADM36313.1"
FT                   /translation="MYEGLEDLKVDTVNRKTLAKQVIERIVHLLSSGQLKAGDKLPTEM
FT                   ELMDILHVSRPVLREALSSLETLGVITRKTRGGTYFNDKIGMQPFSVMLALATDNLPAI
FT                   IEARMALELGLVTIAAEKINEDELQRLQKTIDDIANSTDNLYGEADKEFHRIIALSANN
FT                   PVVEGMIQSLLITHAKIDSQIPYRERDVTVEYHKKIYDALAKRDPYKAHYHMYEHLKFV
FT                   RDKILKGMDEK"
FT   gene            262320..263852
FT                   /gene="garD"
FT                   /locus_tag="BSUW23_01285"
FT   CDS_pept        262320..263852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="BSUW23_01285"
FT                   /product="D-galactarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36314"
FT                   /db_xref="GOA:E0U0W1"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W1"
FT                   /protein_id="ADM36314.1"
FT                   /translation="MAMNLRQNQAPLYIKVNEKDNTAIIVNDGGLPKGTVFSCGLVLEE
FT                   DVPQGHKVALTDLNQGDEIVRYGEVIGFADETIKRGSWIRESLVRMPAPPALDDLPLAN
FT                   RVPKPLPPLEGYTFEGYRNADGSAGTKNILGITTSVQCVVGVLDYAVKRIKEELLPKYP
FT                   NVDDVVPLHHQYGCGVAINAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPARIA
FT                   SENQDDILSLQDHRGFAAMIQSILEMAEERLIKLNSRTRVTCPVSDLVIGLQCGGSDAF
FT                   SGVTANPAVGYAADLLVRAGATVLFSEVTEVRDAIHLLTPRAVSEEVGHSLIEEMKWYD
FT                   SYLRRGEADRSANPSPGNKKGGLSNVVEKALGSVAKSGTSPISGVLGPGEKAEQKGLLF
FT                   AATPASDFVCGTLQLAAGMNLQVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWADLIDIN
FT                   AGRIATGEASIEDVGWEIFRTILDVASGRKQTWAERWGLHNDLCLFNPAPVT"
FT   gene            264129..265049
FT                   /gene="ycbJ"
FT                   /locus_tag="BSUW23_01290"
FT   CDS_pept        264129..265049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="BSUW23_01290"
FT                   /product="putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36315"
FT                   /db_xref="GOA:E0U0W2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W2"
FT                   /protein_id="ADM36315.1"
FT                   /translation="MTNQNEKNLITEIVALARSQGLAVHSENAQLNETGMDFQVVFAED
FT                   DTGMSWVLRKPRRSDVVERAASEGRTLAFLRANLTANVPDWNIHTPELIAYPMLEGTPA
FT                   AGVDLEQKQYVWNMNHQPPSDDFVHTLAEILAELHGMDQTSAGQSGIEVIMPEDFRQMT
FT                   AESMVDVKNKLGVSKQLWERWQTWINDDAYWPVFSTLIHGDLHPPHILINQSEQVTGLL
FT                   DWTEAKVADPAKDFIFFQMLFGEEETARLLEYYDQAGGRIWAKMQEHISEMQAAYPLEV
FT                   AKFALQTQQEEHIKMALEALGVKSD"
FT   misc_binding    265107..265354
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader; regulation of aminoacyl-tRNA
FT                   synthetase and amino acid biosynthetic genes;
FT                   BSUW23_misc_RNA_6"
FT   gene            265456..265557
FT                   /locus_tag="BSUW23_01295"
FT   CDS_pept        265456..265557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36316"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W3"
FT                   /protein_id="ADM36316.1"
FT                   /translation="MQLMILRSHVLDVKEREKSKENLARPAAGKVLF"
FT   gene            265830..266522
FT                   /gene="ycbL"
FT                   /locus_tag="BSUW23_01300"
FT   CDS_pept        265830..266522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbL"
FT                   /locus_tag="BSUW23_01300"
FT                   /product="two-component response regulator (paired with
FT                   YcbM)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36317"
FT                   /db_xref="GOA:E0U0W4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W4"
FT                   /protein_id="ADM36317.1"
FT                   /translation="MQRILLVEDDHSISEMVDHYLTKEGFEMVHAFDGEEGIRLFKQDS
FT                   YDLILLDIMLPKLNGMDFLKIIREKSNIPVLMISAKDGDVDKALGLGFGADDYIAKPFS
FT                   MIELTARVKAAIRRATQYSAEEPAENKVIRIHQLAIDIDNVSVLKNGEPLQLTSTEWQL
FT                   LCLFAANPKKVFTKEQIYRSVWNEEYFGDQNIINVHMRRLRGKIEDDPSSPQYIKTLWG
FT                   IGYKLGEF"
FT   gene            266524..267459
FT                   /gene="ycbM"
FT                   /locus_tag="BSUW23_01305"
FT   CDS_pept        266524..267459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbM"
FT                   /locus_tag="BSUW23_01305"
FT                   /product="two-component sensor histidine kinase (paired
FT                   with YcbL)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36318"
FT                   /db_xref="GOA:E0U0W5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W5"
FT                   /protein_id="ADM36318.1"
FT                   /translation="MTVLWMAAVIILVCLNVIQFMMKKKRDRNLAYTAEQLGAMLNRDS
FT                   AGQILLHTDHQALKDLLVNINLFVEDRQQISAQFAKTEQSMKRMLTNMSHDLKTPLTVI
FT                   LGYIEAIQSDPDMPDEERERLLGKLRQKTNELIQMINSFFDLAKLESEDKDIPITKIHM
FT                   NEICKRNILHYYDAVQSKGFQAAIDIPDTPVYAHANEEALDRILQNLLSNAIQYGAAGK
FT                   FIGMTLSYDETSIAITVWDRGKGISETDQQRVFERLYTLEESRNKAFQGSGLGLTITKR
FT                   LTEKMGGTISVQSKPYERTAFTITLKRMTY"
FT   gene            267554..268477
FT                   /gene="ycbN"
FT                   /locus_tag="BSUW23_01310"
FT   CDS_pept        267554..268477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbN"
FT                   /locus_tag="BSUW23_01310"
FT                   /product="bacitracin ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36319"
FT                   /db_xref="GOA:E0U0W6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W6"
FT                   /protein_id="ADM36319.1"
FT                   /translation="MTYIVQTNGLTKTYGGKEVVSNVSMHIKKGEIYGFLGPNGAGKTT
FT                   IMKMLTSLVKPTSGEISILGNKLTHTSYEVLGNIGSMIEYPIFYENLTAVENLDLHCEY
FT                   MGYHNKKAIQEVLDMVNLKQINKQPVKTFSLGMKQRLGIARAILTKPDLLILDEPVNGL
FT                   DPLGIKKIRQLFQVLSKEYGMTLLISSHLLSEIEQIADTIGVIRDGRLLEEVSMEDVRG
FT                   QNTEYIELVTPNQTRACFVLEKELHVTNFKILNEKTIRIYEAEASQSAISKALILNDVE
FT                   IESMNKKYTSLEDYFINLINGNRIGA"
FT   gene            268493..269182
FT                   /gene="ycbO"
FT                   /locus_tag="BSUW23_01315"
FT   CDS_pept        268493..269182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbO"
FT                   /locus_tag="BSUW23_01315"
FT                   /product="putative Na+-driven exporter or maturation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36320"
FT                   /db_xref="GOA:E0U0W7"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W7"
FT                   /protein_id="ADM36320.1"
FT                   /translation="MMNLIRIELRKMKMGWYVRGALIANLIIMGFLWLICYSEKADSGV
FT                   SFQSMEEAFLIIGTFVRAVFIVFGAVLIAKLVISEYKNKTILVMFTYPISRKKLLTAKL
FT                   MIAGGLTFITILLSNILIAVGFFWLNSIYHFIPGELTSEIISQQAVKMAVFAFGAAGTS
FT                   LVPIFFGMRKHSVPATIISSVVIVMLISSTNPGFSISSVVYIPLSLAAFGLVFSYMAIR
FT                   NADKQDA"
FT   gene            complement(269236..269622)
FT                   /gene="ycbP"
FT                   /locus_tag="BSUW23_01320"
FT   CDS_pept        complement(269236..269622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /locus_tag="BSUW23_01320"
FT                   /product="putative inner integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36321"
FT                   /db_xref="GOA:E0U0W8"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W8"
FT                   /protein_id="ADM36321.1"
FT                   /translation="MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTLVLGVISY
FT                   LLGDLYVLPRWNNMIATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIAMAIGE
FT                   YCFHFYMMSKEIGKKHYLETRTDS"
FT   gene            269737..270972
FT                   /locus_tag="BSUW23_01325"
FT   CDS_pept        269737..270972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01325"
FT                   /product="putative proteinase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36322"
FT                   /db_xref="GOA:E0U0W9"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0W9"
FT                   /protein_id="ADM36322.1"
FT                   /translation="MKGKLLTVMLLFMLCGGGCKPVEEPASSARSPFPSDSAKTKAYNI
FT                   HKGFIEAERRFGTELFQNMSDKDGLTDNLLISPYSLQQVLMMTANGAEGETLKEIKAAL
FT                   YVSGLHDSAINESSFALVKRFGSLPKGDLLTANAVWSKLEAKPDFKQTIKQFFSGSVFK
FT                   MDDNIQTAKNLINQWMAHQTKGHIDDIADHLSTEAVSLLVNAVYFQEKWALPFDQNVTA
FT                   EEQFFLPDGSAKKLLMMKQTARFAYLENELFQAVKLPYEDQQLSFTLFLPKKTPASFMS
FT                   LFTNQHIKAWDSAFQPKTVKLSMPRFTLKGQYNVKRALYEMGMKSVFSAADFSRMFTEG
FT                   SGVSIDDVNHHTFIKVDESGTEAAAASSVEIVESAIAPDVTLTANRPFFFVITDEQTTS
FT                   LLFLGFVANPNE"
FT   gene            271055..271483
FT                   /gene="cwlJ"
FT                   /locus_tag="BSUW23_01330"
FT   CDS_pept        271055..271483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="BSUW23_01330"
FT                   /product="cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36323"
FT                   /db_xref="GOA:E0U0X0"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X0"
FT                   /protein_id="ADM36323.1"
FT                   /translation="MAVVKATSADVDLLARLLRAEAEGEGKQGMLLVGNVGINRLRANC
FT                   SDFKGLRTIRQMIYQPHAFEAVTHGYFYQRARNSERALARRSINGERVWPAKFSLWYFR
FT                   PEGDCPPQWYNQPFVARYKSHCFYQPTGETCENVYNTF"
FT   gene            271589..272320
FT                   /gene="ycbR"
FT                   /locus_tag="BSUW23_01335"
FT   CDS_pept        271589..272320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbR"
FT                   /locus_tag="BSUW23_01335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36324"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR019303"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X1"
FT                   /protein_id="ADM36324.1"
FT                   /translation="MATIDLQKKSVKIVLEKKQLTKVAARVGLVLDITGSMRTLYKNGT
FT                   VQNVVERILAVADQFDDNGLLDIWVYDNEFSRLQPVSEKDFSGYVDREILNNDRLHKFG
FT                   RNDEPPVMKDVLRKYIVEEPSSYPAFVVFINDGGCKKSIKPIIEASSDKPVFWQFIGVG
FT                   NGNFDFLNKLDTLEGRAVDNTSFLHIEEIDRISDDELYDALLTEFPFWLKEAKEKGIVR
FT                   EQEPPAEKPKKKGFFSRLFSK"
FT   gene            272400..272576
FT                   /gene="yczK"
FT                   /locus_tag="BSUW23_01340"
FT   CDS_pept        272400..272576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczK"
FT                   /locus_tag="BSUW23_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36325"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X2"
FT                   /protein_id="ADM36325.1"
FT                   /translation="MDGLQTTRYAKNAPFSQLSARFSGRLVSEDLFLKFSAYNRFTLLH
FT                   SHLTMIFYNEGDQ"
FT   gene            272595..274346
FT                   /gene="phoD"
FT                   /locus_tag="BSUW23_01345"
FT   CDS_pept        272595..274346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="BSUW23_01345"
FT                   /product="phosphodiesterase/alkaline phosphatase D"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36326"
FT                   /db_xref="GOA:E0U0X3"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X3"
FT                   /protein_id="ADM36326.1"
FT                   /translation="MAYDNRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTI
FT                   AQSVGAFEVNAAPKFSSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPNQAVPVKW
FT                   EVAKDEHFRKIVRKGTEMAKPNLAHSIHVEADGLEPNKVYYYRFKTGHELSPVGKTKTL
FT                   PAPGANVPQMTFAFASCQQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTG
FT                   NVRTHNSAEIITLQDYRNRHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKG
FT                   QSVEAFVLRRAAAYQAYYEHMPLRISSLPNGPDMQLYRNFTYGNLASFNVLDTRQYRDD
FT                   QANNDGNKPPSDESRNPNRTLLGKEQEQWLFNNLSSSTAHWNVLAQQIFFAKWNFGTSA
FT                   SPIYSMDSWDGYPAQRERVINFINSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFG
FT                   AEFVGTSITSGGNGADKRADTDKILKENPHIKFFNDYRGYVRCTVTPHQWKADYRVMPF
FT                   VTEPGAAISTRASFVYQKDQTGLRKVSSTTIQGGVKQSNEVEEDRFFAHNKAHEKQMIK
FT                   KRAKITN"
FT   gene            274360..274572
FT                   /gene="tatAD"
FT                   /locus_tag="BSUW23_01350"
FT   CDS_pept        274360..274572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAD"
FT                   /locus_tag="BSUW23_01350"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36327"
FT                   /db_xref="GOA:E0U0X4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X4"
FT                   /protein_id="ADM36327.1"
FT                   /translation="MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATK
FT                   SLVSGDEKEEKSAELTAVKQDKNAG"
FT   gene            274634..275359
FT                   /gene="tatCD"
FT                   /locus_tag="BSUW23_01355"
FT   CDS_pept        274634..275359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCD"
FT                   /locus_tag="BSUW23_01355"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36328"
FT                   /db_xref="GOA:E0U0X5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X5"
FT                   /protein_id="ADM36328.1"
FT                   /translation="MDKKETHLIGHLEELRRRIIITLAAFLLFLITAFLFVQDIYDWLI
FT                   RDLDGKLAVLGPSEILWVYMMLAGICAIAASIPVAAYQLWRFVAPALTKTERKVTLMYI
FT                   PGLFALFLAGISFGYFVLFPIVLSFLTHLSSGHFETMFTADRYFRFMVNLSLPFGFLFE
FT                   MPLVVMFLTRLGVLNPYRLAKARKLSYFLLIVVSVLITPPDFISDFLVMIPLLVLFEVS
FT                   VTLSAFVYKKRLTSETAAA"
FT   gene            complement(275356..276003)
FT                   /gene="pcp"
FT                   /locus_tag="BSUW23_01360"
FT   CDS_pept        complement(275356..276003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BSUW23_01360"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36329"
FT                   /db_xref="GOA:E0U0X6"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X6"
FT                   /protein_id="ADM36329.1"
FT                   /translation="MRKKVLITGFDPFDKETVNPSWEAAKQLNGLETDEAIITAEQIPT
FT                   VFRTALDTLRQAILKHQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEE
FT                   ISPRGPAAYWTGLPVKRMTAKMKENGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIR
FT                   GGFIHIPFIPEQTIDKTAPSLSLDTIVRALRIAAVTAAQYDEDLKSPGGTLH"
FT   gene            276083..277195
FT                   /gene="ycbU"
FT                   /locus_tag="BSUW23_01365"
FT   CDS_pept        276083..277195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbU"
FT                   /locus_tag="BSUW23_01365"
FT                   /product="putative cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36330"
FT                   /db_xref="GOA:E0U0X7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X7"
FT                   /protein_id="ADM36330.1"
FT                   /translation="MEHLPQQYRQLFPTVQTHTMLASCSQSALAEPVSRAIKDYHDSLL
FT                   HMGTNWNEAIEKTESARNECAKLIGAEPDEIAIVPSVSDALVSVASSLAVFRKKHVVYT
FT                   EMDFPAVSHVWQAQSDYTVSVIPSIDGELPLEQYETYIMDETVLTCVPHVHYRDGFVQD
FT                   VKAIAEITHRKGSLLFVDAYQSAGHIPIDVKEWGVDMLAAGTRKYLLGIPGMAFLYVRK
FT                   ELADALKPKTSAWFGRESGFDAAYAKGARRFQTGTPAFVSIYAAAAALSLLNHIGVSHI
FT                   RDHVKTICTDACQYAAEKGLQLAAAPAGEQPGMVAIRDERASETAALLKKRKVICAPRD
FT                   TVIRLAPHFYNTKDELRHAIDEIAEIALRM"
FT   gene            complement(277238..278671)
FT                   /gene="lmrB"
FT                   /locus_tag="BSUW23_01370"
FT   CDS_pept        complement(277238..278671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrB"
FT                   /locus_tag="BSUW23_01370"
FT                   /product="efflux transporter; drug-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36331"
FT                   /db_xref="GOA:E0U0X8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X8"
FT                   /protein_id="ADM36331.1"
FT                   /translation="METAAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMKEL
FT                   NITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTLIAALAPSFS
FT                   FLLAARIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGLVL
FT                   EHLNWHWIFWISLPFLVLALVFGIAYMQNVSDITKPKIDVLSIILSTIGFGGIVFGFSN
FT                   AGEGSGGWSSPTVIVSLIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVFIC
FT                   MMVILSSMLLLPMYLQGGLVLTAFASGLILLPGGILNGFMSPVTGRLFDKYGPKWLVIP
FT                   GFVIVTVVLWFFSNITTTSTAALIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPDGT
FT                   AIMNTLQQMAGAIGTAVAGSIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFAMI
FT                   VAVIGLIGAFFLKRVKVDH"
FT   gene            complement(278721..279287)
FT                   /gene="lmrA"
FT                   /locus_tag="BSUW23_01375"
FT   CDS_pept        complement(278721..279287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrA"
FT                   /locus_tag="BSUW23_01375"
FT                   /product="transcriptional repressor of lmrAB and yxaGH
FT                   operons"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36332"
FT                   /db_xref="GOA:E0U0X9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0X9"
FT                   /protein_id="ADM36332.1"
FT                   /translation="MSYGDSREKILSAATRLFQLQGYYGTGLNQIIKESGAPKGSLYYH
FT                   FPGGKEQLAIEAVNEMKEYIRQKIADCMEAYTDPAEGIQAFLKELSCQFSCTEDIEGLP
FT                   VGLLAAETSLESEPLREACHEAYKEWASVYEEKLRLAGCSESHAKEVSTVINAMIEGGI
FT                   LLSLTAKNSTPLLHISSCIPDLLKR"
FT   gene            280081..280719
FT                   /gene="estA"
FT                   /locus_tag="BSUW23_01380"
FT   CDS_pept        280081..280719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="BSUW23_01380"
FT                   /product="secreted alkaliphilic lipase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36333"
FT                   /db_xref="GOA:E0U0Y0"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0Y0"
FT                   /protein_id="ADM36333.1"
FT                   /translation="MKFVKSKFIALVTILVLSVTSLFAMQPSAKAAEHNPVVMVHGIGG
FT                   ASYNFAGIKSYLVSQGWSRGKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDI
FT                   VAHSMGGANTLYYIKNLDGGNKIENVVTLGGANRLTTSKALPGTDPNQKILYTSIYSSA
FT                   DMIVMNYLSKLDGAKNVQIHGVGHIGLLMNSQVNSLIKEGLNGGGQNTN"
FT   gene            complement(280757..281140)
FT                   /gene="yczC"
FT                   /locus_tag="BSUW23_01385"
FT   CDS_pept        complement(280757..281140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczC"
FT                   /locus_tag="BSUW23_01385"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36334"
FT                   /db_xref="GOA:E0U0Y1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0Y1"
FT                   /protein_id="ADM36334.1"
FT                   /translation="MEFAGFMLRACALVLDVIIAAAVILAAGFTFGDGSAGVIIVAILM
FT                   VFVYPLLMPLTNWKGTLGKKIIGLQIVRDETYEKISLPQAIVRYMIAWVHVFSRLIYLT
FT                   AAFTKKKQAVHDMAAKTIVLKAE"
FT   gene            281375..282451
FT                   /gene="yccF"
FT                   /locus_tag="BSUW23_01390"
FT   CDS_pept        281375..282451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /locus_tag="BSUW23_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36335"
FT                   /db_xref="GOA:E0U0Y2"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0Y2"
FT                   /protein_id="ADM36335.1"
FT                   /translation="MGKVKRNAPCPCGSGKKYKKCCGSKVVDFPTELAAKEAKQIQEDL
FT                   VEYAFTVHRESISSFINQHDFLSAMDRQTKDISVFNLGIWGIFFHPLAGEKTIFEEYLQ
FT                   KKGDSITRPKTREIVESWKSMTPALLLLQDLKEGVIHFEDVITTKQFEVEMDANNQDLP
FT                   PVGSLILGYPIHEAEKAEFFMQFTIFPVKRTEALISKVKKYADAAVKNGKTPEDFMKQE
FT                   FNNVLFALLAEKDEEPQAEEAEESSIEWANDMEKETAAAIEEGMGGDEYPTELIPAVID
FT                   IWKTFCEKKSPVIRKPEAFAAAVEYYVNAISLNGASVSQAKLAKKYGVSASTISSRYKE
FT                   IESTLQDEADRFAQALSS"
FT   gene            complement(282491..282703)
FT                   /locus_tag="BSUW23_01395"
FT   CDS_pept        complement(282491..282703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36336"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0Y3"
FT                   /protein_id="ADM36336.1"
FT                   /translation="MLICENSTPGMEPKVLDTLYQSFGRSTKSGAHEGMGTYIIQKLVK
FT                   SAFGRLDFTYRHPVFRLEIKIPFQK"
FT   gene            282718..282969
FT                   /locus_tag="BSUW23_01400"
FT   CDS_pept        282718..282969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36337"
FT                   /db_xref="GOA:E0U0Y4"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0Y4"
FT                   /protein_id="ADM36337.1"
FT                   /translation="MSLVVFLPIFPMFFILSKAPNQFDLSYFLIPFLNLHALFKQLLFG
FT                   MVEPAAILYTSGTIAVLIAIFFLLARACFLKDKWVLPK"
FT   gene            283105..284037
FT                   /gene="yccK"
FT                   /locus_tag="BSUW23_01405"
FT   CDS_pept        283105..284037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /locus_tag="BSUW23_01405"
FT                   /product="putative ion channel associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36338"
FT                   /db_xref="GOA:E0U0Y5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0U0Y5"
FT                   /protein_id="ADM36338.1"
FT                   /translation="MDQTRTLGKTKLQVKRIGFGANAVGGHNLFPNLNDETGKDLVRTA
FT                   LDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVNGSIELDNSRKF
FT                   LRGEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQ
FT                   LQECNADGYLEVFQAEYSLIQRDAEKELLPYCEKHGISFIPYFPLASGLLTGKFTKDTV
FT                   FDDFRKDKPQFQGAAFIHNLQKVDKLKAVAEEKQAETAHVALAWLLTRSAIDAIIPGAK
FT                   RPEQLKDNLKTLNIELTEDEVNFISGIFT"
FT   gene            complement(284077..285141)
FT                   /gene="ycdA"
FT                   /locus_tag="BSUW23_01410"
FT   CDS_pept        complement(284077..285141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdA"
FT                   /locus_tag="BSUW23_01410"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36339"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1J2"
FT                   /protein_id="ADM36339.1"
FT                   /translation="MFQKKTYAVFLILLLMMFTAACSGSKTSAEKKNSETEKSSDIAQV
FT                   KIKDVSYTLPSKYDKSTSDDQLVLKVNVAVKNTGKEPLNVDSMDFTLYQDDTKMSDTDP
FT                   EDYNEKLRSSTINADKSVEGSLFYVVDKGKKYELNYTPESYGDKKPKSVTFKIDGKDKK
FT                   ILATADQLQDSAKALSAYVDVLLFGKDNADFEKITGDNKNKIVSDFNESAKDGYLSASG
FT                   LSSTYADSKALDNIVNGIKEGLSKNSSIQAKTTSISKDEAIVEATIKPVDASSLSDRIE
FT                   DRVKDYYSKNSGASYEDAVKYALQVYPEEFKKLGPASSEKTVEVKMKKNDIDQWQLDMD
FT                   DYRAAELVEAFIKE"
FT   gene            285488..286885
FT                   /gene="ycdB"
FT                   /locus_tag="BSUW23_01415"
FT   CDS_pept        285488..286885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdB"
FT                   /locus_tag="BSUW23_01415"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36340"
FT                   /db_xref="GOA:E0U1J3"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1J3"
FT                   /protein_id="ADM36340.1"
FT                   /translation="MKKEELKQKALEIGRVPTHLKLEIEDYGDDEKRGHFCWTDPQDEH
FT                   IGIIVELGPDGQLKSLSRDIEPESGERLSEEKLEDIMRQFVETHYPGALSVFVREEENC
FT                   TSDDKVRFSYVQMEDGLPLPMSGFMGEVSLSGEIIYFRYYGKAGSIIKPKRVADEEEAF
FT                   AFIKKDVEFDLLFEVLHRSVYKNGDDQPHLVYEPECRAVTVPADLVKEEQAFDDDDDRE
FT                   PESFPLPLFEGIHEKADLGSMIGIEKGFVKERETDLGDGRIRTVWRNPDDPVYQPADKS
FT                   MDSWFRGRVHQVLKTIHNKETGKLEGVMSFMEKKGPLTVTEAECEKRALRFLFALFPNA
FT                   DQYFKIKYDEPDEEENEVAGFTFEAHCHGVPLRFGQIRICVSRQTGHITVYMAPDIDPK
FT                   ELEAIHPVPAISAEQAKSIFWQHFKVELGWEREYRDDEEHSYRLVYKPVYPRFIEAHTG
FT                   EPVFSSW"
FT   gene            join(287071..287976,289333..289722)
FT                   /gene="ycdC"
FT                   /locus_tag="BSUW23_01420"
FT                   /note="locus interrupted by ISBsu1 insertion"
FT   CDS_pept        287071..287976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /locus_tag="BSUW23_01420"
FT                   /product="putative hydrolase, N-terminus; reading frame
FT                   truncated by ISBsu1 insertion"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36341"
FT                   /db_xref="GOA:E0U1J4"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1J4"
FT                   /protein_id="ADM36341.1"
FT                   /translation="MVNKQLKKKAQEIGNVPPHYELEIEDYNQKQKKKGQAYFIWKNPE
FT                   DPEKHITVELRHDGALLTFSTTVCSETDKKLPDAELKLMALQFAAANHPGTFMKFHFQG
FT                   KEERGKHIRFIYTKMELGLPLPNSGFLIDITRSGQIVHFLYYGEGHKAEVPNEFVAKEK
FT                   VVSHYLNTMSLQLMYDVIDGEQVPRLVYEPILPGYSYPADVDEIVPDQHIADERIENGA
FT                   PLPPFQNMEEINIYAMLGLTSDMQKVSEKDFGEEIGSTWRKGTAPERKDLSIGSYFETR
FT                   NKNTIKIKTDKKTGKLGLTP"
FT   mobile_element  287960..289248
FT                   /mobile_element_type="insertion sequence:ISBsu1"
FT                   /note="ten copies are present in genome"
FT   gene            288056..288388
FT                   /locus_tag="BSUW23_01425"
FT   CDS_pept        288056..288388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01425"
FT                   /product="ISBsu1 transposase, ORFA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36342"
FT                   /db_xref="GOA:E0TTK8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK8"
FT                   /protein_id="ADM36342.1"
FT                   /translation="MGTRVSYPVEVKQKAVEMRLAGVPMKEIMQKLNIKNKTQVQTWVR
FT                   WHKAGDTHRFEQPVGKQYTYGKGPEYSSELEKLQAENHYLRQQNEVLKKYNELERKLIA
FT                   KRQSNL"
FT   gene            288406..289206
FT                   /locus_tag="BSUW23_01430"
FT   CDS_pept        288406..289206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01430"
FT                   /product="ISBsu1 transposase, ORFB"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36343"
FT                   /db_xref="GOA:E0TY85"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0TY85"
FT                   /protein_id="ADM36343.1"
FT                   /translation="MTVQDICIHLGISRASYYRWKKNLTKDHPKRHLEKQIGTLCREHK
FT                   YRYGYRKITAILKKRMRINHKTVQRIMQKNQWQCQVKVKKRKKNGQPYAVVDNILDRNF
FT                   QSDRPLEKLVTDITYLPYGQKQLYLSSILDLYNGEVIAFTIGAKQDTDFVLDTLNQLPT
FT                   LPENCVLHSDQGSVYTSYEYQKAVNTKGITMSMSRKGTPADNASIESFHSSLKSETFYL
FT                   NSIDRTTTAIVERTVIEYIHYYNNIRIQTKLNNQSPINYRQLAV"
FT   gene            complement(289729..290232)
FT                   /gene="cwlK"
FT                   /locus_tag="BSUW23_01440"
FT   CDS_pept        complement(289729..290232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlK"
FT                   /locus_tag="BSUW23_01440"
FT                   /product="murein L,D:-endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36345"
FT                   /db_xref="GOA:E0U1J7"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1J7"
FT                   /protein_id="ADM36345.1"
FT                   /translation="MKLSAKTSVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHP
FT                   VVKQNADALKAAAANKGITVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNY
FT                   GLAIDFALQKKDGSIIWDMEYDGNQNGKSDWLEVVEIAKKLGFEWGGDWKRFKDYPHLE
FT                   MVPD"
FT   gene            290353..291474
FT                   /gene="rapJ"
FT                   /locus_tag="BSUW23_01445"
FT   CDS_pept        290353..291474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapJ"
FT                   /locus_tag="BSUW23_01445"
FT                   /product="response regulator aspartate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36346"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1J8"
FT                   /protein_id="ADM36346.1"
FT                   /translation="MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEE
FT                   NQDLLLYFSLMEFRHRIMLDKLMPVRDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYF
FT                   RGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYAS
FT                   QALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALDHARQLEEAYMIAAA
FT                   HYNVGHCKYSLGDYCEAEGYFKTAAAIFKEHNFQQAVQAVFSLTHMYCKEGKYDKAVET
FT                   YGRGVKSAAEWEDDMYLTKFRLIHELYLGSGDRNVLKECFDLLESRQLLADAEDLLHDT
FT                   AERFNQQERYESAAFFYRRLMNIKKKLAEQRFQ"
FT   gene            291584..292360
FT                   /gene="ycdF"
FT                   /locus_tag="BSUW23_01450"
FT   CDS_pept        291584..292360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="BSUW23_01450"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36347"
FT                   /db_xref="GOA:E0U1J9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1J9"
FT                   /protein_id="ADM36347.1"
FT                   /translation="MYKDLTGKTAIVTGSSKGIGKAIAERFGQEKMNVVVNYHSDPSGA
FT                   DETVDIIKHSGGKAVAVEADVSKEAGIQALLDAALEHFGTLDVMVNNSGFNGAEAMPHE
FT                   MSLEDWQRVIDVNVTGTFMGAKAALNHMMKNNIKGNVLNISSVHQQIPRPANVQYSTSK
FT                   GGIKMMTETLALNYANKGIRVNAIAPGTIATESNVDTKKEVNRQEQLKKIPMKTFGKPE
FT                   EVAAAAAWLVSEEASYVTGTTLFVDGGMTLYPSQLE"
FT   gene            292385..294076
FT                   /gene="ycdG"
FT                   /locus_tag="BSUW23_01455"
FT   CDS_pept        292385..294076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdG"
FT                   /locus_tag="BSUW23_01455"
FT                   /product="putative glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36348"
FT                   /db_xref="GOA:E0U1K0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K0"
FT                   /protein_id="ADM36348.1"
FT                   /translation="MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGA
FT                   DVIWICPIYPSPNVDYGYDVTDHKTIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHT
FT                   SVEHPWFKEAELDKNSKYRSYYFWRPGTKNGPPTDWVSAYGRPVWQYEEHTGEYYLHMN
FT                   AVKQADLNWEHPEVRQAVFDMMRFWLDKGVDGLRIDQLHLISKKGYLPSYEDYINQQAE
FT                   PKPFQPNGERIHDYLKEMTDEVFSRYDVMSVGEVGGVTPEEGLKYTGTDKHELNMIFHF
FT                   QHMELDQQPGKEHWDVKPLELSDLKSVLTSWQKKLEHQGWNTLYWCNHDQPRIVSRFGD
FT                   DGEYRKASAKMLATVLYLMKGTPYIYQGEEIGMTNAPFTRIKDYKDIQTINMYHKRVFE
FT                   KGYDPEDVMRSILAKSRDHARTPMQWSSGKNAGFTDGTPWLKVNPNFSSINVEEAQTDP
FT                   DSILTYYKKLISLRKEYADLIKGSYELLLPDDPQLFVYMRQNGKQQLLSVNNFSKEQAV
FT                   FRWPKNCRKDQSSLLLSNYKNNGDLADEMVFQPYESRVYLLDNSIK"
FT   gene            294259..295227
FT                   /gene="adcA"
FT                   /locus_tag="BSUW23_01460"
FT   CDS_pept        294259..295227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="BSUW23_01460"
FT                   /product="Zn(II)-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36349"
FT                   /db_xref="GOA:E0U1K1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K1"
FT                   /protein_id="ADM36349.1"
FT                   /translation="MFKKWSGLFVIAACFLLVAACGNSSTKGSTDSKSGKLHIVTTFYP
FT                   MYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSTE
FT                   KSMGQGHAVFVNASKGIDLMEGSEEEHEEHEEHEHGEHEHSHAMDPHVWLSPVLAQKEV
FT                   KNITAQIVKQDPDNKEYYEKNSAEYIAKLQDLDKLYRTTVKKAAKKEFITQHTAFGYLA
FT                   KEYGLTQVPIAGISPNQEPSAADLAKLKTYAKEHNVKVIYFEEIASSKVAETLANEIGA
FT                   KTEVLDTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLLDKS"
FT   gene            295282..295977
FT                   /gene="adcC"
FT                   /locus_tag="BSUW23_01465"
FT   CDS_pept        295282..295977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="BSUW23_01465"
FT                   /product="Zn(II) transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36350"
FT                   /db_xref="GOA:E0U1K2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K2"
FT                   /protein_id="ADM36350.1"
FT                   /translation="MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTL
FT                   MKVMLGMLKPWEGTVTISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKG
FT                   KWFKRLNEEDHLEVEKALKMVEMWELRHRKIGDLSGGQKQKICIARMLASNPDLLMLDE
FT                   PTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCL
FT                   TWNSCDELF"
FT   gene            295935..296777
FT                   /gene="adcB"
FT                   /locus_tag="BSUW23_01470"
FT   CDS_pept        295935..296777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="BSUW23_01470"
FT                   /product="high affinity Zn(II) ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36351"
FT                   /db_xref="GOA:E0U1K3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K3"
FT                   /protein_id="ADM36351.1"
FT                   /translation="MEMFDLEFMRRAFLAGGMIAIMAPILGVYLVLRRQALMADTLSHI
FT                   SLSGVAIGFFLSTNITAASIVVVTVGAIGIEYMRRAYRTYSEVSIAILMAAGLSFAMFL
FT                   ISFSKGTANMSIDQYLFGSLVTVNQQQVYIIGIITLLILLYFVVLKRPLYLLTFDEATA
FT                   KTSGINTNVLSMSFSIVTGLAISVIIPIIGVLLVSALLVLPAAFAIRIAKGFNMVFITA
FT                   ILISLFSVFMGLTSSYQLGTPPGPSITLLLIVLLLIGFVAQGVWTFIKKEALRKKGRR"
FT   gene            complement(296815..297861)
FT                   /gene="yceB"
FT                   /locus_tag="BSUW23_01475"
FT   CDS_pept        complement(296815..297861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /locus_tag="BSUW23_01475"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36352"
FT                   /db_xref="GOA:E0U1K4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K4"
FT                   /protein_id="ADM36352.1"
FT                   /translation="MPILVSHAKNRQKGSGLLIHLSILDQAPVSKGESPVTTLQHSIEL
FT                   AQLSEQWGYKRYWFAEHHSTKGLASTAPEIMIARIAAHTSTIRVGSGGVLLPQYSPFKV
FT                   AETFRQLEALYPNRIDLGVGRSPGGTTKTRLALTDGVKKSLTEFNRQLQDVSYFLTDSL
FT                   PAGHPYAGIKAAPLIDTVPELWVLGLGENSARRAAHQGIGYVFGHFINPERGENAFRVY
FT                   RESFRPSAHFSSPAALFTIFVICAKTDEEAEELALSQDLWLLRVGKGLDSRVPSIEEAK
FT                   AYHYTESDKNQIRENRKRMVIGSPSTVKQQLLELTERYETNEIMVLCNVFDFEAKKESY
FT                   EHLAGMFL"
FT   gene            298093..298692
FT                   /gene="yceC"
FT                   /locus_tag="BSUW23_01480"
FT   CDS_pept        298093..298692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="BSUW23_01480"
FT                   /product="putative stress adaptation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36353"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K5"
FT                   /protein_id="ADM36353.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKLMVGLGWDPVSSGGGFFSKLLGG
FT                   GGPNIDCDASVLMLENGKFTDKKNIIYFGNLKSRCGSVRHTGDNLTGDGAGDDEQIMID
FT                   LEKVPENIDKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQSNHEEMLKYNLRDNYAGRT
FT                   SLITAEIYRSGSEWKFAAIGEGTNDTRLEDIISRYV"
FT   gene            298714..299295
FT                   /gene="yceD"
FT                   /locus_tag="BSUW23_01485"
FT   CDS_pept        298714..299295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="BSUW23_01485"
FT                   /product="putative stress adaptation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36354"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K6"
FT                   /protein_id="ADM36354.1"
FT                   /translation="MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSS
FT                   VFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANID
FT                   KISFVITIHEAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYR
FT                   HNGEWKFSAIGSGYQGGLARIATDYGLQVG"
FT   gene            299330..299908
FT                   /gene="yceE"
FT                   /locus_tag="BSUW23_01490"
FT   CDS_pept        299330..299908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="BSUW23_01490"
FT                   /product="putative stress adaptation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36355"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K7"
FT                   /protein_id="ADM36355.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLAKAVIGLGWDTNKYSGGHDFDLDAS
FT                   AFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIE
FT                   KIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQDELLRFDLGEDFSIETAVVVCELYR
FT                   HGGEWKFNAIGSGFSGGLAALCRNYGLQV"
FT   gene            299960..300733
FT                   /gene="yceF"
FT                   /locus_tag="BSUW23_01495"
FT   CDS_pept        299960..300733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceF"
FT                   /locus_tag="BSUW23_01495"
FT                   /product="putative stress adaptation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36356"
FT                   /db_xref="GOA:E0U1K8"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K8"
FT                   /protein_id="ADM36356.1"
FT                   /translation="MDFLHHIMSTYASFFDWKMWGEVLSDPVSWGLIGSLVVLEGLLSA
FT                   DNALVLAVMVKHLPEKQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAW
FT                   LVIKHFWIGEKEEETDGMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEK
FT                   VWVLLIGGMLGILMMRTVAKVFLVLIDKIPELENTAFVLIGIIALKMAASAFHYEMPHS
FT                   VFFIIIIAAFAVTFVIHYINKQKQVREQTAASKEE"
FT   gene            300817..302430
FT                   /gene="yceG"
FT                   /locus_tag="BSUW23_01500"
FT   CDS_pept        300817..302430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="BSUW23_01500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36357"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1K9"
FT                   /protein_id="ADM36357.1"
FT                   /translation="MRQEELTIHKALPVDGDWKNLLFQPLPERDHYETEQGLSFSRLAG
FT                   QILGTPIDETDYYNELYELSVNDRISILSETLDKTIGPETFQKLQHINSINQKEKGLSV
FT                   SRFVAFLDGEKLIAKHSNPLMHRHLRKALMTLLHTFEDNHEQGLNHPDFRRVLLDVSKF
FT                   SLNHLNPWLEKNDIEREMPKVVWYGDATKSQLYFLYYLMLVGCDVLLFHPAGNDQLALV
FT                   DPKQELSFTEKLPDVSELQPFPKEKPDRKSTVAYRSTKEIEHVLNHEESMLYKPWQFRD
FT                   HTPVSVTLKTTYDELFLIAKERAFIRPNFKADKHSIEIPNVFAKIMGVSKDNKEYWNRL
FT                   HTLADYQETEMVRSFPFTEEIKSNYQFHYSHALDHEGNIDPDKLMASNVWQYKQLPAGV
FT                   QTAIAKTISRMCRHPRLKALHQEQVKDVQIYLFKQTTNLPANLLKLIQMFDYAQTVPKL
FT                   VLYHTEMSGGLTRSDAAALLFLNEIGIDIIIYNPPGHQDIEQFIEEDQYDIHWLDDMVF
FT                   QQDYKEPSLVKRLFRTITQK"
FT   gene            302446..303537
FT                   /gene="yceH"
FT                   /locus_tag="BSUW23_01505"
FT   CDS_pept        302446..303537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /locus_tag="BSUW23_01505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36358"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L0"
FT                   /protein_id="ADM36358.1"
FT                   /translation="MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLVQQIDVK
FT                   NQMELLEYGKEPAVEISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKG
FT                   LMAKIFKRGGSMIEKIFKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYY
FT                   MELEKYVVAGQMKLEEMQSILPSYEEKAANGNQLAQMQLDTLRNGIQALEERVYDLDMA
FT                   RMVALQTAPQIRLLQRGNAKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSEL
FT                   DRRTNEMLRRNAENISSQSVEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKR
FT                   LREDGARRIAQLQDNIKKAALQQ"
FT   gene            303660..304862
FT                   /gene="yceI"
FT                   /locus_tag="BSUW23_01510"
FT   CDS_pept        303660..304862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceI"
FT                   /locus_tag="BSUW23_01510"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36359"
FT                   /db_xref="GOA:E0U1L1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L1"
FT                   /protein_id="ADM36359.1"
FT                   /translation="MGKQQPISQRKLLGVAGLGWLFDAMDVGILSFIIAALHVEWNLSP
FT                   EEMKWIGSVNSIGMAAGAFLFGLLADRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLI
FT                   LRFVIGMGLGGELPVASTLVSEAVVPEKRGRVIVLLESFWAVGWLVAALISYFVIPSFG
FT                   WQAALLLTALTAFYALYLRTSLPDSPKYESLSAKKKTVWENVKSVWARQYIRPTVMLSI
FT                   VWFCVVFSYYGMFLWLPSVMLLKGFSMIQSFEYVLLMTLAQLPGYFSAAWLIEKVGRKW
FT                   ILVIYLIGTAGSAYFFGTADSLGLLLTAGMLLSFFNLGAWGVLYAYTPEQYPTAIRATG
FT                   SGTTAAFGRIGGIFGPLLVGTLAARHISFSVIFSIFCIAILLAVVCILIMGKETKQTEL
FT                   E"
FT   gene            complement(304893..305030)
FT                   /locus_tag="BSUW23_01515"
FT   CDS_pept        complement(304893..305030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01515"
FT                   /product="putative efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36360"
FT                   /db_xref="GOA:E0U1L2"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L2"
FT                   /protein_id="ADM36360.1"
FT                   /translation="MVLYQRTHHFGAVTGFTAILFMLSMAVYQTIHKTGKHRSIARAQM
FT                   "
FT   gene            complement(305136..305366)
FT                   /gene="yceK"
FT                   /locus_tag="BSUW23_01520"
FT   CDS_pept        complement(305136..305366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceK"
FT                   /locus_tag="BSUW23_01520"
FT                   /product="putative transcriptional regulator (ArsR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36361"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L3"
FT                   /protein_id="ADM36361.1"
FT                   /translation="MTTKLLDDQIRAQKCKALSDESGLAIIRTLYYSGKELSCGEVGEK
FT                   CNIVKTTAFYHFKTLREDTFQTYLPSFLETL"
FT   gene            305663..306916
FT                   /gene="opuAA"
FT                   /locus_tag="BSUW23_01525"
FT   CDS_pept        305663..306916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="BSUW23_01525"
FT                   /product="glycine betaine ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36362"
FT                   /db_xref="GOA:E0U1L4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L4"
FT                   /protein_id="ADM36362.1"
FT                   /translation="MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGS
FT                   TVGVNQADFDVYDGEIFVIMGLSGSGKSTLVRLLNRLIEPTAGNIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFE
FT                   QQYPDQLSGGMQQRVGLARALTNNPDILLMDEAFSALDPLIRKDMQDELLDLHENVGKT
FT                   IIFITHDLDEALRIGDRIALMKDGNIVQIGTPEEILMSPSNEYVEKFVEDVDLSKVLTA
FT                   GHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKKLLGVIHASDAKKAAESDLSL
FT                   QDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVKGALIGALAGNNDY
FT                   INVEGTEQTQDPSVQEVK"
FT   gene            306918..307766
FT                   /gene="opuAB"
FT                   /locus_tag="BSUW23_01530"
FT   CDS_pept        306918..307766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAB"
FT                   /locus_tag="BSUW23_01530"
FT                   /product="glycine betaine ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36363"
FT                   /db_xref="GOA:E0U1L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L5"
FT                   /protein_id="ADM36363.1"
FT                   /translation="MDRLPRIPLADMIDRFVDWITMTFGGFFDGIANGLAAFVNGIVSG
FT                   LGFIPSILLTIIFAALAWWISTRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIIS
FT                   IVVGVPIGIWASQKETVRRIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFA
FT                   MPPTIRMTVLGIKQVPADLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALS
FT                   MVVIAAMVGAPGLGSEVYSAVTQLKTGVGVEAGIAIVIVAITLDRITQNIKVKKKSRGN
FT                   A"
FT   gene            307766..308647
FT                   /gene="opuAC"
FT                   /locus_tag="BSUW23_01535"
FT   CDS_pept        307766..308647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /locus_tag="BSUW23_01535"
FT                   /product="glycine betaine ABC transporter (glycine
FT                   betaine-binding lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36364"
FT                   /db_xref="GOA:E0U1L6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L6"
FT                   /protein_id="ADM36364.1"
FT                   /translation="MLKKIIGIGVSAMLALSLAACGSESDENATAAEQVNKTIIGIDPG
FT                   SGIMTLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKL
FT                   KYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDDMGEVMIKVEEGEKPA
FT                   KAAAEYVKKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVVGKVLEDLGYDVTF
FT                   TQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDVGVSVTGVKMGLVVPQY
FT                   MKNVNSIEDLKK"
FT   gene            complement(308685..309836)
FT                   /gene="amhX"
FT                   /locus_tag="BSUW23_01540"
FT   CDS_pept        complement(308685..309836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BSUW23_01540"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36365"
FT                   /db_xref="GOA:E0U1L7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L7"
FT                   /protein_id="ADM36365.1"
FT                   /translation="MQKLSEDMKQTVMDIFEHLHANPEVSWKEYETTAFLKQKLEDLGC
FT                   RTCTFSDCTGVVGEIGSGSPVVAVRADIDALWQEVNGTFRANHSCGHDSHMTMALGTLM
FT                   LLKKQPELPKGTIRFIFQPAEEKGGGALKMIEEGVLDDVDYLYGVHIRPIQETQNGRCA
FT                   PSILHGSSQHIEGTIIGEEAHGARPHLGKNSIEIAAFLVHKLGLIHIDPKIPHTVKMTK
FT                   LQAGGESSNIIPGKASFSLDLRAQTNEAMETLITETERACEAAAAAFGARIELQKEHSL
FT                   PAATENKEAEAIMAEAITDIIGAEQLDEPLVTTGGEDFHFYAVKVPNLKTTMLGLGCGL
FT                   QPGLHHPHMTFDRNAMFNGIHILANAVLKTFQKAESLAAANAS"
FT   gene            309986..311419
FT                   /gene="ycgA"
FT                   /locus_tag="BSUW23_01545"
FT   CDS_pept        309986..311419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /locus_tag="BSUW23_01545"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36366"
FT                   /db_xref="GOA:E0U1L8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L8"
FT                   /protein_id="ADM36366.1"
FT                   /translation="MSMPAAETQPKKKRTTFKMPDAYVLLFIIAFICAIASYIVPAGEF
FT                   DRVTKGDVTTAVPGSYHSIEQSPVSLISFFTSLQDGMVGSAPIIFLILFTGGTIAILEK
FT                   TGAINGLIYNVISKFRTKQLLFICIVGALFSILGTTGIVVNSVIGFIPIGLIVARSLKW
FT                   DAVAGAAVIYIGCYAGFNSTILSPSPLGLSQSIAELPLFSGIGLRVLIYICFLLSSIIY
FT                   IYLYTRKLKKSKDASVLGTNWFPAAGMSEAGKEEDQSVPFTVRHKLILAVAGLSLIGFL
FT                   YGALKLGWSDSQMAATFIFISVLAGLIGRLAANDIAKTFIMGCQGLVYGALIVGMARSI
FT                   SVILENGKLLDTVVNALASVLDGFSPMAGAIGMYIASALLHFLISSGSGEAVVFIPILA
FT                   PLADLMGITRQVAVEAVMLGEGVVNCVNPTSGVLMAVLAASGIPYVKWLRFMLPLALIW
FT                   FLIGLVFICIGVLINWGPF"
FT   gene            311535..312023
FT                   /gene="ycgB"
FT                   /locus_tag="BSUW23_01550"
FT   CDS_pept        311535..312023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="BSUW23_01550"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36367"
FT                   /db_xref="GOA:E0U1L9"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1L9"
FT                   /protein_id="ADM36367.1"
FT                   /translation="MNNLHNRLSGVNGKNKRVKKEQKIWSEIGMIAGAFTLLDVIVRGI
FT                   MFEFPFKEWAASLVFLFIIILYYCIRAAASGMLLPRIDTEEELQKRVKQQRIESIAVAF
FT                   AVVVLTMYDRGIPHTFFAWLKMILLFIVCGGVLFLLRYMIVKLAYRRAVKEEAEKKSS"
FT   gene            312276..314255
FT                   /gene="amyE"
FT                   /locus_tag="BSUW23_01555"
FT   CDS_pept        312276..314255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyE"
FT                   /locus_tag="BSUW23_01555"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36368"
FT                   /db_xref="GOA:E0U1M0"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="InterPro:IPR031965"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M0"
FT                   /protein_id="ADM36368.1"
FT                   /translation="MFEKRFKTSLLPLFAGFLLLFHLVLGGSAAANAETQNTSKELTAP
FT                   SIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQ
FT                   PTSYQIGNRYLGTEQEFKEMCAAAEEYGVKVIVDAVINHTTSDYAAISNEIKSIPNWTH
FT                   GNTQIKNWSDRWDVTQNSLLGLYDWNTQNAQVQSYLKRFLERALNDGADGFRFDAAKHI
FT                   ELPDDGNYGSQFWPNITNTSAEFQYGEILQDSASRDAAYANYMNVTASNYGHSIRSALK
FT                   NRNLSVSNISHYASDVSVDKLVTWVESHDTYANDEEESTWMSDDDIRLGWAVIASRSGS
FT                   TPLFFSRPEGGGNGVRFPGKSQIGDRGSGLFEDQAITAVNRFHNVMDGQPEELSNPNGN
FT                   NQIFMNQRGSHGVVLANAGSSSVTINTSTKLPDGRYDNKAGNGSFQVTDGKLTGTLNAR
FT                   SVVVLYPDDIANAPHVFLENVKTGVTHSFNDQLTITLRADANTTKAVYQINNGQETAFK
FT                   DGDQLTIGKGDSFGTTYNITLTGTNSDGVTRTQEYRFVKKDPSAAKTIGYQNPNHWGQV
FT                   NAYIYKHDGGRAIELAGSWPGRAMAKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQ
FT                   NQPGFDYVQNGLYNDSGLSGSLPH"
FT   gene            314432..315394
FT                   /gene="ldh"
FT                   /locus_tag="BSUW23_01560"
FT   CDS_pept        314432..315394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="BSUW23_01560"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36369"
FT                   /db_xref="GOA:E0U1M1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M1"
FT                   /protein_id="ADM36369.1"
FT                   /translation="MNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMG
FT                   DVMDLNHGKAFAPQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKG
FT                   IVSEVMASGFDGIFLIATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRYMLSEYF
FT                   GAAPQNVHALSEDKHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAA
FT                   YHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRG
FT                   GIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN"
FT   gene            315426..317051
FT                   /gene="lctP"
FT                   /locus_tag="BSUW23_01565"
FT   CDS_pept        315426..317051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BSUW23_01565"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36370"
FT                   /db_xref="GOA:E0U1M2"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M2"
FT                   /protein_id="ADM36370.1"
FT                   /translation="MWEQLYDPFGNEYVSALVALTPILFFLLALTVFKMKGILSAFLTL
FT                   AVSFFVTVLAFHMPVEKAISSVLLGIGSGLWPIGYIVLMAVWLYKIAVKTGKFTIIRSS
FT                   IAGISPDQRLQLLLIGFCFNAFLEGAAGFGVPIAISAALLVELGFKPLKAAALCLIANA
FT                   ASGAFGAIGIPVITGAQIGDLSALELSRTLMWTLPMISFLIPFLLVFLLDQMRGIKQTW
FT                   PALLVVSGVYTAVQTLTMAVLGPELANILAALFSMGGLALFLRKWQPKEIYREEGAGET
FT                   GEKKAYSAADIAKAWSPFYILTAAITIWSLPAFKALFQEGGLLYQTTLLLKMPFLHQQM
FT                   MKMPPIAPTAMPLDAVFKVDLLSATGTAILAAVIVTGLFSKKFSYRDAFASLKETGKEL
FT                   WVPIMTICFVMGFANLANFAGLSSSIGLALAKTGDLFPFVSPVLGWIGVFITGSVVSNN
FT                   ALFGHLQVVTGAQIGAGSDLLLAANTAGGVMAKLVSPQSIAIAAAAVGQTGKESKLFKR
FT                   TVAYSLILLLIICIWTFILARLGL"
FT   gene            complement(317091..318632)
FT                   /gene="mdr"
FT                   /locus_tag="BSUW23_01570"
FT   CDS_pept        complement(317091..318632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdr"
FT                   /locus_tag="BSUW23_01570"
FT                   /product="multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36371"
FT                   /db_xref="GOA:E0U1M3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M3"
FT                   /protein_id="ADM36371.1"
FT                   /translation="MDTTSAKQASTKFVVLGLLLGILMSAMDNTIVATAMGSIVADLGS
FT                   FDKFAWVTASYMVAVMAGMPIYGKLSDMYGRKRFFLFGLIFFLIGSALCGIAQTMNQLI
FT                   IYRAIQGIGGGALLPIAFTIIFDLFPPEKRGKMSGMFGAVFGLSSVLGPLLGAIITDSI
FT                   SWHWVFYINVPIGALSLFFIIRYYKESLEHKKQKIDWGGAITLVVSIVCLMFALELGGK
FT                   TYDWNSIQIIGLFIIFAVFFIAFFIVERKAEEPIISFWMFKNRLFATAQILAFLYGGTF
FT                   ILLAVFIPIFVQSVYGSSATSAGFILTPMMIGSVIGSMIGGIFQTKASFRNLMLISVTA
FT                   FFIGMLLLSNMTPETARVWLTVFMMISGFGVGFNFSLLPAASMNDLEPRFRGTANSTNS
FT                   FLRSFGMTLGVTIFGTVQTNVFTNKLSDAFSGMKGSAGSGAAQNIGDPQEIFQAGTRSQ
FT                   IPETILNRIIDAMSASITYVFLLALIPIALAAVTVLFMGKARVKTTAEMAKKANE"
FT   gene            318745..319209
FT                   /gene="ycgE"
FT                   /locus_tag="BSUW23_01575"
FT   CDS_pept        318745..319209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgE"
FT                   /locus_tag="BSUW23_01575"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36372"
FT                   /db_xref="GOA:E0U1M4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M4"
FT                   /protein_id="ADM36372.1"
FT                   /translation="MSTRNSRSDLEKTAVQLFRKLSTRTVLFHQAAAQALGLFPTDLKS
FT                   ADILNEAGPMTAGELGKKTGLSTGSVTALVDRLEKAGYVAREKDPDDRRRVIIVPLTAS
FT                   KKHVKDLFRSLSESTMDLCREYTEEELELIFSFVGKAADIVEEELNRLKQ"
FT   gene            319284..319913
FT                   /gene="ycgF"
FT                   /locus_tag="BSUW23_01580"
FT   CDS_pept        319284..319913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgF"
FT                   /locus_tag="BSUW23_01580"
FT                   /product="putative aminoacid export permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36373"
FT                   /db_xref="GOA:E0U1M5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M5"
FT                   /protein_id="ADM36373.1"
FT                   /translation="MNIFLSYIVLGLSLSAPVGPVNAAQIDKGIKNGFWHAWIFGLGAM
FT                   TADGLYMLFIYFGLSQFLTAPFVKTFLWLFGFFVLTYTGIETLKNVREPMDVRSSRGKV
FT                   SYRKTFASGFLISLSNPLSILFWLGIYGSILAKTAEAYNMNQLLIYSSGIMIGILIWDF
FT                   CMAITASMFRNLLHEKLLRGLTGIAGVSLLIFGFYFGYQGIKQLLG"
FT   gene            319983..320744
FT                   /gene="ycgG"
FT                   /locus_tag="BSUW23_01585"
FT   CDS_pept        319983..320744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgG"
FT                   /locus_tag="BSUW23_01585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36374"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M6"
FT                   /protein_id="ADM36374.1"
FT                   /translation="MVNGIYTKSFLERNQAELPEWQRIAFELLAETVADDADTFPCIPG
FT                   RQAFLTDQLRIAFAGDPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEH
FT                   YSIEAYEELFWSFLNRLSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFILCATPGHEAR
FT                   KSRSFPYFMIAFQPRWVFDDLNGSTVSGQNMSRLIRSRLKAYDQAPVHPHLGWYGGKDN
FT                   REWKQYFLRDDEKQVSKCPFSYLKNMFNKMK"
FT   gene            complement(320746..322086)
FT                   /gene="ycgH"
FT                   /locus_tag="BSUW23_01590"
FT   CDS_pept        complement(320746..322086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="BSUW23_01590"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36375"
FT                   /db_xref="GOA:E0U1M7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M7"
FT                   /protein_id="ADM36375.1"
FT                   /translation="MSQTKKDQQKGNLAWWQLSLIGIGCTIGTGFFLGSSIAIVKSGFS
FT                   VLLSFLIGAIGTYFVFEQLAKLSAKQPEKGSFCAYARKAFGRWAGFSNGWVYWSSEMLI
FT                   TGSQLTAISLFTKHWFPQVPLWVFASIYAVLGLLIIFTGLSVFEKTENVLAVIKTAAIF
FT                   MFIVIAILALCGILSGGKHDVQVPNKTSEFFPYGAMGLWTGLIYAFYAFGGIEVMGLMA
FT                   VHLKKPEEASKSGKLMLATLAIIYIISIGLALLLVPLDMFTEQDSPFITSLKGYNLKII
FT                   LDIFNGIFIIAGFSTLVASLFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAG
FT                   LVLSIILSLVLPKNIYEHMTTAAGLMLLYTWLFILFSSKKLTDPEGMGKTQIYLAMILI
FT                   AAAVSGTLFEKSSRPGFFVSIGFLVIIAIVTMIYQKKQGHKDRPASS"
FT   gene            322216..322812
FT                   /gene="ycgI"
FT                   /locus_tag="BSUW23_01595"
FT   CDS_pept        322216..322812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgI"
FT                   /locus_tag="BSUW23_01595"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36376"
FT                   /db_xref="GOA:E0U1M8"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M8"
FT                   /protein_id="ADM36376.1"
FT                   /translation="MTQQYIVEPKKGLGLKLKKGQILKVVDVEGQQVADFVAYHAKDFY
FT                   EHLDQGATIDANHSIHVKVNDHIYSNLYKPMLTLIEDTVGKHDLLLPACRPDMNRLLYG
FT                   KQKDEFQDTCYDNMNRALEQFGVPKPHMHYPFAIFMNTVLDEKGNLSVETPLSNAGDYV
FT                   RLRAEMDLIVAFSSCPIEKGKCNGDSVTSIRVEVS"
FT   gene            322945..323763
FT                   /gene="nadE"
FT                   /locus_tag="BSUW23_01600"
FT   CDS_pept        322945..323763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BSUW23_01600"
FT                   /product="NAD synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36377"
FT                   /db_xref="GOA:E0U1M9"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1M9"
FT                   /protein_id="ADM36377.1"
FT                   /translation="MSMQEKIMRELHVKPSIDPKQEIEDRINFLKQYLKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVERIREEGGVAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSW
FT                   KFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVIGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGKSLLKELGAPERLYLKEPTADLLDDKPQQADE
FT                   TELGISYEEIDDYLEGKEVSAKVSEALENRFSITEHKRQVPASMFDDWWK"
FT   gene            complement(324037..324630)
FT                   /gene="tmrB"
FT                   /locus_tag="BSUW23_01605"
FT   CDS_pept        complement(324037..324630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmrB"
FT                   /locus_tag="BSUW23_01605"
FT                   /product="ATP-binding tunicamycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36378"
FT                   /db_xref="GOA:E0U1N0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N0"
FT                   /protein_id="ADM36378.1"
FT                   /translation="MIIWINGAFSSGKTQTAFELHRRLKASYVYDPEKMGFALRSMIPP
FT                   EIAEDDFQSYPLWRTFNYSLLASLTDTYRGIIIVPMTIVHPEYFNEIIGRLRHDGRTVH
FT                   HFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCIEGLASPIFVDHLQTDNMSIQDAAET
FT                   IAARANLTLAPDTRGILRRSIDRLMVKLNHIRIK"
FT   gene            324937..325497
FT                   /gene="aroK"
FT                   /locus_tag="BSUW23_01610"
FT   CDS_pept        324937..325497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BSUW23_01610"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36379"
FT                   /db_xref="GOA:E0U1N1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N1"
FT                   /protein_id="ADM36379.1"
FT                   /translation="MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQE
FT                   IEKDFNMSIPEMFEEKGEDFFRKTEKEYILDICRHKRFKIVSLGGGSFKQEEIRKCCLE
FT                   NCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNL
FT                   SPEEVADYIVETLKIGWDLYQPM"
FT   gene            complement(325527..326288)
FT                   /gene="ycgJ"
FT                   /locus_tag="BSUW23_01615"
FT   CDS_pept        complement(325527..326288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgJ"
FT                   /locus_tag="BSUW23_01615"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36380"
FT                   /db_xref="GOA:E0U1N2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N2"
FT                   /protein_id="ADM36380.1"
FT                   /translation="MRNETPFSKNAVMYRDEKVFAEGKDLGVMIKTAECRADQRVLDIG
FT                   AGAGHTALAFSPYVQECIGIDATKEMVEVASTFAQEKGAGNVRFQQGTAESLPFPDDSF
FT                   DLITCRYAAHHFSDVRKAVSEVARVLKKDGRFLLIDHYAPEDPGLDEFVNHVNRLRDPS
FT                   HVRESSLSEWQLMFTANQLGYQEIQKWNLPIQYDSWIKRGGTPADREKQIIAHLNDASD
FT                   KARDMFDIKLNQNVQPGSFCLKAILIQGIKR"
FT   gene            326405..327379
FT                   /gene="ycgK"
FT                   /locus_tag="BSUW23_01620"
FT   CDS_pept        326405..327379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgK"
FT                   /locus_tag="BSUW23_01620"
FT                   /product="putative transcriptional regulator (LysR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36381"
FT                   /db_xref="GOA:E0U1N3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N3"
FT                   /protein_id="ADM36381.1"
FT                   /translation="MDIKVMEYAAEIARRQSFTKAAEHLHIAQPSLSQQIKKLEAELGL
FT                   TLFYRSHGSVTLTPHGRRFIEKAEDIIRSRDDLLREMQELSQGLGHKLSIGIPAVTGRY
FT                   LFPPLLKQFLARYPHVEVQLVEQDPVSLEEMTAKGEVDLSVLSLPIEDERLSITPLFTE
FT                   PIVLAVPKEKQKWMPPEMIALIEKAMEGEEGRQPCVPLEMVRHVPFILLKEGFGFRRTV
FT                   LDLCAESGFKPNTAFKTSHIETAQSLVANGLGVTMAPNMVRRDKDPGVIYLSIQSAPSR
FT                   TLVFVFLKNRYVSLTAQAFMELSRESLKQTFDKGCLENKSENI"
FT   gene            327451..328407
FT                   /gene="cah"
FT                   /locus_tag="BSUW23_01625"
FT   CDS_pept        327451..328407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="BSUW23_01625"
FT                   /product="S-deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36382"
FT                   /db_xref="GOA:E0U1N4"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N4"
FT                   /protein_id="ADM36382.1"
FT                   /translation="MQLFDLPLDQLQTYKPEKTTPNDFSEFWKSSLDELAKVKAAPDLQ
FT                   LVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVN
FT                   WALHGYAAFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEV
FT                   ISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPY
FT                   LEINSFFRRNGSPETEEKAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAY
FT                   NHLETEKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG"
FT   gene            328413..329273
FT                   /gene="ycgL"
FT                   /locus_tag="BSUW23_01630"
FT   CDS_pept        328413..329273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /locus_tag="BSUW23_01630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36383"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N5"
FT                   /protein_id="ADM36383.1"
FT                   /translation="MKSRRTTSGGFFLQTAGMRTDWRRIEMKQRIIDELKRIEQSYGVK
FT                   IVYAVESGSRAWGFPSQDSDYDVRFIYVPKKEWYFSIEQERDVIEEPIHDLLDISGWEL
FT                   RKTLRLFKKSNPPLLEWLSSDIVYYEAFTTAKQLRKLRTEAFKPEASVYHYINMARRNV
FT                   KDYLQGQEVKIKKYFYVLRPILACKWIEKHGTIPPMDFTVLMNELVTDPELKAEMETLL
FT                   ERKKRGEELDLEARIQVIHQFIETEIERIMEAAKTLKAEHKDMTPELNRLLLNTVEEVW
FT                   KDGGS"
FT   gene            329455..330372
FT                   /gene="ycgM"
FT                   /locus_tag="BSUW23_01635"
FT   CDS_pept        329455..330372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /locus_tag="BSUW23_01635"
FT                   /product="proline oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36384"
FT                   /db_xref="GOA:E0U1N6"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N6"
FT                   /protein_id="ADM36384.1"
FT                   /translation="MEVITRDFFLFLSKSGFLNKMAKNWGSRVAAGKIIGGNDFNSSIP
FT                   TIRQLNSQGLSVTVDHLGEFVNSAAVARERTEECIQTIATIADQQLNSQVSLKMTSLGL
FT                   DIDMDLVYENMTKILQTAEKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEYVSTVLQAY
FT                   LYRTEKDIDDLDSLHPFLRLVKGAYKESEKVAYPEKSDVDENYKKIIRKQLLNGHYTAI
FT                   ATHDDKMIDYTKQLAKENGIANDKFEFQMLYGMRSQTQLNLVKEGYNMRVYLPYGEDWY
FT                   GYFMRRLAERPSNIAFAFKGMTKK"
FT   gene            330389..331936
FT                   /gene="ycgN"
FT                   /locus_tag="BSUW23_01640"
FT   CDS_pept        330389..331936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgN"
FT                   /locus_tag="BSUW23_01640"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36385"
FT                   /db_xref="GOA:E0U1N7"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N7"
FT                   /protein_id="ADM36385.1"
FT                   /translation="MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGER
FT                   VETEAKIVSINPADKEEVVGRVSKASQEHAEQAIEAAAKAFEEWRYTSPEERAAVLFRA
FT                   AAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGE
FT                   KNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLE
FT                   ESGLPKGVVNFVPGSGAEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLK
FT                   RVIAEMGGKDTVVVDEDADIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLKRV
FT                   IEITESKVTAKPDSADVYMGPVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIK
FT                   PTIFADLDPKARLMQEEIFGPVVAFSKVSNFDEALEVANNTEYGLTGAVITNNRKHIER
FT                   AKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
FT   gene            332067..333482
FT                   /gene="ycgO"
FT                   /locus_tag="BSUW23_01645"
FT   CDS_pept        332067..333482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgO"
FT                   /locus_tag="BSUW23_01645"
FT                   /product="putative proline/ornithine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36386"
FT                   /db_xref="GOA:E0U1N8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N8"
FT                   /protein_id="ADM36386.1"
FT                   /translation="MIGYFAYKRTSNLTDYMLGGRSLGPAVTALSAGAADMSGWLLMGL
FT                   PGAMFSTGLSGIWIVFGLCLGAWANWLYVAPRLRTYTEQAGNSITIPGFLENRFGDHSK
FT                   LLRLFSGIVILVFFTFYVSSGMVSGGVLFNSILGMEYHTGLWVVTGVVVVYTLFGGFLA
FT                   VSWTDFVQGIIMFAALILVPIVTFFHTGGASETVTEIRSVDPDMFNMFKGTSVLGIISL
FT                   FAWGLGYFGQPHIIVRFMAITSVKEIKRARRIGMGWMILSAVGAVLTGLGGIAYYHQNG
FT                   MTLKDPETIFIQLGNILFHPIITGFLISAILAAIMSTISSQLLVTSSSLVEDLYKSMFR
FT                   RSASDKELVFLGRMAVLVISVIALFLAWEKNNTILGLVSYAWAGFGASFGPVVLLSLFW
FT                   KRMTKWGALAGMIVGAATVIIWANAGLSDFLYEIIPGFAASLLSVFIVSVLTQAPSQAV
FT                   ADQFKDYQDTMSQ"
FT   gene            333635..334870
FT                   /gene="ycgP"
FT                   /locus_tag="BSUW23_01650"
FT   CDS_pept        333635..334870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgP"
FT                   /locus_tag="BSUW23_01650"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36387"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1N9"
FT                   /protein_id="ADM36387.1"
FT                   /translation="MEELLERVFSFSDVDKLIDFISYELQKPVILESADFFLLAYNSYY
FT                   INHFDSANQQTIFSKKCPVQIFERFLKDGIIEKLKTEPEPFRVNKIESIGLNQRVVVSA
FT                   KHKGEVMGYIWVQELDQNLTEEELDFLYETSFHVGKIIYKTNKLKQEKEEKAEDLIKRA
FT                   IYQQFTTEKELRREAERINTVLPSMFSVVILHAANGDGEAVEDLKENIRSYLNLRDKVS
FT                   HVLTIESNIVIVVASFSQKSSVSSAASEFINKLLTHFHFQKIPTPIYIGIGNEYDHLLK
FT                   LGKSYTEALEVIKAAEITGNQENIPYEYAKLGIYRYLESIEQKNEFLEYENKDLALLKA
FT                   KDQESSTELLKTLEIYLLNNCKTKPAAEQLFIHQNTLNYRIKQITEMTSIDLSDFRTRC
FT                   QLYLDLMLMKKK"
FT   gene            complement(334907..335764)
FT                   /gene="ycgQ"
FT                   /locus_tag="BSUW23_01655"
FT   CDS_pept        complement(334907..335764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ"
FT                   /locus_tag="BSUW23_01655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36388"
FT                   /db_xref="GOA:E0U1P0"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P0"
FT                   /protein_id="ADM36388.1"
FT                   /translation="MFRLLVLMGFTFFFYHLHASGNLTKYINMKYSYLSFIAIFLLAIL
FT                   TAVQAYVFIKSPEKGGHHHDDDCGCGHDHEHDHEQNRPFYQRYLIYLVFLFPLVSGIFF
FT                   PIATLDSSIVKTKGFSFKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSK
FT                   KEISLTDDDFLKGMETIYNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIAD
FT                   SGVYGMLVEFPKDMNIKDDEWIQIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYV
FT                   YRGF"
FT   gene            complement(335769..336671)
FT                   /gene="ycgR"
FT                   /locus_tag="BSUW23_01660"
FT   CDS_pept        complement(335769..336671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgR"
FT                   /locus_tag="BSUW23_01660"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36389"
FT                   /db_xref="GOA:E0U1P1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P1"
FT                   /protein_id="ADM36389.1"
FT                   /translation="MSGGFIVTAQSSFLQLNSIFISILIEAIPFILIGVILSGIIQMFV
FT                   SEEMIARIMPKNRFLAVLFGALAGVLFPACECGIIPITRRLLLKGVPLHAGVAFMLTAP
FT                   IINPIVLFSTFIAFGNRWSVVFYRGGLALAVSVIIGIILSYQFKDNQLLKPDEPGHHHH
FT                   HHHTLLQKLGGTLRHAIDEFFSVGKYLIIGAFIAAAMQTYVKTSTLLAIGQNDVSSSLV
FT                   MMGLAFVLSLCSEVDAFIASSFSSTFSLGSLIAFLVFGAMVDIKNLLMMLAAFKKRFVF
FT                   LLITYIVVIVLAGSLLVKG"
FT   gene            complement(336753..337607)
FT                   /gene="ycgS"
FT                   /locus_tag="BSUW23_01665"
FT   CDS_pept        complement(336753..337607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgS"
FT                   /locus_tag="BSUW23_01665"
FT                   /product="putative aromatic hydrocarbon hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36390"
FT                   /db_xref="GOA:E0U1P2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P2"
FT                   /protein_id="ADM36390.1"
FT                   /translation="MKRRVETITFEGHTLEYSVAGSGPPILVMHGGHSNCYEEFGYTAL
FT                   IEHEYSIITPSRPGYGRTSKEIGKSLADACRFYVNLLDHLQIDSVHVVAISAGGPSGIS
FT                   FASHYPERVNTLTLQSAVTKEWLTPKDTEYKMGRILFRPPVEKWIWKLISYLNNAFPRF
FT                   MFQAMSPQFSTLSFQRIKSLMDEKDVEAFRKMNSRQRSGEGFLLDLSQTAAISSKELQA
FT                   ISCPVLIMQSVYDGFIDKSHAHYAKEHIPDAVLCLLHSWGHLIWLGKEAAETDRIILGF
FT                   LES"
FT   gene            337770..338780
FT                   /gene="ycgT"
FT                   /locus_tag="BSUW23_01670"
FT   CDS_pept        337770..338780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgT"
FT                   /locus_tag="BSUW23_01670"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36391"
FT                   /db_xref="GOA:E0U1P3"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P3"
FT                   /protein_id="ADM36391.1"
FT                   /translation="MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPRLGGK
FT                   VSLFFPEKIIRDIGGIPGIAGKQLIKQLKEQAATFDPDIVLNQRVTGFERLEDGTIVLT
FT                   GSEGEKHYTRTVILAVGMGTLEVNEFDSEDATRYAGKNLHYGVEKLDAFKGKRVVISGG
FT                   GDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYCLEQLSGDEDR
FT                   IQSVTVCHTASGQREDIAVDELIINHGFKIDLGPMKGWGLEIEEGRVKADRHMRTNLPG
FT                   VFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK"
FT   gene            complement(338811..340256)
FT                   /gene="nasF"
FT                   /locus_tag="BSUW23_01675"
FT   CDS_pept        complement(338811..340256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="BSUW23_01675"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36392"
FT                   /db_xref="GOA:E0U1P4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P4"
FT                   /protein_id="ADM36392.1"
FT                   /translation="MKNGIVYFVGAGPGDPGLLTIKGKQALEEADVILYDRLANPKLLE
FT                   FASPDCQFIYCGKLPDRHFMKQREINALLVEKASMGLTVVRLKGGDPSVFGRVGEEADA
FT                   LHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLA
FT                   RSVQTLVFYMGVKNLSYICQQLIAYGKSPSVPVIVVQWGTWGRQRSVKGSLENIQQKVQ
FT                   EHQITNPAIIVIGDIVNFQTHSWFESKPLIGQHIMVVTHGEDEDPLADKLRASGADVIE
FT                   WPKWRTENMPVNEEILRKIGTFEDIFFTSHHAVCEFFQALTSKKIDIRQLTARLSATSE
FT                   HAETELKKRGFLISAIQPDSEKRLVVGSRHAVENIQKHESCSFYITHENVIDDRFTHMI
FT                   QRTISESPLHMIICPSKPSTQQLISAGEQIGISPEPSASRPPIVCISDNSAAGAYGFTA
FT                   VQEQDELFALIQNQQAEKKLLHS"
FT   gene            complement(340322..340642)
FT                   /gene="nasE"
FT                   /locus_tag="BSUW23_01680"
FT   CDS_pept        complement(340322..340642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="BSUW23_01680"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36393"
FT                   /db_xref="GOA:E0U1P5"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P5"
FT                   /protein_id="ADM36393.1"
FT                   /translation="MVNKGVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSNGSIRAI
FT                   ENRCPHKGGVLAEGIVSGEYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYL
FT                   VY"
FT   gene            complement(340675..343092)
FT                   /gene="nasD"
FT                   /locus_tag="BSUW23_01685"
FT   CDS_pept        complement(340675..343092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="BSUW23_01685"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36394"
FT                   /db_xref="GOA:E0U1P6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P6"
FT                   /protein_id="ADM36394.1"
FT                   /translation="MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNR
FT                   ILLSKVLQGDTDIKDITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDE
FT                   LILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVSVIHLAPYLMERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDGRVEGV
FT                   RFKDGTSIEADLVVMAVGIRPNTALGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKHICGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESDEKK
FT                   AIKVFDEQDGIYKKIVLRGNQIVGAVLFGDSSEGNRLFSMIQKEADITETSKISILQPL
FT                   NQEAGTSMTAAMSDDEIICGCNGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKP
FT                   LVEEILQHTLGSDFDASAQKEAICGCTTLSRDEVVEEIKAKGLSHTREIMNVLGWKTPE
FT                   GCSKCRPALNYYLGMINPTKYEDDRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTD
FT                   LRKIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTC
FT                   VGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDG
FT                   GWELYVGGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVGL
FT                   SHVQSVLNNPEKRQELNDQMNETLSVHKDPWKNFLENKQTSKELFENVVSTS"
FT   gene            complement(343213..345345)
FT                   /gene="nasC"
FT                   /locus_tag="BSUW23_01690"
FT   CDS_pept        complement(343213..345345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasC"
FT                   /locus_tag="BSUW23_01690"
FT                   /product="assimilatory nitrate reductase (catalytic
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36395"
FT                   /db_xref="GOA:E0U1P7"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E0U1P7"
FT                   /protein_id="ADM36395.1"
FT                   /translation="MTERLLRYFRDKQQDIQSEKTYDTQCPFCSMQCKMQLVEQTIVTR
FT                   KKYTAIGIDNPTTQGRLCIKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNHIKD
FT                   QVTMIQHEHGHDAMAVYGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAAN
FT                   QTFGADRGLTNPLSDIPYTRVIILAGTNIAECQPTIMPYFEKAKDNGAYIIAIDPRETA
FT                   TTKIADLHLKIKPGTDAALANALVKIMIDEQLVNEDFIRSRTNGFAELKQHTDALSLND
FT                   IAEQTSVPLAHMRKAAVKFAKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGKP
FT                   YSGYGAITGQGNGQGAREHGQKADQLPGYRSIENEEHRSHIAKVWGIHQDDLPRKGVSA
FT                   YEMMEKINDGDIKGLFLMCSNPAVSSPNANLVKKALRKLTFFVAIDLFISETAKYADVI
FT                   LPASSYLEDEGTMTNVEGRVTLREASRPCPGEAKHDWQIICEIASVLGKGRYFSYTSAK
FT                   DIFNELREASRGGIADYSGITYDRLRREGGIHWPCPEPDHPGTGRLFADSFAHPDQKAA
FT                   LSVIPIEPAVPKEKPTADYPLYLTTGRVMSHYLTGVQTRKSAALAARHFESFMEIHPQT
FT                   AATYNIEDRVLVKIESPRGSITVRSKLSDQIRKDTVFVPIHWADAQNVNDLIGEALDPA
FT                   CKMPGFKVCAVRIRPI"
FT   gene            complement(345342..347666)
FT                   /gene="nasB"
FT                   /locus_tag="BSUW23_01695"
FT   CDS_pept        complement(345342..347666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasB"
FT                   /locus_tag="BSUW23_01695"
FT                   /product="assimilatory nitrate reductase (electron transfer
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36396"
FT                   /db_xref="GOA:E0U298"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E0U298"
FT                   /protein_id="ADM36396.1"
FT                   /translation="MKKQRLVLAGNGMAGIRCIEEVLKLNRQMFEIVIFGSEPHPNYNR
FT                   ILLSSVLQGEASLDDITLNSKDWYDKHRITLYTGETVVQIDTDQQRVITDRKRTLSYDK
FT                   LIVATGSSPHILPIPGADKEGVYGFRTIEDCQALMSMAKHYQKAAVIGAGLLGLEAAVG
FT                   LQHLGMDVSVIHHSAGIMQKQLDQTASRLLQTELERKGLTFLLEKDTVAISGTSRADGI
FT                   RFKDGSSLKADLIVMAAGVRPNIQLVVSAGIAVNRGIIVNDDMQTSEPNVYAVGECAEH
FT                   NGTVYGLAAPLYEQGKALAKHICGVPCEGYQGSAPSAALKIAGIDVWSAGKVHEDERTT
FT                   SIKIYDEQTGIYKKALFEDDKLAGVILFGDTRDKQRFLDSLLKQRDISIVKKQIIEPEK
FT                   TGTLFDSMSSSETICQCNSVTKGAIEEAVHTKGLTTVEEVKHCTKASGSCGGCKPLVED
FT                   LLRYMTSSEYTEPAGTPSFCGCTDFTEDDIIAELQRRPFANPAEAMNQLGWKTKNGCGK
FT                   CVPAIQYYLEMLHPGFVQPESAAEDTYILIPQMYGGRTNAEQLRNIANIIEAYSIPDVS
FT                   ITHGQRLKLSGIKPADLPNIKKDLIMPVRSNEHHRTLQSVKACTCGQNRSIQQLAAQIE
FT                   RHLEMLSMPAYISISLSCETDCTDAAIQDFGAIQTQAGWDIYIGGIRGTHARSGALFCV
FT                   TDNADSTAGMIKGLIQYYRETAHYLETVHQWMDRLGIVHIREVLFEEDLRTQLLESLQT
FT                   DLSLIPKPPVQAGTHKRGEAF"
FT   gene            347847..349052
FT                   /gene="nasA"
FT                   /locus_tag="BSUW23_01700"
FT   CDS_pept        347847..349052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /locus_tag="BSUW23_01700"
FT                   /product="nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36397"
FT                   /db_xref="GOA:E0U299"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U299"
FT                   /protein_id="ADM36397.1"
FT                   /translation="MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGL
FT                   SPFEKGLVVAVPILSGSVFRIILGILTDRIGPKKTAMIGMLVTMIPLLWGTFGGRSLSE
FT                   LYAIGVLLGVAGASFAVALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQF
FT                   GWHIVMGIALVPLLIVYILFVSMAKDSPAQPAPQPLKNYLHVFGQKETWFFCLLYSVTF
FT                   GGFVGLSSFLSIFFVDQYQLSKIHAGDFVTLCVAAGSFFRPVGGWISDRVGGTKVLSVL
FT                   FVIVALCMAGVSSLPSLSMVIVLLFVGMMGLGMGNGAVFQLVPQRFRKEIGMVTGIVGA
FT                   AGGIGGFFLPNILGSLKQMTGTYAIGFITFSCIALLAFALVLAAGYYWRKSWGAESSPA
FT                   DA"
FT   gene            349168..350082
FT                   /gene="folEB"
FT                   /locus_tag="BSUW23_01705"
FT   CDS_pept        349168..350082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folEB"
FT                   /locus_tag="BSUW23_01705"
FT                   /product="putative GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36398"
FT                   /db_xref="GOA:E0U2A0"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A0"
FT                   /protein_id="ADM36398.1"
FT                   /translation="MNQYTLLPGKPERLQYFGSVSSMKGEKPVEKEKMKDLQNIRKDYF
FT                   FDIQHVGVANVSHPVTITSAMTPAEQTTTADFTMTCDLRRNQKGINMSRLTELLQIYHQ
FT                   DGWVLSFSSLQQFTKELAENMDQSSASVEVRFPWFFERKSPKLEKAGLMHADILMSVTY
FT                   REDQPFEQRAGISAKVTTLCPCSKEISEYSAHNQRGTVSIWADIHPAASMPSDFKADLL
FT                   HAAESNASARLHPVLKRPDEKAVTETAYENPRFVEDLARLIAADLYELKWVSSFEIECR
FT                   NEESIHLHDAYAKLRFSKQEDRI"
FT   gene            350111..350311
FT                   /gene="yciB"
FT                   /locus_tag="BSUW23_01710"
FT   CDS_pept        350111..350311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciB"
FT                   /locus_tag="BSUW23_01710"
FT                   /product="putative metal uptake system lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36399"
FT                   /db_xref="GOA:E0U2A1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A1"
FT                   /protein_id="ADM36399.1"
FT                   /translation="MPASLLLACSDHAEEHASADTKDKKVIGKEAKKLGVKASHGCIRL
FT                   AIPDAKWIYENIPQHTKVVIG"
FT   gene            350395..351567
FT                   /locus_tag="BSUW23_01715"
FT   CDS_pept        350395..351567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01715"
FT                   /product="putative flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36400"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A2"
FT                   /protein_id="ADM36400.1"
FT                   /translation="MYKWLIIGGGIQGSTLAVHLVKSRRASIEDIAVIDPHERPLECWK
FT                   RNTSRIQMKYLRSPSVHHVDTEPFSLQTHADKSQWPEVFFGRYKRPSLSFFNQHCETVL
FT                   DEIHMDQAWKTGMVTNLRRANGLWEAETDTAGTLRGERVVLAMSFSHQPSWPEWAKPFQ
FT                   NSGIYHVFDREVHDVSNESLQMAVVGGGITAAHYAIKLADDGHDVTMLVRHPFRIYDFD
FT                   SDPGWLGPKYMKAFSKTSDYQKRRQWITSARHRGSFPKDISRTLAVYKEEGRVKVIQDE
FT                   IDFCQKTDDGKIQIHCKTSESRYEYERVALATGFTSDISRFDWVQRAAQAEQLPYAGCG
FT                   FPIIGKDLQWGKGLYVMGAFAELEIGPTARNISGARKAAYTIAYTAKHTS"
FT   gene            351604..352797
FT                   /gene="yciC"
FT                   /locus_tag="BSUW23_01720"
FT   CDS_pept        351604..352797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC"
FT                   /locus_tag="BSUW23_01720"
FT                   /product="putative metallochaperone with NTPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36401"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A3"
FT                   /protein_id="ADM36401.1"
FT                   /translation="MKKIPVTVLSGYLGAGKTTLLNSILQNREGLKIAVIVNDMSEVNI
FT                   DAGLVKQEGGLSRTDEKLVEMSNGCICCTLREDLLIEVEKLAKDGRFDYIVIESTGISE
FT                   PIPVAQTFSYIDEEMGIDLTKFCQLDTMVTVVDANRFWHDYQSGDSLLDRKEALGEEDE
FT                   RDIADLLIDQIEFCDVLILNKCDLVSEQELEQLEKVLRTLQPRAKFIRSVKGNVKPQEI
FT                   LHTGLFNFEEASGSAGWIQELTAGHAEHTPETEEYGISSFVYKRRLPFHSTRFYHWMDQ
FT                   MPKNVVRAKGIVWCASHNNLALLMSQAGPSVTIEPVSYWVAALPKLEQEQVKQQEPEIL
FT                   EEWDPEFGDRLTQLVFIGTDLDEDEITKELDQCLLTEYEFDSDWSLFEDPFKWKLNQ"
FT   gene            complement(352846..353526)
FT                   /gene="yckA"
FT                   /locus_tag="BSUW23_01725"
FT   CDS_pept        complement(352846..353526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="BSUW23_01725"
FT                   /product="putative ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36402"
FT                   /db_xref="GOA:E0U2A4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A4"
FT                   /protein_id="ADM36402.1"
FT                   /translation="MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIG
FT                   LFISLARMSQLALLRWPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFS
FT                   LNSAAYIAEINRSAISSVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLD
FT                   LIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAICSAAAAFQNILEKKY
FT                   AHYV"
FT   gene            complement(353536..354387)
FT                   /gene="yckB"
FT                   /locus_tag="BSUW23_01730"
FT   CDS_pept        complement(353536..354387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BSUW23_01730"
FT                   /product="putative ABC transporter (binding lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36403"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A5"
FT                   /protein_id="ADM36403.1"
FT                   /translation="MPSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVV
FT                   ATSGTLYPTSYHDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQV
FT                   DAAANDIDVTKDREKKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVY
FT                   MDVARKYGAQEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDI
FT                   KYMPNKQALVMKKSNAALQKKMNETLKEMSKDGTLTKLSKQFFNKADVSKKLDVDVQDV
FT                   GL"
FT   gene            354647..354817
FT                   /locus_tag="BSUW23_01735"
FT   CDS_pept        354647..354817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01735"
FT                   /product="putative glutathione-dependent formaldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36404"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A6"
FT                   /protein_id="ADM36404.1"
FT                   /translation="MGRALVILMLYEMVKKHEIDLSHKLSLADGPKAYDIFDKKEDGNI
FT                   KVILKTYGGVK"
FT   gene            354814..355269
FT                   /gene="yckC"
FT                   /locus_tag="BSUW23_01740"
FT   CDS_pept        354814..355269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckC"
FT                   /locus_tag="BSUW23_01740"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36405"
FT                   /db_xref="GOA:E0U2A7"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A7"
FT                   /protein_id="ADM36405.1"
FT                   /translation="MNIYKPAGFWIRLGASLLDYIIVSVPLLLIYWLITGKDPNDSMFI
FT                   SLIVLLYSILLPVFWNGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYGITFGL
FT                   GLIASLILIGVREDKRTLHDLIAGTYVTYASPGEEELYTDEQIRKSE"
FT   gene            355352..355684
FT                   /gene="yckD"
FT                   /locus_tag="BSUW23_01745"
FT   CDS_pept        355352..355684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckD"
FT                   /locus_tag="BSUW23_01745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36406"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A8"
FT                   /protein_id="ADM36406.1"
FT                   /translation="MERIKINIITMFITAAVISLTGTAEAAEKQQQPPANVTLTDQQKK
FT                   EIEQLEADILKKRKDVISKYVQYGVLPKERGEHIKNHMDKHFEMMKQNGFVPKPHPHQH
FT                   KFEKRH"
FT   gene            355819..356241
FT                   /locus_tag="BSUW23_01750"
FT   CDS_pept        355819..356241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01750"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36407"
FT                   /db_xref="GOA:E0U2A9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2A9"
FT                   /protein_id="ADM36407.1"
FT                   /translation="MEMDFIAKLNQQWTDIYYVLHYKHKDNISHQAIRLMQHIEKQGEA
FT                   TIGALAEYLSVSHNTASEHTKRLIQKGLVAKRRSQQDERKVIVFLTQEGRSVLEQHTQL
FT                   DKEKLTEIIKRLSTSEKELLEQAFELLSKEAKQWQF"
FT   gene            356229..356570
FT                   /locus_tag="BSUW23_01755"
FT   CDS_pept        356229..356570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36408"
FT                   /db_xref="GOA:E0U2B0"
FT                   /db_xref="InterPro:IPR021493"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B0"
FT                   /protein_id="ADM36408.1"
FT                   /translation="MAVLSKVIISALIIGFVTEISKRHPTYGGIIAALPLVSLLSLFWM
FT                   QIQGEKTAQLSQFTSGVLTGIPATVCLLAILAFLLKVHVPFWLALCVGILGWAVFLWMQ
FT                   KIFFNILCN"
FT   gene            356590..357318
FT                   /locus_tag="BSUW23_01760"
FT   CDS_pept        356590..357318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36409"
FT                   /db_xref="GOA:E0U2B1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B1"
FT                   /protein_id="ADM36409.1"
FT                   /translation="MFLKKVTLLRDKIADFDRFPFTIPAINQLNEILFTSQVTFFVGEN
FT                   GSGKSTLLEAIANKCEFNTAGGSRNNVYDLQESDSHLGDYIRLSWLPKVTNGFFLRAES
FT                   FYHLSLHLDEMELEAPQPYRSYGGRPLHKQSHGESFMSLFRHRFKEKAIYLLDEPEAAL
FT                   SPARQLAFMRVIHDLVKGGNVQMIIATHSPILLGYPDANILSFDGGRIHPTEYENTEHV
FT                   QLTRYFLGQREKILNELFRD"
FT   gene            357391..358824
FT                   /gene="bglC"
FT                   /locus_tag="BSUW23_01765"
FT   CDS_pept        357391..358824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglC"
FT                   /locus_tag="BSUW23_01765"
FT                   /product="aryl-phospho-beta-d-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36410"
FT                   /db_xref="GOA:E0U2B2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B2"
FT                   /protein_id="ADM36410.1"
FT                   /translation="MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIP
FT                   GKTFKATNGDIAVDHYHRYKEDVALMAEMGLKAYRFSVSWPRIFPNGKGEINEAGLAFY
FT                   DNLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNNYCITLYKRFGDRVK
FT                   YWVSLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPDGKIG
FT                   PSFAYSPAYPLSSHPEDILAFENAEEFMNNWWLDMYCWGTYPQIPFRYLEKQGWAPTIE
FT                   AGDMELLAKGKPDFVGVNYYQTITYERNPLNGVSEGKMNTTGQKGTNQETGIPGVFKTK
FT                   KNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRID
FT                   YLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEENTHDLKRL
FT                   KKKSFYWYQDVIKTNGESL"
FT   gene            complement(358861..359259)
FT                   /gene="nin"
FT                   /locus_tag="BSUW23_01770"
FT   CDS_pept        complement(358861..359259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nin"
FT                   /locus_tag="BSUW23_01770"
FT                   /product="inhibitor of the DNA degrading activity of NucA
FT                   (competence)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36411"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B3"
FT                   /protein_id="ADM36411.1"
FT                   /translation="MIKSWKPQELSISYHQFTVFQKDSAPPVMDWTDEAIEKGFAAADG
FT                   AISFEAQRNTKAFILLRLNSSETVNSYEKKVTVPFQVTENGIEIESIMSKRLSFDLPKG
FT                   DYQLTCWTVPAEMSDLHADTYIIDAVSV"
FT   gene            complement(359282..359719)
FT                   /gene="nucA"
FT                   /locus_tag="BSUW23_01775"
FT   CDS_pept        complement(359282..359719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BSUW23_01775"
FT                   /product="endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36412"
FT                   /db_xref="GOA:E0U2B4"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B4"
FT                   /protein_id="ADM36412.1"
FT                   /translation="MDIIKTILLVIVVIAAAAVGLIKGDFFSADQKTSQTEEYDETIAL
FT                   PSDRYPETAKHIKDAINEGHSDVCTIDRDGAEERREQSLKDVPPKTGYDRDEWPMAMCK
FT                   EGGEGASVEYISPADNRGAGSWVGHQLTDYPDGTKVLFTIQ"
FT   gene            complement(359905..361629)
FT                   /gene="tlpC"
FT                   /locus_tag="BSUW23_01780"
FT   CDS_pept        complement(359905..361629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /locus_tag="BSUW23_01780"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36413"
FT                   /db_xref="GOA:E0U2B5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B5"
FT                   /protein_id="ADM36413.1"
FT                   /translation="MVIKQLKLKLGTKILCLVFVIVLLFSVSIGTVMLKEITDSMKQMA
FT                   TEKAKGDLALSSAYIDDVISGDWQIKNNKLYKGQTQINENEDIVDLLGEKTGDTVTIFQ
FT                   GDTRVATNVMKNGERAVGTQASPEVADAVLKKGKLFNGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIIASVILVLLFTRRINKRLNALKCAF
FT                   ESAGNGDMTIEVSDKSGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQHQITRIENSESSLKQASADIRDISSNTAAIADKGQLA
FT                   QSKAAIGQKEISNVQAQMDAIHDSIQNSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEHGKGFAVVADEVRKLAEESQQSAGQISKLITEIQKDMSQSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVSNISTTAHNINESFAANTA
FT                   DIKDSTENTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMIDQPENGR"
FT   gene            complement(361742..362299)
FT                   /gene="hxlB"
FT                   /locus_tag="BSUW23_01785"
FT   CDS_pept        complement(361742..362299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlB"
FT                   /locus_tag="BSUW23_01785"
FT                   /product="6-phospho-3-hexuloisomerase (PHI)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36414"
FT                   /db_xref="GOA:E0U2B6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B6"
FT                   /protein_id="ADM36414.1"
FT                   /translation="MKTTEYVTEILNELHRSAAYISDEEADQLADHILSSNQIFTAGAG
FT                   RSGLMAKSFAMRLMHMGFNAHIVGEILTPPLRKGDLVIIGSGSGETKSLIHTAAKANSL
FT                   DGVVAALTINPESSIGKQADLIVNMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVI
FT                   LKLMEKQGLDSDTMFTHHANLE"
FT   gene            complement(362304..362936)
FT                   /gene="hxlA"
FT                   /locus_tag="BSUW23_01790"
FT   CDS_pept        complement(362304..362936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlA"
FT                   /locus_tag="BSUW23_01790"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36415"
FT                   /db_xref="GOA:E0U2B7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B7"
FT                   /protein_id="ADM36415.1"
FT                   /translation="MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVK
FT                   EIKETFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKK
FT                   KILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTA
FT                   IAGGIKLDTLPEVIKQNPDLVIVGGGITSAADKAETASKMKQLIAQG"
FT   gene            363167..363529
FT                   /gene="hxlR"
FT                   /locus_tag="BSUW23_01795"
FT   CDS_pept        363167..363529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlR"
FT                   /locus_tag="BSUW23_01795"
FT                   /product="positive regulator of hxlAB expression"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36416"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B8"
FT                   /protein_id="ADM36416.1"
FT                   /translation="MSRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKT
FT                   LIPDITHKILVNQLRELEQDMIVHREVYPVVPPKVEYSLTSQGESLMPILDAMYEWGKG
FT                   YMELIDIDKNVIKESL"
FT   gene            364107..374870
FT                   /gene="srfAA"
FT                   /locus_tag="BSUW23_01800"
FT   CDS_pept        364107..374870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAA"
FT                   /locus_tag="BSUW23_01800"
FT                   /product="surfactin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36417"
FT                   /db_xref="GOA:E0U2B9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2B9"
FT                   /protein_id="ADM36417.1"
FT                   /translation="MEITFYPLTDAQKRIWYTEKFYPHTSISNLAGIGKLVSTDKVDWV
FT                   LVEQAIQEFIRRNDAMRLRLRLDENGEPVQYISEYRPVDIKHTDTTGDPNAIETISQWS
FT                   REETKKPLRLYDCDLFRFSMFTIKENEVWFYANVHHVISDGISMNILGNAVMHIYLELA
FT                   GASETKEGISHSFIDHVLSEQDYAQSKRFEKDKVFWNKQFESVPELVSLKRNASAGGSL
FT                   DAERFSKDVPEALHQQILSFCEANKVSVLSVFQSVLAAYLYRVSGQNDVVTGTFMGNRT
FT                   NAKEKQMFGMFVSTVPLRTNVDGGQSFLGFVKDRMKDLMKTLRHQKYPYNLLINDLRET
FT                   KSSLTKLFTISLEYQVMQWEKEEDLSFLTEPIFSGSGLNDVSIHVKDRWDTGKLTIDFD
FT                   YRTDLFSREEIKIVCERMMTMLENALSHPDDAIDELTLISEAEKEKLLARAGGESVSYR
FT                   KDMTIPELFQEQAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVL
FT                   IERSERMITSIMGILKAGGAYVPIDPAFPAERIQYILEDCGADFILTESKVAAPAADAE
FT                   LIDFDQAISEGADESLNADVNARNLAYIIYTSGTTGRPKGVMIEHRQVHHLVESLQQAI
FT                   YQSGSQTLRMALLAPFHFDASVKQIFASLLLGQTLYIVSKKTVTNGSALAAYYRRHSIE
FT                   ATDGTPAHLQMLIAAGDFEGLKLKHMLIGGEGLSSVVADKLLKLFKEAGTAPRLTNVYG
FT                   PTETCVDASVHQVIPESAVQSAYVPIGKALGNNRLYILDQRGRLQPEGVAGELYIAGDG
FT                   VGRGYLHLPELTAEKFLQDPFVPSDRMYRTGDVVRWLPDGTIEYLGREDDQVKVRGYRI
FT                   ELGEIEAVIQQAPDVAKAVVLARPDEQGNLEVCAYVVQTTGSEFAPASLREHAARQLPD
FT                   YMVPAYLTEVTEIPLTPSGKVDRRKLFALQVKAVSGTAYTAPRNDMEKAIAAIWQDVLN
FT                   VEKAGIFDNFFETGGHSLKAMTLLTKVHKETGADIPLQYLFEHPTIAALAEEAKHREIQ
FT                   EFAAIEPAEKQEHYPLSLAQQRTYIVSQFEDAGVGYNMPAAAILEGPLEIQKLERAFQG
FT                   LIRRHESLRTSFILENSTPRQKIHDSVDFNIEMIERGGRSDEAIMTSFVRRFDLAKAPL
FT                   FRIGLMELEENRHMLLFDMHHLISDGVSIGIILEELARIYKGEQLPELRLQYKDYAVWQ
FT                   SGQAAEGYQKDRAYWKEVFAGELPVLQLLSDYPRPPVQSFEGDRVSIKLDAGLKDRLNR
FT                   LAEQNGATLYMVMLSAYYTLLSKYTGQDDIIVGTPSAGRNHSDIEGIVGMFVNTLAIRS
FT                   EVKQDETFTHLITRVRKQVLDAFSHQDYPFEWLVEDLNIPRDVSRHPLFDTMFSLQNAT
FT                   EGIPAVGDLILSVHETNFKIAKFDLTMQARETDEGIELDLDYSTNLFKQSTADRLLNHF
FT                   ARLLEDAAAEPEKQISEYKLLSEEEVASQIQQFNPGRTPYPKEKTIVQLFEEQAAKTPD
FT                   HPALQYEGKSLTYRELNERANRLARGILSLGAGEGRTAAVLCERSMDMIVSILAVLKAG
FT                   SAYVPIDPEHPIQRMQHFFCDSGAKVLLTQKKLKALAEEAEFDGVIVLADEEESYHADA
FT                   QNFTLPLDSSAMANLTYTSGTTGTPKGNIVTHANILRTVKETNYLSITEQDTILGLSNY
FT                   VFDAFMFDMFGSLLNGAKLVLIPKETVLDMARLSRVIERENISILMITTALFHLLVDLN
FT                   PACLSTLRKIMFGGERASVEHVRKALQTVGKGKLLHMYGPSESTVFATYHPVDELEEDT
FT                   LSVPIGKPVSNTEVYILDRAGHVQPAGIAGELCVSGEGLVKGYYNRPELTEEKFIPHPF
FT                   TSGERMYKTGDLARWLPNGDIEFIGRIDHQVKIRGQRIELGEIEHQLQTHDRVQESVVL
FT                   AVDQGAGDKLLCAYFVGEGEISSQELREHAAKDLPAYMIPAVFIQMDELPLTGNGKIDR
FT                   RALPLPDASVSRGVSYVAPRNETEQQLADVWAQVLQVQQVGVYDHFFDIGGHSLAGMKM
FT                   LALVHQELGVELSLKDLFQSPTVEGLAQVIASAEKGTAISISPAKKQDTYPVSSPQKRM
FT                   YVLQQLEGAQTSYNMPAVLRLTGELDVERLNSVMQQLMQRHEAFRTTFEIKDGETVQRI
FT                   WEEAECEMAYFEAAEEETERIVSEFIKPFKIDRLPLFRMGLIKHSDTEHVLLFDMHHII
FT                   SDGASVGVLIEELSKLYDGETLEPLRIQYKDYAVWQQQFIQSELYKKQEEHWLKELDGE
FT                   LPVLTLPTDYSRPAVQTFEGDRIAFSLEAGKAEALRRLAKETDSTLYMVLLASYSAFLS
FT                   KLSGQDDIIVGSPIAGRSQADVSRVIGMFVNTLALRTYPKGEKTFADYLSEVKETALNA
FT                   FGAQDYPLEDLIGNVQVQRDTSRNPLFDAVFSMQNANIKDLTMKGIQLEPHPFDRKTAK
FT                   FDITLTADETDGGLTFVLEYNTALFKPETIERWKQYWMQLLDAVTGNPNQPLASLSIVT
FT                   ETEKQTLLDAWKGKNLSVPTDKTVHQLFEETAQRHKDRPAVTFNGQSWTYGELNAKANR
FT                   LARILIDCGISADERVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIDYILQDS
FT                   GAKLLLKQEGISVPDSFSGDVIFLDGDRTILSLPLDENDEENPETDTNAENLAYMIYTS
FT                   GTTGQPKGVMVEHHALVNLCFWHHDAFSMTEEDRSAKYAGFGFDASIWEMFPTWTIGAE
FT                   LHVIDEEIRLDIVRLNDYFETHGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAV
FT                   KQPYTLVNNYGPTENTVVATSTEINPEEGSLSIGQAIANTRVYILGEGNQVQPEGVAGE
FT                   LCVAGRGLARGYLNKEDETAKRFVADPFVPGERMYRTGDLVKWVNGAIEYIGRIDQQVK
FT                   VRGYRIELSEIEVQLAQLSEVHDAAVTAVKDKGGNTAIAAYVTPETADIEALKSSLKET
FT                   LPDYMIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGKYKAPSTDMEELLAGIWQDV
FT                   LGISEVGVSDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEG
FT                   KQADQGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAAKGFDPERVEKTLQALIEH
FT                   HDALRMVYREGTKEVVQYNRGLEDASAQLEIIQIEGQAKDDEDRIEREAERLQSSIDLQ
FT                   EGGLLKAGLFQAEDGDHLLLAIHHLVVDGVSWRILLEDFAAVYTQLEQSNEPVLPQKTH
FT                   SFAEYAERLQDFANSKAFLKEKEYWRQLEEQTVAANLPKDRESGDQRMKHTRTIEFSLT
FT                   AEETEQLTTKVHEAYHTEMNDILLTAFGLAMKEWTGQDRVSVHLEGHGREEIIEDLTIS
FT                   RTVGWFTSMYPMVLDMKHTDDLGYQLKQMKEDIRHVPNKGVGYGILRYLTAPEHKEDVA
FT                   FSIQPDVSFNYLGQFDDMSDAGLFKRSELPSGQSLSPETEKPNALDVVGYIENGKLTMS
FT                   MAYHSLEFHEKTIKTFSDSFKAHLLRIIEHCLSQDGTELTPSDLGDDDLTLDELDKLME
FT                   IF"
FT   gene            374883..385634
FT                   /gene="srfAB"
FT                   /locus_tag="BSUW23_01805"
FT   CDS_pept        374883..385634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAB"
FT                   /locus_tag="BSUW23_01805"
FT                   /product="surfactin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36418"
FT                   /db_xref="GOA:E0U2C0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C0"
FT                   /protein_id="ADM36418.1"
FT                   /translation="MSKKSIQKVYALTPMQEGMLYHAMLDPHSSSYFTQLELGIHGAFD
FT                   LEIFEKSVNELIRSYDILRTVFVHQQLQKPRQVVLAERKTKVHYEDISHADQDRQKEHI
FT                   EGYKQDVQRQGFNLAKDMLFKVAVFRLDADQLYLVWSNHHIMMDGWSMGVLMKSLFQNY
FT                   EAIRAGKTPANGQGKPYSDYIKWLGKQDNEEAESYWSERLAGFEQPSVLPGRLPEKKDE
FT                   YVNKEYSFTWDEKLVARIQQTANRHQVTGPNLFQAVWGIVLSKYNFADDVVFGTVVSGR
FT                   PSEINGIETMAGLFINTIPVRVKVDRDAAFADVFSAVQQHAVEAERYDYVPLYEIQKRS
FT                   ALDGNLLNHLVAFENYPLDQELENGSMEDRLGFSIKVESAFEQTSFDFNLIVYPGKTWT
FT                   VKIKYNGAAFDSVFIERAAKHLTRMMEAAVDQPDAFVREYGLVGDEEQRQIVEVFNQTE
FT                   AELPEGIAVHQVFEEQAQRTPASTAVVYEGAELTYRQLNTAANRLARKLVELGLQKGET
FT                   AAIMNDRSAETVVGMLAVLKAGAAYVPLDPVLPEDRLRFMAEDSSIQMVLAGKSYTEQA
FT                   HQLQVPVITLDSGFEESGAADNLNLPSAPSDLAYIMYTSGSTGKPKGVMIEHKSILRLV
FT                   KNAGYVPIHEEDRMAQTGAVSFDAGTFEVFGALLNGAALYPAKKETLLDAKQFAAFLRE
FT                   QRITTMWLTSPLFNQLAAKDAGMFGTLRHVIIGGDALVPHIVSKVKQASPSLSLWNGYG
FT                   PTENTTFSTSFLIDREYSGSIPIGKPIGNSTAYIMDEQQRLQPIGAPGELCVGGIGVAR
FT                   GYVNLPELTEKQFLEDPFRPGERIYRTGDLARWLPDGNIEFLGRIDNQVKVRGFRIELG
FT                   EIETKLNMAEHVTEAAVIIRKNKAGENEICAYFTADRKVSVSGLRKTLSQSLPDYMVPA
FT                   HLIQMDSLPLTPNGKINKKELPAPQSEAVQPEYTAPETESEKKLAEIWEGVLGVKAGVT
FT                   DNFFMIGGHSLKAMMMTAKIQEHFHKEVPIKVLFEKPTIQELALYLDENESKEEQTFEP
FT                   IRQAPYQQHYPVSPAQRRMYILNQLGQANTSYNVPAVLLLEGEVDKDRLENAIQQLINR
FT                   HEILRTSFDLIDGEVVQTVHKNISFQLEVAKGREEYAEEMIKAFIQPFELNRAPLVRSK
FT                   LVQLEEERHLLLIDMHHIITDGSSTGILIGDLAKMYQGADLEQPQIHYKDYAVWHKEHA
FT                   DQQKDEAYWLDTFKGELPILDLPTDFERPAERSFAGERVMFGLDKQMTAQIKSLLAETD
FT                   TTMYMFLLAAFNVLLSKYASQDDIIVGSPTAGRTHPDLQDVPGMFVNTVALRTAPAGDK
FT                   TFAQFLEEVKTASLQAFEHQGYPLEELIEKLPLTRDTSRSPLFSVMFNMQNMEIPSLRL
FT                   GDLKISSYSMLHHVAKFDLSLEAVEREEDIGLSFDYAAALFKDETIRRWSSHFVNIIKE
FT                   AATNPNVRLSDVDLLSPAETAALLEESHMTQITEATFAALFEKQAQQTPDHSAVRSGGN
FT                   LLTYRELDEQANQLAHHLRAQGAGSEDIVAIVMDRSAEIMVSILGVMKAGAAFLPIDPD
FT                   TPEERIRYSLEDSGARIAVVNERNMTAIGQYEGTIVNLDDAKWRNESKERPSPISGSRN
FT                   LAYVIYTSGTTGKPKGVQIEHRNLTNYVSWFSEEAGLTETDKTVLLSSYAFDLGYTSMF
FT                   PVLLAGGELHIVPKETYTAPDEMGLYIKEHGITYIKLTPSLFHTMVNTSRFTKEPNFES
FT                   LRLIVLGGEKIIPADVLTFRKVYGHTEFINHYGPTEATIGAIAGRVNLSEPDAFAKRPT
FT                   IGQPIANAGALVLNESLKLVPPGASGQLYIKGQGLARGYLNRPQLTAERFVQNPYSPGS
FT                   LMYKTGDVVRRLSDGTLEFIGRADDQVKIRGYRIEPKEIETVMLSLSGIQEAVVLAVSE
FT                   GGLQELCAYYTADQAIEKAELRNQLSQTLPSHMIPAFFVQVDAIPLTANGKTDRSALPK
FT                   PHAEQSGRRALAAPETVLEKSLCRIWQKTLGIEAISIDDNFFDLGGHSLKGMMLIANIQ
FT                   AESEKIVPLKALFEHPTVRQLAAYMEASAVSGGHHVLKPADKQDMYPLSSAQKRMYVLN
FT                   QLDRQTISYNMPSVLLMEGELDISRLRDSLNQLVNRHESLRTSFMEANGEPVQRIIEEA
FT                   AIDLHLFEAKEDEAEQKIKDFIRPFDLNDAPLIRAALLRIEAKKHLLLLDMHHIIADGV
FT                   SRGIFVKELALLYKGEQLPEPALHYKDFAVWQNEAEQKERMKEHEAYWLSVLSGELPEL
FT                   DLPLDYARPPVQSFKGDTVRFRTGSETAKAVEQLLAETGTTLHMMLHAVFHVFLSKISG
FT                   QRDIVIGSVTAGRMNADVQDMPGMFVNTLALRMEAEEQQTFAELLEQAKQTNLSALEHQ
FT                   EYPFEELVNQLDLPRDMSRNPLFNVMVTTENPDKEQLTLQNLSISPYESHQGTSKFDLT
FT                   LGGFTDENGIGLQLEYATDLFSKETAEKWSEYVLHLLKAIAENPNQPLSSLSLVTETEK
FT                   QTLLDAWKGKTLPVPTDKTVHQLFEETVQRHIDRPAVTYNGQSWTYGELNAKANRLARI
FT                   LIDCGISADERIGILTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDSGATL
FT                   LLKQEGISVPDSYTGEVILLDGNRTILSLPLDENDEENPETDANAENLAYMIYTSGTTG
FT                   QPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTVGAELHVI
FT                   DEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAMKQPY
FT                   KLINNYGPTENTVVATSTEINPEEGSLSIGQAIANTRVYILGEGNQVQPEGVAGELCVA
FT                   GRGLARGYLNKEDETAKRFVADPFVPGERMYRTGDLVKWVNGGIEYIGRIDQQVKVRGY
FT                   RIELSEIEVQLAQLSEVHDAAVTAVKDKGGNTAIAAYVTPETADIEALKSSLKETLPDY
FT                   MIPAFWVTLNELPVTANGKVDRKALPEPDIEAGGGEYKAPTTDMEELLAGIWQDVLGIS
FT                   EVGVSDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEGKQAD
FT                   QGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAAKGFDPERVEKTLQALIEHHDAL
FT                   RMVYREEDGEIIQAYKPIGESKVSFEIVDLYGTDEEMLKSQIKILADRLQSSLDLQNGP
FT                   LLKAEQYRTEAGDHLLIAVHHLVVDGVSWRILLEDFASGYVQAEKEGSVVFPQKTNSFK
FT                   DWAEELAAFSQSADLLQQAEYWSQIDAEQVSPVPKDYETEQRIVKHTSSVICELTEEDT
FT                   KHLLTDVHQPYGTEINDILLSALGLTMKEWTDDAKIGINLEGHGREDIIPNVNISRTVG
FT                   WFTAQYPVVLDMSEADVSTVIKTVKENLRRIPDKGVGYGILRYVTKTAETKGFTPEISF
FT                   NYLGQFDSEVKTDFFEPSAFDMGRQVSEESEALYALSFSGMIRNGRFVLSCSYNEKEFE
FT                   RATVEEQMERFKENLLMLIRHCTEKEDKEFTPSDFSAEDLGMDEMGDIFDMLEENLK"
FT   gene            378019..378159
FT                   /gene="comS"
FT                   /locus_tag="BSUW23_01807"
FT   CDS_pept        378019..378159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comS"
FT                   /locus_tag="BSUW23_01807"
FT                   /product="regulator of genetic competence"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36419"
FT                   /db_xref="InterPro:IPR035139"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C1"
FT                   /protein_id="ADM36419.1"
FT                   /translation="MNRSGKHLISSIILYPQPSGECISSISLDKQTQATTSPLYFCWRE
FT                   K"
FT   gene            385671..389498
FT                   /gene="srfAC"
FT                   /locus_tag="BSUW23_01810"
FT   CDS_pept        385671..389498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAC"
FT                   /locus_tag="BSUW23_01810"
FT                   /product="surfactin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36420"
FT                   /db_xref="GOA:E0U2C2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C2"
FT                   /protein_id="ADM36420.1"
FT                   /translation="MSQFSKDQVQDMYYLSPMQEGMLFHTILNPGQSFYLEQITMKVKG
FT                   SLNTKCLEESMNVIMDRYEVFRTVFIHEKVKRPVQVVLKKREFRIEEIDLTHLTDSEQI
FT                   AKINEYKEQDKVKGFDLTRDIPMRAAIFKKAEESFEWVWSYHHIILDGWCFGIVVQDLF
FT                   KVYNALREQKPYSLPPVKPYKDYIKWLEKQDKQASLRYWREYLEDFEGQTTFAKLRKKQ
FT                   TDGYEPKELLFSLPEAETKAFTELAKSQHTTLSTALQAVWSVLISRYQQSGDLTFGTVV
FT                   SGRPAEIKGVEHMVGLFINVVPRRVKLSEDITFNGLLKQLQEQALQSEPHQYVPLYDIQ
FT                   TQADQPKLIDHIIVFENYPLQDAKNEENSENGFDMEDVHVFEKSNYDLNLMASPGDEML
FT                   IKLAYNENVFDEAFILRLKSQLLTAIQQLIEKPDQPVSTINLVDDKERAFLLSGLNPPA
FT                   QTHEAKPLTDWFKEAVNVNPDAPALTYSGQTLSYRELDEEANRLARRLQKQGADKGSVV
FT                   ALYTKRSLELVIGILGVLKAGAAYLPIDPKLPKDRISYMLTDSAAACLLTHQEMKEKAA
FT                   QLPYTGTTLFIDDQTRFAEQASDPAIAIEPDDPAYIMYTSGTTGKPKGNITTHANIQGL
FT                   VKHVDYMAFCEKDTFLSVSNYAFDAFTFDFYASTLNAARLIIADEHTLLDTERLTDLIH
FT                   QENVNVMFATTALFNLLTDAGEDWMKGLRCVLFGGERASVPHVRKALRVMGPGKLINCY
FT                   GPTEGTVFATAYVVHDIPDSVSSLPIGKPISNASVYILNEQNQLQPFGAVGELCISGMG
FT                   VSKGYVNRHDLTKQKFITNPFKPGETLYRTGDLARWLPDGTIEYAGRIDDQVKIRGHRI
FT                   ELEEIEKQLQEYPGVKDAVVVADRHDSGDASINAYLVNRTQLSAQDVKAHLKKQLPAYM
FT                   VPQTFTFLDELPLTTNGKVNKRLLPKPDQDQLAEEWIGPRDETEETIAQIWSEVLGRQE
FT                   VGIHDDFFALGGHSLKAMTAASRIKKELGIDLPVKLLFEAPTIAGISAYLKNGGSDGLQ
FT                   DVTIMNPDQEQIIFAFPPVLGYGLMYQNLASRLPSYKLCAFDFIEEENRLDRYAALIQE
FT                   LQPEGPLTLFGYSAGCSLAFEAAKKLEEQGRTVQRIIMVDSYKKQGVSDLDGRTVENDV
FT                   EALMNVNRDNEALNSEAVKQGLKQKTHAFYSYYVNLISTGQVKADIDLLTSGADFDMPE
FT                   WLATWDEATTGAYRVKRGFGTHAEMLQGETLDRNAGILLEFLNTQTETVS"
FT   gene            389526..390254
FT                   /gene="srfAD"
FT                   /locus_tag="BSUW23_01815"
FT   CDS_pept        389526..390254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAD"
FT                   /locus_tag="BSUW23_01815"
FT                   /product="surfactin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36421"
FT                   /db_xref="GOA:E0U2C3"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C3"
FT                   /protein_id="ADM36421.1"
FT                   /translation="MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAA
FT                   EPPGHGTNQTSAIENLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGI
FT                   FPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIKLGGMPAELVENKEVMSFFLPSFRSD
FT                   YRALEQFELHDMASIQSPVHVFNGLDDEKCIRDAEGWKKWAKDITFHEFAGGHMFLLSH
FT                   TEEVAERIFAILNQHPIIQS"
FT   gene            390353..391579
FT                   /gene="ycxA"
FT                   /locus_tag="BSUW23_01820"
FT   CDS_pept        390353..391579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxA"
FT                   /locus_tag="BSUW23_01820"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36422"
FT                   /db_xref="GOA:E0U2C4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C4"
FT                   /protein_id="ADM36422.1"
FT                   /translation="MRASPQMKWFILLFTFVFAIGMNSFRNSFQFFMLPMADTFHADRS
FT                   LIAVSVSIFMITTGIVQFFVGFFIDRFSVRKIMALGAVCISASFLVLPYSPNVHVFSAI
FT                   YGVLGGIGYSCAVGVTTQYFISRWFDTHKGLALAILTNANSAGLLLLSPIWAAAPYHAG
FT                   WQNTYTILGIVMAAVLLPLLAFGMKHPPHAQAPSVKKSYDWRGFWSVVKQSRLIHILYF
FT                   GVFTCGFTMGIIDAHLVPMLKDAHVSHVNGMMAAFGAFIIIGGLLAGWLSDLLGSRSVM
FT                   LSILFFIRLISLICLLIPILGIHHSELWYFGFILLFGLSYTGVIPLTAASISESYQTGL
FT                   IGSLLGINFFIHQIAGALSVYAGGLFFDMTHDYLLIIVVCVVFVGVSAVIELVPFLDKQ
FT                   KAKETHQSL"
FT   gene            complement(391594..392151)
FT                   /gene="ycxB"
FT                   /locus_tag="BSUW23_01825"
FT   CDS_pept        complement(391594..392151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxB"
FT                   /locus_tag="BSUW23_01825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36423"
FT                   /db_xref="GOA:E0U2C5"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C5"
FT                   /protein_id="ADM36423.1"
FT                   /translation="MIQYASESINLPGEITFKDVREIFFYQVGKISFFYFLLFCAIFAA
FT                   VYSSNGWPRLVYGSDALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERIKSKR
FT                   TYILNQEGIRICSKKYDLIFNWNEITAVFEYKNIFRINTSSSQYIAVPKHFFHSKEEMN
FT                   RFRGIILNNTESKKVKFKKDQR"
FT   gene            complement(392205..393143)
FT                   /gene="ycxC"
FT                   /locus_tag="BSUW23_01830"
FT   CDS_pept        complement(392205..393143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxC"
FT                   /locus_tag="BSUW23_01830"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36424"
FT                   /db_xref="GOA:E0U2C6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C6"
FT                   /protein_id="ADM36424.1"
FT                   /translation="MIKNQQASAYMAAILYSFIIGLSFLFVKIALQTAEPFDILAHRFT
FT                   IAFAAATVPVLFGWVKLSIRVKDVMAILPLALLYPALFFSFQAFGLVYSSSSEAGIIQA
FT                   AIPIFTMVFAAYVLKERSTWTQKGFTVLSVAGVMFIFVMKGVDVESASLKGSLLILLSA
FT                   LSSAMYNTAARKMTQRFKLTELTYIMSAIGFVVFNAIALIRHGAAGTVSTYFQPFREPG
FT                   FVLAIVYLGVLSSLVTSFLSNYTLSRIEAFKMSAFNHVSTIVTMIAGVVILNESLSWYH
FT                   LAGAVCIMIGVLGSNTNLQKKTNHHRVPAKK"
FT   gene            393264..394598
FT                   /gene="ycxD"
FT                   /locus_tag="BSUW23_01835"
FT   CDS_pept        393264..394598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxD"
FT                   /locus_tag="BSUW23_01835"
FT                   /product="putative PLP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36425"
FT                   /db_xref="GOA:E0U2C7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C7"
FT                   /protein_id="ADM36425.1"
FT                   /translation="MEKYMSLLTRIEEMMQSSAYQEGDRLPSIRQLSARYQVSKSTVIR
FT                   ALQELEKRHLIYSVPKSGYYIVKKTGKSKSGQPGTIDFATSAPDPDVFPYLDFQHCINK
FT                   AIDTYKNDLFIYGTPKGLPSLIRVLRKLLANQQVFADERHIFITSGVQQALSLLCAMPF
FT                   PNGKEKIAIEQPGYHLMIEQLETLGIPAIGVNRTEAGLDIAEVERLFQTESIKFFYTMP
FT                   RFHNPLGCSLSEHDKQELVRLAEMYDVYLVEDDYLGDLEENKKADPLYAYDLSSHVIYL
FT                   KSFSKMMFPGLRVGAAVLPDALADTFHTYKKLNDIDCSMISQAALEIYLKSGMYGRHKE
FT                   KIRASYKERSLRLHQAIQTHRQLGSGRFTFSSGQAPCMHTHLVLPRDLPASRVIQRMKK
FT                   QGVLLEAIDRHYLSDYPKENLLKINISNVKTEDIEHGVKLLMSHL"
FT   gene            complement(394593..395267)
FT                   /gene="sfp"
FT                   /locus_tag="BSUW23_01840"
FT   CDS_pept        complement(394593..395267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfp"
FT                   /locus_tag="BSUW23_01840"
FT                   /product="4'-phosphopantetheinyl transferase (Surfactin
FT                   synthetase-activating enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36426"
FT                   /db_xref="GOA:E0U2C8"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C8"
FT                   /protein_id="ADM36426.1"
FT                   /translation="MKIYGIYMDRPLSQEENERFMSFISPEKQEKCRRFYHKEDAHRTL
FT                   LGDVLVRSVISRQYQLDKADIRFSAQEYGKPCIPDLPDAHFNISHSGRWVICAFDSHPI
FT                   GIDIEKMKPISLEIAKRFFSKTEYSDLLAKNKDEQTDYFYHLWSMKESFIKQEGKGLSL
FT                   PLDSFSVRLHQDGQVSIELPDSHTPCYIKTYEVDPGYKMAVCAAHPDFPEDITMLSYEA
FT                   LL"
FT   gene            complement(395372..396019)
FT                   /gene="yczE"
FT                   /locus_tag="BSUW23_01845"
FT   CDS_pept        complement(395372..396019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczE"
FT                   /locus_tag="BSUW23_01845"
FT                   /product="integral inner membrane protein regulating
FT                   antibiotic production"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36427"
FT                   /db_xref="GOA:E0U2C9"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2C9"
FT                   /protein_id="ADM36427.1"
FT                   /translation="MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLF
FT                   QHFGLTVGQWSIIIGALIVGLTSLFTRAWPKIGAILNMVLIGVFIDFFNFLLPAPSTYT
FT                   GSVIVFSLGVLLIGYGVGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMEITILFA
FT                   AWGMGGPIGFGTILTAILTGIILRFSLPQSIQLLNYAVARRTAAVKATPPIH"
FT   gene            complement(396141..396884)
FT                   /gene="tcyC"
FT                   /locus_tag="BSUW23_01850"
FT   CDS_pept        complement(396141..396884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyC"
FT                   /locus_tag="BSUW23_01850"
FT                   /product="cystine ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36428"
FT                   /db_xref="GOA:E0U2D0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D0"
FT                   /protein_id="ADM36428.1"
FT                   /translation="MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGELSFDDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVME
FT                   GPVQVQKRNKEEVRKEAIQLLEKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELML
FT                   FDEPTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQDVADEVVFIDGGVIVEQG
FT                   PPEQIFSAPKEERTQRFLNRILNPL"
FT   gene            complement(396898..397602)
FT                   /gene="tcyB"
FT                   /locus_tag="BSUW23_01855"
FT   CDS_pept        complement(396898..397602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyB"
FT                   /locus_tag="BSUW23_01855"
FT                   /product="cystine ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36429"
FT                   /db_xref="GOA:E0U2D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D1"
FT                   /protein_id="ADM36429.1"
FT                   /translation="MYLNNLPALTLGTAIPWDLVQQSFWPILSGGIYYTIPLTILSFIF
FT                   GMILALITALARMSKVRPLRWVFSVYVSAIRGTPLLVQLFIIFYLFPAFNITLDPFPSA
FT                   VIAFSLNVGAYASEIIRASILSVPKGQWEAGYTIGMTHQKTLFRVILPQAFRVSIPPLS
FT                   NTFISLIKDTSLASQILVAELFRKAQEIGARNLDQILVIYIEAAFIYWMICFLLSLVQH
FT                   VIERRLDRYVAK"
FT   gene            complement(397589..398395)
FT                   /gene="tcyA"
FT                   /locus_tag="BSUW23_01860"
FT   CDS_pept        complement(397589..398395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyA"
FT                   /locus_tag="BSUW23_01860"
FT                   /product="cystine ABC transporter (substrate-binding
FT                   lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36430"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D2"
FT                   /protein_id="ADM36430.1"
FT                   /translation="MKKALLALFMVVSIAVLAACGAGNDNQSKDNAKDGDLWASIKKKG
FT                   VLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFNETQWDSMFAGLNSK
FT                   RFDVIANQVGKTDREDQYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNY
FT                   NKLATDAGAKVEGVEGLAQSLQLIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGD
FT                   PQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK"
FT   gene            complement(398511..399383)
FT                   /gene="yclA"
FT                   /locus_tag="BSUW23_01865"
FT   CDS_pept        complement(398511..399383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclA"
FT                   /locus_tag="BSUW23_01865"
FT                   /product="putative transcriptional regulator (LysR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36431"
FT                   /db_xref="GOA:E0U2D3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D3"
FT                   /protein_id="ADM36431.1"
FT                   /translation="MDIRQLRYFITIAQEQKITSAAKKLHMAQPPLSRQLKQLEDELGV
FT                   ILFDRNKKKQMTLTYEGTVFLKRAKEILHRFEDAVIEVQELKEKVAGTLAVGSTIYCAA
FT                   LMLEKVTQIKERYPHLTFNIWENEPATLLELLESRQIDAAVTTTLIKSDSVQFKQLDDI
FT                   PCVLVLSEEAGYPCGDTIKMEDIPSFPLILLRPVNGKGVYNQVMNEFHRLNLEPRIVCE
FT                   CHDSATLLSLVSSGFGASILPVTMIPVHMRNHVHTVHIENNPFIMTPAVIWRTDSYLPK
FT                   PVQQFLDLF"
FT   gene            399473..400087
FT                   /gene="ubiX"
FT                   /locus_tag="BSUW23_01870"
FT   CDS_pept        399473..400087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BSUW23_01870"
FT                   /product="putative 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36432"
FT                   /db_xref="GOA:E0U2D4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D4"
FT                   /protein_id="ADM36432.1"
FT                   /translation="MKAEFKRKGGDKVKLVVGMTGATGAIFGVRMLEWLKAAEVETHLV
FT                   VSPWANVTIKHETGYTLKEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLAS
FT                   IRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFY
FT                   NQPSSLEEMVDHIVFRTLDQFGIRLPEAKRWNGIEKQKGGA"
FT   gene            400090..401511
FT                   /gene="ubiD"
FT                   /locus_tag="BSUW23_01875"
FT   CDS_pept        400090..401511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="BSUW23_01875"
FT                   /product="putative 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36433"
FT                   /db_xref="GOA:E0U2D5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D5"
FT                   /protein_id="ADM36433.1"
FT                   /translation="MAYQDFREFLAALEKEGQLLTVNEEVKPEPDLGAAARAASNLGDK
FT                   SPALLFNNIYGYHNAQIAMNVIGSWPNHAMMLGMPKDTPVKEQFFEFAKRYDQFPMPVK
FT                   REESAPFHENEITEDINLFDILPLFRINQGDGGYYLDKACVISRDLEDPENFGKQNVGI
FT                   YRMQVKGKDRLGIQPVPQHDIAIHLRQAEERGINLPVTIALGCEPVITTAASTPLLYDQ
FT                   SEYEMAGAIQGEPYRIVKSKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGG
FT                   RSMPIIKIKRVYHRNNPIFEHLYLGMPWTECDYMIGINTCVPLYQQLKEAYPNEIVAVN
FT                   AMYTHGLIAIVSTKTRYGGFAKAVGMRALTTPHGLGYCKMVIVVDEDVDPFNLPQVMWA
FT                   LSTKMHPKHDAVIIPDLSVLPLDPGSNPSGITHKMILDATTPVAPETRGHYSQPLDSPL
FT                   TTKEWEQKLMDLMNK"
FT   gene            401570..401755
FT                   /gene="bsdD"
FT                   /locus_tag="BSUW23_01880"
FT   CDS_pept        401570..401755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdD"
FT                   /locus_tag="BSUW23_01880"
FT                   /product="nonoxidative vanillate/4-hydroxybenzoate
FT                   decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36434"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D6"
FT                   /protein_id="ADM36434.1"
FT                   /translation="MSKSPVEGAWEVYQCQTCFFTWRSCEPESITNPAKYNPAFKIDPK
FT                   ETETAIEVPAVPERKA"
FT   gene            401752..402216
FT                   /gene="yclD"
FT                   /locus_tag="BSUW23_01885"
FT   CDS_pept        401752..402216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /locus_tag="BSUW23_01885"
FT                   /product="putative FMN-binding enzyme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36435"
FT                   /db_xref="GOA:E0U2D7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D7"
FT                   /protein_id="ADM36435.1"
FT                   /translation="MISVSCMSDRLFELLDGNRLKEKRQEAFVLQTVSEDGWPHAAMIS
FT                   VGEIIALSRTDIRIALWKNTATAANILRTGKAQFTAWWKGAAHYVKLQCEPLPPLKEAE
FT                   YDRERFACRIVSVKEDVAKYADLTSGVRIQLHSPEEVLNRWEKTLEELKR"
FT   gene            402284..403129
FT                   /gene="yclE"
FT                   /locus_tag="BSUW23_01890"
FT   CDS_pept        402284..403129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclE"
FT                   /locus_tag="BSUW23_01890"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36436"
FT                   /db_xref="GOA:E0U2D8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D8"
FT                   /protein_id="ADM36436.1"
FT                   /translation="MERMGICHSDGFDLSYRIEGEGAPILVIGSAVYYPRLFSSDIKQK
FT                   YQWIFADHRGFVKPKRELRAEDLRLEAVLADIERLRTSLQLEDMVILGHSGHAFMALEY
FT                   ARTYPEHVRKVALFNTAPDNSEARQRKSESFFMETASLERKKRFEKDIANLPLDIKKDP
FT                   ERRFVHMCIHAEAKSFYQERPHAAALWDGVFTNMPIIDELWGHTFAQLDLIQRLADVQV
FT                   PVYIGLGRYDYLVAPVTLWDAVDGLYPHVEKVIFEKSGHQPMLEEPQAFDQSFSKWMDK
FT                   "
FT   gene            complement(403167..404645)
FT                   /gene="dtpT"
FT                   /locus_tag="BSUW23_01895"
FT   CDS_pept        complement(403167..404645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtpT"
FT                   /locus_tag="BSUW23_01895"
FT                   /product="di-tripeptide-proton ABC symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36437"
FT                   /db_xref="GOA:E0U2D9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2D9"
FT                   /protein_id="ADM36437.1"
FT                   /translation="MASIDNESIIKSVPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAI
FT                   LLYYLYTETVNGGLGFDKGTAVAIMSIYGSLVYMSSIIGGWLADRVFGTANTVFYGGIF
FT                   IMFGHVALAYPGSATAFYISMALIIIGTGLLKPNVSSVVGDLYTKEDPRRDSGFSIFYM
FT                   GINLGGLLAPLIVGTLGQKYNYHLGFGAAAVGMLLGLIVFALTRKKNLGIAGSNVPNPL
FT                   SKKSAIGTGIGVIIVAIAAIIAVQTGVLTINRFINLVSILGILIPIVYFIIMFTSKKAD
FT                   KTEKSRLAAYVPLFIAAVMFWAIQEQGATILALYADERTRLSLGGLELQSSWFQSLNPL
FT                   FIVIFAPIFAWLWMKLGKRQPSTPVKFSIGIILAGLSFIIMVFPAMQGKEALVSPLWLV
FT                   LSFLLVVLGELCLSPVGLSVTTKLAPAAFSAQTMSMWFLTNAAAQAINAQVAGLFDKIP
FT                   ETIYFGTIGLISIVLGGILLLISPIIKRAMKGVL"
FT   gene            404925..406679
FT                   /gene="yclG"
FT                   /locus_tag="BSUW23_01900"
FT   CDS_pept        404925..406679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /locus_tag="BSUW23_01900"
FT                   /product="putative uronase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36438"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E0"
FT                   /protein_id="ADM36438.1"
FT                   /translation="MAEFILNAADFGILGDGKTDSTELINQCLSTAVSKGYHTVWFPKG
FT                   TYVIDGTLGGDPNQKFRNAGIIVPGNLEIVMDPECIIKVIPNSSWGYSAFYVGKQENIT
FT                   ISGGQIIGERDEHTYASAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRG
FT                   LKTNNDYRTSEQITIRRCEVRRSRRNNISITGCDMVTVEECVIADAGTGNGTAPKFGID
FT                   IEGYGEGDIDYEEPINVSIRNNHFIGNVSSSVTNFNGYGISIEGNHSDNTISYGYGTQT
FT                   VIKGNILRRAEDAAAAPRVGITGLGVSQGKESSDAVIAGNLITGFSTGIDVRGKSVLVT
FT                   NNKISNFENTGILVYQSSDVKVDGNQIQNGLSKTMRSTGLRAVLSDDTAFLNNCLIQVI
FT                   DGVNISGGDMIIKDNVLRKFSRGIWIAQGNAVIEGNTLNPDAFEAAPESYAVSVTNNAS
FT                   AIIKNNTYKEFKNYPIYCSTSAKTSIIGNHFERSPLLVTIYINAGVHEIFDNTISVNRT
FT                   AGNPIVIYINGSAGSIISGNTIDNLSAGTATAIQTNTSTNSKIIGNRIFKGTINRHSSD
FT                   TIDGNIIA"
FT   gene            complement(406695..406916)
FT                   /gene="yczF"
FT                   /locus_tag="BSUW23_01905"
FT   CDS_pept        complement(406695..406916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczF"
FT                   /locus_tag="BSUW23_01905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36439"
FT                   /db_xref="GOA:E0U2E1"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E1"
FT                   /protein_id="ADM36439.1"
FT                   /translation="MKILGVTGILLICLLTISVFMDMLQGFSLTKAIYNNMSSFKMTTF
FT                   AEWVVLLFFVFILVREMYVIYKSKKKNP"
FT   gene            407042..408676
FT                   /gene="gerKA"
FT                   /locus_tag="BSUW23_01910"
FT   CDS_pept        407042..408676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BSUW23_01910"
FT                   /product="spore germination receptor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36440"
FT                   /db_xref="GOA:E0U2E2"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E2"
FT                   /protein_id="ADM36440.1"
FT                   /translation="MPLFSKQKKKTDSKDKQNTEEKNQDQLQEKERPVLVSASLTKNIA
FT                   ETKKEVGSSSDVIIREIKIGEQDRIHLAIIYIAGLVDNNTIHEWLIEPLVQNESIQNSH
FT                   AIQQILEKTLPLGGVKAEKSWDKLFSELMLGNALVFADGYDEALICSTQGGEQRSIEEP
FT                   STQVSFRGPRQGFTESLETNISMIRRYIKNPNVWVEKMKIGSVTHTDVALMYIHGICDE
FT                   KVLKEVKQRLKKIDIDSILESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAI
FT                   VVDGTPFVLIAPALFVQFFQSVEDYYSRFDIATSIRVLRVLVFFISLVAPAVYVAATTF
FT                   HQEMIPTQLLVVIAAQREIVPFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGAL
FT                   VIGQAAVQAGIVSPAMVIIVAITAIASFATPAFAMAISARLIRFIFIIASSIMGFYGLI
FT                   LGIIMMFVHLCSLRSFGVPYMSPLAPFSSQGVKDTLFRVPWWADEKRPESISKKDKVRQ
FT                   GDDQRPEPDGSRGMVNKDLEEGDQNGT"
FT   gene            408666..409889
FT                   /gene="gerKC"
FT                   /locus_tag="BSUW23_01915"
FT   CDS_pept        408666..409889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BSUW23_01915"
FT                   /product="spore germination receptor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36441"
FT                   /db_xref="GOA:E0U2E3"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E3"
FT                   /protein_id="ADM36441.1"
FT                   /translation="MVRKRVLTVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNEGN
FT                   YVLHLQIINPGNVAGGLQGGGAGDRPPVSVYSIEGDNMTEALRKASMKVSRRLYFAHTN
FT                   LVAISEKLAREEGLDFVLDNLDRDTEFRTTATVVIAHKTKAENIVKILTPIDKIPSNKV
FT                   NKTLDFTEAQYGRVVKTNIQDVLKTLAIDTRAPVIPGYMMIGDDKKGISMENTQATDPK
FT                   AILQADGLAVFNKSGHLKYWITDKESVGAVWLMNKVQHTFINADWDKTKDAVSLQVTHQ
FT                   TTKLVPEMRNGRPHIHVRVAVEGIIDAVKYPFKLSDPKELSAIEKALNKELEKEITNTV
FT                   KMVKKNKIDFIGFGDTIYRKYPKQWEKMKDTWDKEYLPELPVDVKAETYIRRTGLRNNP
FT                   IQHQLEDE"
FT   gene            409914..411038
FT                   /gene="gerKB"
FT                   /locus_tag="BSUW23_01920"
FT   CDS_pept        409914..411038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BSUW23_01920"
FT                   /product="spore germination receptor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36442"
FT                   /db_xref="GOA:E0U2E4"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E4"
FT                   /protein_id="ADM36442.1"
FT                   /translation="MEKAKISIRQLFVMVIIFELGSSLLITPGSMAGRDAWIAVLLGCA
FT                   AGLFLYYLYQGIYQCYPESSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEM
FT                   LLTFAYHDTPILIVNALLMIVCIYAVRKGIEVLARAAELLFGAMYILGALGLVLIIVSG
FT                   SIDTQNLKPVLEDGIVPVIHSVFTQTMYVPFGEVVLFVMIFPHLNDRKDVKKVGMAAIA
FT                   ISGLVVALSVAINISVLDVDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFF
FT                   KVSLYLYAVVVGTSTLFKEKNPSQLAYPMGLGILILSITIATNFSEHLNEGLKVVPLYI
FT                   HLPFQLLFPLFLFIIAVWKKKRREKSKRSEKKKQ"
FT   gene            complement(411141..411821)
FT                   /gene="yclH"
FT                   /locus_tag="BSUW23_01925"
FT   CDS_pept        complement(411141..411821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclH"
FT                   /locus_tag="BSUW23_01925"
FT                   /product="putative ABC transporter (ATPase component)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36443"
FT                   /db_xref="GOA:E0U2E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E5"
FT                   /protein_id="ADM36443.1"
FT                   /translation="MSLLEFQQVGYWYKDKSQPLFQDINISFQKGKFYTIVGTSGTGKT
FT                   TFLSLAGGLDAPKEGTILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTA
FT                   MEITGSKETNKEAYALEMLQKVGISEKQARQKVLTLSGGQQQRVSITRAFCCETDLIVA
FT                   DEPTGNLDEDTSKEIVRLFQDLAHKENKCVIMVTHDEQIAKVSDINIRLSRGSFTVKEN
FT                   VAVV"
FT   gene            complement(411837..413291)
FT                   /gene="yclI"
FT                   /locus_tag="BSUW23_01930"
FT   CDS_pept        complement(411837..413291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclI"
FT                   /locus_tag="BSUW23_01930"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36444"
FT                   /db_xref="GOA:E0U2E6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E6"
FT                   /protein_id="ADM36444.1"
FT                   /translation="MNFIKRAFWNMKAKKGKTLLQLFVFTVICVFVLSGLTIQSAAQKS
FT                   SELARQELGGSVTLQVDRQKQMEKQQDSGEKRSFESTPIKVSDANKLAALDHVKSYNYI
FT                   TSASANAGNFDAIESSSSSSSDSSSSSNTKNGQGGPQRIQADLSIEGVTSTALVDEFSD
FT                   GDSKITDGRAITKSDVGKNVTVINETLAVENDVSVGDSITIESATDEDTTVKLKVVGIY
FT                   KTTSSGDDQAQNFSFLNPYNKLYTPYTATAALKGDDYKNTIDSAVYYMDDAKNMDAFVK
FT                   AAKKTSIDFNTYTLNTNDQLYQQMVGPIENVASFSKNVVYLVSVAGAVILGLIVMMSIR
FT                   ERKYEMGVLMAIGEKRWKLIGQFLTEILIVAVIAIGLASVTGNLVANQLGNQLLSQQIS
FT                   SSSDSTQTASGQNGQMPSGGGGMGGGMFGHNSANVDVIDSLNVAVSMNDMLVLGGIGII
FT                   IAIIATLLPSISVLRLHPKTILTKQE"
FT   gene            413504..414187
FT                   /gene="yclJ"
FT                   /locus_tag="BSUW23_01935"
FT   CDS_pept        413504..414187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclJ"
FT                   /locus_tag="BSUW23_01935"
FT                   /product="two-component response regulator (YclK)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36445"
FT                   /db_xref="GOA:E0U2E7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E7"
FT                   /protein_id="ADM36445.1"
FT                   /translation="MKILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENW
FT                   DLIILDIMLPSMDGVTICRKIRETSTVPIIMLTAKDTESDQVIGFEMGADDYVTKPFSP
FT                   LTLVARIKAVIRRYQATGKAVIDEDMIESECFTINKKTREVFLNGEPVENLTPKEFDLL
FT                   YYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLASEDKPFLYTVWGVGY
FT                   KFDED"
FT   gene            414177..415595
FT                   /gene="yclK"
FT                   /locus_tag="BSUW23_01940"
FT   CDS_pept        414177..415595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclK"
FT                   /locus_tag="BSUW23_01940"
FT                   /product="two-component sensor histidine kinase (YclJ)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36446"
FT                   /db_xref="GOA:E0U2E8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E8"
FT                   /protein_id="ADM36446.1"
FT                   /translation="MKIKYLYQLLLSHISILILAFVIIISLFSHFVKEFAYQNKVEELT
FT                   SYAVQIANEFQAGQVDMRRLYPYQDILSTRKTQFIIFNEEQQPYFLPEGFHHQPREKLK
FT                   KSEWNKLKKGQTVMIRADGRFDDEVSLVAQPIFVQNEFKGAVLLISPISGVEQMVNQVN
FT                   LYMFYAVISTLVITILVSWLLSKFHVKRIQKLREATDKVASGDYDIHLENSYGDEIGVL
FT                   ASDFNIMAKKLKQSRDEIDRLEKRRRQFIADVSHELKTPLTTINGLVEGLNSHTIPEDK
FT                   KDKCFSLISEETKRMLRLVKENLDYEKIRSQQITLNKLDVPLIEVFEIVKEHLEQQAKE
FT                   KQNKLTIQVEDHIIVHADYDRFIQILVNITKNSIQFTRNGNIWLRGLEGYKETIIEIED
FT                   TGIGISKEDIEHIWERFYKADISRTNTAYGEYGLGLSIVKQLVEMHQGTVEIKSEKGKG
FT                   TTFIIRLPLTAKQP"
FT   gene            415757..416905
FT                   /gene="rapC"
FT                   /locus_tag="BSUW23_01945"
FT   CDS_pept        415757..416905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapC"
FT                   /locus_tag="BSUW23_01945"
FT                   /product="response regulator aspartate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36447"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2E9"
FT                   /protein_id="ADM36447.1"
FT                   /translation="MKSGVIPSSAVGQKINEWYKYIRTFSVPDAEVLKAEIQQELNHMQ
FT                   HDSNLLLYYSLMEFRHQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYV
FT                   NFFRGMYEFDKREFISAITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLI
FT                   NIKNAYEIYVEQETYNVRIIQCHFVFGVNLMDERNFEQAARHFKLALDMAEAEQKAQLV
FT                   GRAYYNLGLCYYNQDLLDPAIDYFEKAVSTFESSRIINSLPQAYFLITLIYYKRGKHDK
FT                   ASAYHKRGYEYAKETDDADYAVKFEFLQSLYQDQPNEEGIERCFQYLKNKNMYADIEDL
FT                   ALEVAKYYYEQKWFKLSASYFLQVEEARKQIQRSEGLYEIEI"
FT   gene            416889..417011
FT                   /gene="phrC"
FT                   /locus_tag="BSUW23_01950"
FT   CDS_pept        416889..417011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrC"
FT                   /locus_tag="BSUW23_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36448"
FT                   /db_xref="InterPro:IPR025899"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F0"
FT                   /protein_id="ADM36448.1"
FT                   /translation="MKLKSKLFVICLAAAAIFTAAGVSANAEALDFHVTERGMT"
FT   gene            complement(417110..417217)
FT                   /gene="yczN"
FT                   /locus_tag="BSUW23_01955"
FT   CDS_pept        complement(417110..417217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczN"
FT                   /locus_tag="BSUW23_01955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36449"
FT                   /db_xref="GOA:E0U2F1"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F1"
FT                   /protein_id="ADM36449.1"
FT                   /translation="MSGYSNCGGYGHSFALIVVLFILLIIVGTAFVGGF"
FT   gene            complement(417366..418730)
FT                   /gene="yclM"
FT                   /locus_tag="BSUW23_01960"
FT   CDS_pept        complement(417366..418730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclM"
FT                   /locus_tag="BSUW23_01960"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36450"
FT                   /db_xref="GOA:E0U2F2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F2"
FT                   /protein_id="ADM36450.1"
FT                   /translation="MKVVKFGGSSLASGAQLEKVFHIVTSDPARKAVVVSAPGKRYAED
FT                   TKVTDLLIACAEQYLASGSAPELTEAVVERYALIANELQLEQSIIEKIRDDLFTLLEGD
FT                   KSNPEQYLDAVKASGEDNNAKLIAAYFRHKGVKAEYINPKDAGLFVTNEPGNAQVLPES
FT                   YQNLYRLRERDGLIIFPGFFGFSEAGDVITFSRSGSDITGSILANGLQADLYENFTDVD
FT                   AVYAVNPSYVENPKEISELTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPS
FT                   AQGTRVVSKRDNTNGPVVGIASDTGFCSIYISKFLMNREIGFGRRALQILEEHGLTYEH
FT                   VPSGIDDMTIILREGQMDAATERSVIKRIQEDLHADEVIVEHHLALIMVVGEAMRHNVG
FT                   TTARAAKALSEAKVNIEMINQGSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS"
FT   gene            419115..420065
FT                   /gene="yclN"
FT                   /locus_tag="BSUW23_01965"
FT   CDS_pept        419115..420065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclN"
FT                   /locus_tag="BSUW23_01965"
FT                   /product="putative iron-siderophore ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36451"
FT                   /db_xref="GOA:E0U2F3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F3"
FT                   /protein_id="ADM36451.1"
FT                   /translation="MKLRYLFILLIILGVTSVFIGVEDLSPLDLFDLSKQEASTLFASR
FT                   LPRLFSIVIAGLSMSICGLIMQQISRNKFVSPTTAGTMDWARLGILISLLLFTSASPLM
FT                   KMLVAFVFALAGNFLFMKILERIKFNDTIFIPLVGLMLGNIVSSIATFIAYKYDLIQNV
FT                   SSWLQGDFSLVVKGRYELLYLSIPLVIIAYVYADKFTLAGMGESFSVNLGLKYKRVVNI
FT                   GLIIVSLITSLVILTVGMLPFLGLIIPNIVSIYRGDNLKNSLPHTALLGAVFVLFCDIL
FT                   GRIIIFPYEISIGLMVGIIGSGIFLFMLLRRKAYA"
FT   gene            420058..421005
FT                   /gene="yclO"
FT                   /locus_tag="BSUW23_01970"
FT   CDS_pept        420058..421005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclO"
FT                   /locus_tag="BSUW23_01970"
FT                   /product="putative iron-siderophore ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36452"
FT                   /db_xref="GOA:E0U2F4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F4"
FT                   /protein_id="ADM36452.1"
FT                   /translation="MRNQMKIALLVVLAIVCIGLFLFYDLGNWDYTLPRRIKKVAAIAL
FT                   TGGAIAFSTVIFQTITNNRILTPGILGLDSLYMLIQTGIIFLFGSANIVIMNKNINFII
FT                   SVLLMILFSLVLYQIMFKGEGRNIFFLLLIGIVFGTLFGSLSSFMQMLIDPNEFQVVQD
FT                   KMFASFNNINTDLLWLAFIIFLLTGAYVWRFTKFFDVLSLGREHAVNLGIDYDKVVKQM
FT                   LIVVAILVSVSTALVGPIMFLGLLVVNLAREFLKTYKHSYLIAGSVFISIIALVGGQFV
FT                   VEKVFTFSTTLSVIINFAGGIYFIYLLLKENKSW"
FT   gene            420999..421757
FT                   /gene="yclP"
FT                   /locus_tag="BSUW23_01975"
FT   CDS_pept        420999..421757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclP"
FT                   /locus_tag="BSUW23_01975"
FT                   /product="putative iron-siderophore ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36453"
FT                   /db_xref="GOA:E0U2F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F5"
FT                   /protein_id="ADM36453.1"
FT                   /translation="MVEVKNVSKQYGGEVVLEETSVTIPKGKITSFIGPNGAGKSTLLS
FT                   IMSRLIKKDSGEIFIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYS
FT                   QGRLTEEDWVHINQALGYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPL
FT                   NNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDHIVVLKNGRIVKEGPPED
FT                   MIETSVLEEIYDMTIPIQQIDNQRIGVYFS"
FT   gene            421779..422735
FT                   /gene="yclQ"
FT                   /locus_tag="BSUW23_01980"
FT   CDS_pept        421779..422735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclQ"
FT                   /locus_tag="BSUW23_01980"
FT                   /product="putative iron-siderophore ABC transporter
FT                   (binding lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36454"
FT                   /db_xref="GOA:E0U2F6"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F6"
FT                   /protein_id="ADM36454.1"
FT                   /translation="MKKFALLFIALVTAVVISACGNQSTSSSKGSDSKNEQITVKHQLD
FT                   KNGTKVPKNPKKVVVFDFGSLDTLDKLGLDGKVAGLPKQALPKYLSKFKDDKYADVGSL
FT                   KEPDFEKVADLDPDLIIISGRQSESYKEFSEIAPTIYLGVDTAKYMESFKSDAETIGKI
FT                   FDKEDEVKDELATIDHSIADLKKKAEKLNKNGLVIMANDGKISAFGSKSRYGLIHDVFG
FT                   VTPADKNIKASTHGQSVSYEYISKTNPDYLFVIDRGTAIGETSSTKQVVENDYVKNVNA
FT                   VKNDHVVYLDSATWYLSGGGLESMTQMIKEVKDGLEK"
FT   gene            complement(422782..424206)
FT                   /gene="ycnB"
FT                   /locus_tag="BSUW23_01985"
FT   CDS_pept        complement(422782..424206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnB"
FT                   /locus_tag="BSUW23_01985"
FT                   /product="putative efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36455"
FT                   /db_xref="GOA:E0U2F7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F7"
FT                   /protein_id="ADM36455.1"
FT                   /translation="MNQSIEPKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFN
FT                   VDANQAQWLTTSFMLTNGILIPITAFLIEKFTSRTLLITAMSIFTAGTVVGAFAPNFPV
FT                   LLTARIIQAAGAGIMMPLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVE
FT                   AFSWRSLFYIILPFAVIDLILASILMKNVTTLRKTKIDILSVILSTFGFGGLLYGFSSV
FT                   GSYGWTSSTVLISLLVGVIALLLFITRQMKLEKPMLEFRVFTFGVFSLTTLLGTLVFAL
FT                   LIGTETILPLYTQNVRDVTAFDTGLMLLPGAIVMGFMSPIIGRIFDRVGGRGLAIAGFC
FT                   IIFLTSLPFMQLTDHTSLAWIVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMN
FT                   NTIRQVGGSIGTALLVSVMSNQAAHAGTTNVKHAALHGMNAAFIVAACIALAGFLLSFT
FT                   LKKKKPQRPAEQQPAR"
FT   gene            complement(424226..425104)
FT                   /gene="ycnC"
FT                   /locus_tag="BSUW23_01990"
FT   CDS_pept        complement(424226..425104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnC"
FT                   /locus_tag="BSUW23_01990"
FT                   /product="putative transcriptional regulator (TetR/AcrR
FT                   family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36456"
FT                   /db_xref="GOA:E0U2F8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F8"
FT                   /protein_id="ADM36456.1"
FT                   /translation="MLDKKTDILLAARKLFSEKDFTSVSMQAIAEECKMSKASIYKLFQ
FT                   SKEDLLLELLSFNQKQMVAAASRLQENTALTPEERLTQKVKMELEGFRRNQQFFNMLTY
FT                   GNPKLHNDRVKQHIHQTRSTIICWHRDSLIQAYGENILPYVWDLVIILHGMMREFLMLI
FT                   KIEEKPLELDPIAEFIISTLNQIIKNKETRQSLLPPEAIELYIHSASSYKPKDKSALLS
FT                   ESLKELHKGISSLPAADYDVDELTSAAAMLEEEAKKEEPRAFLLKSLIGYLEQTGVLTQ
FT                   PVSMLKTLLIT"
FT   gene            complement(425267..426016)
FT                   /gene="ycnD"
FT                   /locus_tag="BSUW23_01995"
FT   CDS_pept        complement(425267..426016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnD"
FT                   /locus_tag="BSUW23_01995"
FT                   /product="NADPH-FMN oxidoreductase (nitroreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36457"
FT                   /db_xref="GOA:E0U2F9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2F9"
FT                   /protein_id="ADM36457.1"
FT                   /translation="MNEVIKSLTDHRSIRSYTDEPVAKEQLDQIIQAVQSAPTSINGQQ
FT                   VTVITVQDKERKKKISELSGGQPWIDQAPVFLLFCADFNRAKIALEDLNDIKMEITNGL
FT                   ESVLVGAVDAGIALGTATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPVSGLVI
FT                   GHPADRSAKKPRLPQEAVNYQETYLNQDELTSYIQAYDEKMSEYMNKRTNGKETRNWSQ
FT                   GIASYYERLYYPHIREMLEKQGFKVEK"
FT   gene            complement(426033..426320)
FT                   /gene="ycnE"
FT                   /locus_tag="BSUW23_02000"
FT   CDS_pept        complement(426033..426320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /locus_tag="BSUW23_02000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36458"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2G0"
FT                   /protein_id="ADM36458.1"
FT                   /translation="MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVG
FT                   EENTFVMLEQWKDEAAMKSHNETAHFQGFVAKGKELLSAPLDVVRTELSE"
FT   gene            426461..426775
FT                   /gene="yczG"
FT                   /locus_tag="BSUW23_02005"
FT   CDS_pept        426461..426775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczG"
FT                   /locus_tag="BSUW23_02005"
FT                   /product="putative transcriptional regulator (ArsR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36459"
FT                   /db_xref="GOA:E0U2G1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2G1"
FT                   /protein_id="ADM36459.1"
FT                   /translation="MNIPNHPETETLQLTKVLHALSDPLRLELVKQLADAKEKTCGTCA
FT                   DVQVAKSTLSHHFKVLRESGIAQVRIEGKRRYYSLRAEDLEKAFPGLLEAVLNVDQDRW
FT                   "
FT   gene            complement(426777..428216)
FT                   /gene="gabR"
FT                   /locus_tag="BSUW23_02010"
FT   CDS_pept        complement(426777..428216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BSUW23_02010"
FT                   /product="transcriptional regulator (GntR/MocR family) with
FT                   PLP binding site"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36460"
FT                   /db_xref="GOA:E0U2Z9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U2Z9"
FT                   /protein_id="ADM36460.1"
FT                   /translation="MDITFTLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKREL
FT                   AEKLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEKLDMFSAVEHPPFALPDDLKEVHI
FT                   DQSNWISFSHMSADTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLIS
FT                   LTRGVKCRPEQIVIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTI
FT                   MLDEKGISIAEISRQQPDVLVTTPSHQFPAGTIMPVSRRIQLLNWAAEKPHRYIIEDDY
FT                   DSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRTYKQRGYDL
FT                   QTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLIAALETEFSGEVTVKGANAGL
FT                   HFVTEFDTCRTEQDILAHAAGQQLEIFGMSRFDLKEKRRQTGRPALIIGFARLKEEDIQ
FT                   EGVERLFRAVYGHKKIPGTGD"
FT   gene            428322..429632
FT                   /gene="gabT"
FT                   /locus_tag="BSUW23_02015"
FT   CDS_pept        428322..429632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BSUW23_02015"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36461"
FT                   /db_xref="GOA:E0U300"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0U300"
FT                   /protein_id="ADM36461.1"
FT                   /translation="MSQTTASITTAQWQQKREQFVSKGVSNGNRSLAVKGVGAELYDLD
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPSYIELAEKLCGIAP
FT                   GGHEKKAIFLNSGAEAVENAVKISRKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFASEVYQAPFPYYYQKPAGMSDESYDDMIIQAFNDFFIASVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSK
FT                   SLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEKI
FT                   GKTIENKAYEWKQECPFIGDIRRLGAMAAIEIVKDPDTREPDKAKAAAIASYANQNGLL
FT                   LLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGLRA"
FT   gene            429701..431089
FT                   /gene="gabD"
FT                   /locus_tag="BSUW23_02020"
FT   CDS_pept        429701..431089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BSUW23_02020"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36462"
FT                   /db_xref="GOA:E0U301"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E0U301"
FT                   /protein_id="ADM36462.1"
FT                   /translation="MPDQLTVYNPATGEEIKTIPQQSAKEVEEAIERSHQAFKTWSKTS
FT                   ANERASLLKKWYELIVEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVY
FT                   GRTVPAPTTGKRIVVTRQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTP
FT                   LSAYELARLAYEAGIPKDVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNS
FT                   ADTVKHVSMELGGHAPLIVDEDANIDLAVEQAMVSKYRNAGQTCVCANRLIVHESIKDE
FT                   FAAKLSEQVSKLKVGNGLEEGVNVGPIINKRGFEKIVSQIDDAVEKGAKVLAGGTYDRN
FT                   DDKGCYFVNPTVLADVDTSMNIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFF
FT                   TENYRRGIYISENLEYGIIGWNDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYM
FT                   SIGL"
FT   gene            431215..432078
FT                   /gene="glcU"
FT                   /locus_tag="BSUW23_02025"
FT   CDS_pept        431215..432078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcU"
FT                   /locus_tag="BSUW23_02025"
FT                   /product="glucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36463"
FT                   /db_xref="GOA:E0U302"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:E0U302"
FT                   /protein_id="ADM36463.1"
FT                   /translation="MDLFLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVI
FT                   YLFVQPALSMRIFIVGIVSGLFWSLGQSNQLKSIQLMGVSKTMPISTGMQLVSTSLFGV
FT                   IVFREWSTPISITLGILALIFIIVGIVLTSLEDKKGKKEGEPSNLKKGILILLVSTLGY
FT                   LIYVVVARLFNVSGWSALLPQAIGMVIGGVILTYKHKPFNKYAIRNILPGLIWAGGNMF
FT                   LFISQPKVGVATSFSLSQMGIVISTLGGIFILREKKSKRQLIAIAIGIALIIAAAVFLG
FT                   IAKTNS"
FT   gene            432097..432882
FT                   /gene="gdh"
FT                   /locus_tag="BSUW23_02030"
FT   CDS_pept        432097..432882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="BSUW23_02030"
FT                   /product="glucose-1-dehydrogenase"
FT                   /EC_number="1.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36464"
FT                   /db_xref="GOA:E0U303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U303"
FT                   /protein_id="ADM36464.1"
FT                   /translation="MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP
FT                   NEVKEEVIKAGGEAVVVQGDVTKEEDVKNIVQTAINEFGTLDIMINNAGLENPVPSHEM
FT                   PLKDWDKVISTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKG
FT                   GIKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPKQRADVESMIPMGYIGEPE
FT                   EIAAVAAWLASKEASYVTGITLFADGGMTQYPSFQAGRG"
FT   gene            complement(432925..433542)
FT                   /gene="ycnI"
FT                   /locus_tag="BSUW23_02035"
FT   CDS_pept        complement(432925..433542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnI"
FT                   /locus_tag="BSUW23_02035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36465"
FT                   /db_xref="GOA:E0U304"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:E0U304"
FT                   /protein_id="ADM36465.1"
FT                   /translation="MKKIAFTLCPAIVGSLLFFTAPASAHVTVKPAESATGSWETYTMK
FT                   VPSEKNQPTTKIVLKMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATGGGIQEGQF
FT                   QQFTFVAKNPDKAEEAAWDAYQYYKDGSIVEWTGDEDADTPHAITKITTSKEVTDEHGA
FT                   TQTKDDSASADSGSSALDIAAIVLSAAAIILSVAALVKKKRA"
FT   gene            complement(433559..435184)
FT                   /gene="ycnJ"
FT                   /locus_tag="BSUW23_02040"
FT   CDS_pept        complement(433559..435184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnJ"
FT                   /locus_tag="BSUW23_02040"
FT                   /product="copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36466"
FT                   /db_xref="GOA:E0U305"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:E0U305"
FT                   /protein_id="ADM36466.1"
FT                   /translation="MKRNRWWIILLLFLVFLPKTSFAHAYIVKSSPGENSELKSAPSQV
FT                   EIEFNEPVEEGFHYIKVYNSNGDRVDTDKTELKKDNNHIMTVKLKKNLPHDVYRAEWNA
FT                   VSADGHPVSGVIPFSIGKADGGFSSQKAAGSALNPATAADRAILYTALSLFIGTVFFHL
FT                   FWYKGDSEQLAKRTRRILIVSITALGLALLLQLPIQTKANAGGGWGSAFQPGYIRETLF
FT                   DTAGGTIWIIQAVLYVLLALSAIPVIRKNRFSSFGYWTAPLIFFFGLLLAKAFTGHAAV
FT                   VEEKAVGILMDFLHLSSASIWVGGIAALVLLLAKEWRQPDKTLAWETVSRFSPWALTAV
FT                   GVILFSGLLNGFFIIRSMDSLFQTAYGRALLVKSGLFVLMLVLGALHFLLTRKQRRTGI
FT                   SRTLKAEWAIGIAVLITAAVFTSLPSPPEPVPEPFFQTKAIENGQSVSLSISPNQPGKN
FT                   QFELRVTDHNGEPVKNIQQITLTIYKTGLSGSENKSTFQLKEKTKGVFQDENLSINEKG
FT                   NWKIKVHGLTGDFNEINIMFTKTN"
FT   gene            complement(435219..435791)
FT                   /gene="ycnK"
FT                   /locus_tag="BSUW23_02045"
FT   CDS_pept        complement(435219..435791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnK"
FT                   /locus_tag="BSUW23_02045"
FT                   /product="putative transcriptional regulator (DeoR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36467"
FT                   /db_xref="GOA:E0U306"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U306"
FT                   /protein_id="ADM36467.1"
FT                   /translation="MLPINRQQHILTWLKEEGALRISDISARFGVSEMTVYRDVNQLVQ
FT                   SNQVIKTAGGITLPARTPQADHMCSYCLKPVNQTHSVQLITVNQDIEQLCCAHCAFLRY
FT                   ADKTEEVSHLICRDFLLHTTVSAGSAYFVVNAELNLHCCQPQAIPFATLDHAERFQKGF
FT                   GGAVRTFDQALEDMLQDRKKRCTCTKK"
FT   gene            435956..436309
FT                   /gene="ycnL"
FT                   /locus_tag="BSUW23_02050"
FT   CDS_pept        435956..436309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnL"
FT                   /locus_tag="BSUW23_02050"
FT                   /product="putative reductase or disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36468"
FT                   /db_xref="GOA:E0U307"
FT                   /db_xref="UniProtKB/TrEMBL:E0U307"
FT                   /protein_id="ADM36468.1"
FT                   /translation="MKETRCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLHEYKVSAPI
FT                   MLVSLAVIVLLIYLLLLLRNAAGTMLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQ
FT                   NGNIIYRGKRKGS"
FT   gene            436482..437918
FT                   /gene="mtlA"
FT                   /locus_tag="BSUW23_02055"
FT   CDS_pept        436482..437918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="BSUW23_02055"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IICB component"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36469"
FT                   /db_xref="GOA:E0U308"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E0U308"
FT                   /protein_id="ADM36469.1"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFEMLINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFVEPAKVLFLNNAINHGILSPIGIEQAAQTGKSILFL
FT                   VEANPGPGLGILLAYMVFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPALILAAIA
FT                   GGASGLLTFTIFNAGLVAASSPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQTKAEEASELSPESVNKIIFACDAG
FT                   MGSSAMGASILRNKVKKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHI
FT                   SVDNFLNSPKYDELIENLKK"
FT   gene            437943..438374
FT                   /gene="mtlF"
FT                   /locus_tag="BSUW23_02060"
FT   CDS_pept        437943..438374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="BSUW23_02060"
FT                   /product="Mannitol-specific phosphotransferase enzyme IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36470"
FT                   /db_xref="GOA:E0U309"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E0U309"
FT                   /protein_id="ADM36470.1"
FT                   /translation="MQVLAKENIKLNQTASSKEEAIKMAGQTLIDNGYVTEDYIGKMFE
FT                   REETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPDGVEYGEGNTVKVVFGIAGKNN
FT                   EHLDILSNIAIICSEEENIERLISAKSEEDLIAIFNEVN"
FT   gene            438376..439497
FT                   /gene="mtlD"
FT                   /locus_tag="BSUW23_02065"
FT   CDS_pept        438376..439497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="BSUW23_02065"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36471"
FT                   /db_xref="GOA:E0U310"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U310"
FT                   /protein_id="ADM36471.1"
FT                   /translation="MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNDTMVSLLNEKKE
FT                   YTVELAEEGHSSEVIGPVSAINSGRQLEELYRLINEAALITTAVGPNVLKLIAPSIAEG
FT                   LRRRDASNTLNIIACENMIGGSSFLKKEIYSHLTEAEQESVSETVGFPNSAVDRIVPIQ
FT                   HHEDPLKVSVEPFFEWVIDESGFKGKTPAINGALFVDDLTPYIERKLFTVNTGHAVTAY
FT                   VGYQRGLKTVKEAIDHPEIRRVVHSALLETGDYLIKTYGFKQAEHDQYIKKIIGRFENP
FT                   FITDDVTRVARSPLRKLGENDRLVGPAKKIKEPNALAEGIAAALRFDFTGDPEAVELQA
FT                   LIEEKGYSGVLQKVCGIHSHEPLHAIVLKKLNQ"
FT   gene            439594..440652
FT                   /gene="ycsA"
FT                   /locus_tag="BSUW23_02070"
FT   CDS_pept        439594..440652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsA"
FT                   /locus_tag="BSUW23_02070"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36472"
FT                   /db_xref="GOA:E0U311"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E0U311"
FT                   /protein_id="ADM36472.1"
FT                   /translation="MKQFEIAAIPGDGVGKEVVAAAEKVLHTAAEVHGSLSFSFTSFPW
FT                   SCDYYMEHGEMMPEDGIHTLTQFEAVFLGAVGNPKLVPDHISLWGLLLKIRRELELSIN
FT                   MRPAKQMAGITSPLLHPNDFDLMVIRENSEGEYSEVGGRIHRGDDEIAIQNAVFTRKAT
FT                   EHVMRFAFELAKKRRGHVTSATKSNGIYHAMPFWDEVFQQTAADYSEIETSSQHIDALA
FT                   AFFVTRPETFDVIVASNLFGDILTDISSSLMGSIGIAPSANINPYGKYPSMFEPVHGSA
FT                   PDIAGQGLANPIGQIWTAKLMLDHFGEEELGAKILDVMEQVTADGIKTRDIGGQSTTAE
FT                   VTDEICARLRKL"
FT   gene            440786..441349
FT                   /gene="sipU"
FT                   /locus_tag="BSUW23_02075"
FT   CDS_pept        440786..441349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipU"
FT                   /locus_tag="BSUW23_02075"
FT                   /product="type I signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36473"
FT                   /db_xref="GOA:E0U312"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E0U312"
FT                   /protein_id="ADM36473.1"
FT                   /translation="MNAKTITLKKKIKTKWIVVLSIIFIAALIFTIRMVFYKPFLVEGS
FT                   SMAPTLKDSERILVDKAAKYTGGFHRGDIIVIHDKMSGRSFVKRLIGLPGDSIKMKDDQ
FT                   LYINGKKVEEPYLLEQKQEVEELGVTLTGDFEVEVPSGKYFVMGDNRLNSLDSRNGMGM
FT                   PSDEDIIGTESLVFYPFGEMRQAK"
FT   gene            complement(441435..442043)
FT                   /gene="yczH"
FT                   /locus_tag="BSUW23_02080"
FT   CDS_pept        complement(441435..442043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczH"
FT                   /locus_tag="BSUW23_02080"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36474"
FT                   /db_xref="GOA:E0U313"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U313"
FT                   /protein_id="ADM36474.1"
FT                   /translation="MLQKPLVILAHEIYGVNSHMKKMAKLIKMAGYDVITPNLLGDGEV
FT                   YSLQEENTAYEQFTKHKRLKTGETIIQNVIRQNAGRQIFVIGFSAGATIAWKCSSMPEV
FT                   SGAVCYYGSRIRDSLHHVPVCPVLLFFPSYEPSFDVAVLIKKLREQQHPNLEIYQFDAL
FT                   HGFANPESVYFDRPLFFKTLSIIKNEAEKPPRSVLSKFS"
FT   gene            442128..442520
FT                   /gene="ycsD"
FT                   /locus_tag="BSUW23_02085"
FT   CDS_pept        442128..442520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsD"
FT                   /locus_tag="BSUW23_02085"
FT                   /product="putative hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36475"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0U314"
FT                   /protein_id="ADM36475.1"
FT                   /translation="MNSLSLPHRYPFLFIDGVKESEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEALAQTAAFTGITDENSLGLLSSVKKAEKLGAAMPGDRLDLTFEVTRNRRG
FT                   FVFGHAKASVGGQPVAEAEIGIYIEK"
FT   gene            complement(442555..442719)
FT                   /gene="yczO"
FT                   /locus_tag="BSUW23_02090"
FT   CDS_pept        complement(442555..442719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczO"
FT                   /locus_tag="BSUW23_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36476"
FT                   /db_xref="UniProtKB/TrEMBL:E0U315"
FT                   /protein_id="ADM36476.1"
FT                   /translation="MAERKQQNRPNENPEHNDLTDPIPNEELKENMNDEKHKRQQRDDS
FT                   QSERDYDTK"
FT   gene            442852..443601
FT                   /gene="ycsE"
FT                   /locus_tag="BSUW23_02095"
FT   CDS_pept        442852..443601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsE"
FT                   /locus_tag="BSUW23_02095"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36477"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0U316"
FT                   /protein_id="ADM36477.1"
FT                   /translation="MSIQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKNKELEITNS
FT                   SPTNIEVNALGINKAAALAKVSEKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   TVKETADWITDTNIEDGVAKAIRHWVL"
FT   gene            443806..444579
FT                   /gene="ycsF"
FT                   /locus_tag="BSUW23_02100"
FT   CDS_pept        443806..444579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsF"
FT                   /locus_tag="BSUW23_02100"
FT                   /product="putative nitrogen-containing heterocycle
FT                   degradation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36478"
FT                   /db_xref="GOA:E0U317"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E0U317"
FT                   /protein_id="ADM36478.1"
FT                   /translation="MFQVDLNCDLGESFGAYTIGLDQDILEYVTSANIACGFHAGDPSV
FT                   MRKTVALAAEKGVKIGAHPGLPDLLGFGRRNMAISPEEAYDLVVYQIGALSGFLKAEGL
FT                   HMQHVKPHGALYNMAAVNQKLSDAIAKAVYKVDPALVLFGLAESELVKAGERIGLQTAN
FT                   EVFADRTYQADGTLTPRSQPDALIESDDAAVTQVIKMVKEGAVTSQQGHDVTLKADTVC
FT                   IHGDGAHALTFAQKIRKELNAAGIEVTAISAQKST"
FT   gene            444594..445808
FT                   /gene="ycsG"
FT                   /locus_tag="BSUW23_02105"
FT   CDS_pept        444594..445808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsG"
FT                   /locus_tag="BSUW23_02105"
FT                   /product="putative branched chain amino acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36479"
FT                   /db_xref="GOA:E0U318"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E0U318"
FT                   /protein_id="ADM36479.1"
FT                   /translation="MEQQKNTAGKKAGSWSLLMGAAFLMATSAIGPGFLTQTATFTNTL
FT                   AASFGFVILISIILDIFAQTNVWRIIAVSGKRGQEIANMVLPGLGYFIAILVVLGGLAF
FT                   NIGNIGGAGLGLQVLFGITPETGALISAVVAILIFLIKEAGKAMDRFTQIAGFAMIILT
FT                   LFVAITSAPPVGQAAANTFAPEQISIFAIVTLVGGTVGGYITFAGGHRLLDAGIKGKEA
FT                   IPQVTKSSVAGILITSVMRIALFLAVLGVVSKGLHIDESNPAASVFQLAAGNVGYKIFG
FT                   LIMWSAAITSVIGAAYTSVSFFKTFSPKIERNSRGIIIGFIVISTLAFVTIGQPAKILV
FT                   LVGSLNGLILPIALGTLLIAAYKKKIIGDYKHPLWLTVSGALVVIVMAIMGVYTLFTQL
FT                   PQLWS"
FT   gene            445814..446605
FT                   /gene="ycsI"
FT                   /locus_tag="BSUW23_02110"
FT   CDS_pept        445814..446605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsI"
FT                   /locus_tag="BSUW23_02110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36480"
FT                   /db_xref="GOA:E0U319"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:E0U319"
FT                   /protein_id="ADM36480.1"
FT                   /translation="MEQLNKMAPNDVRALIREGKITGPTAGMSGGYAQANLVILKKDLA
FT                   FDFLLFCQRNQKPCPVLDVTEAGSPVPSLVAPDADIRTDFPKYRIYRQGILTEEVSDIT
FT                   PYWEDDFVGFLIGCSFSFEQALINNGIAVRHIDEGTNVPMYQTNIACVPAGAFQGQMVV
FT                   SMRPVPERLAVRAAQVTSRFLAVHGGPIHIGNPGAIGIRDLDKPDFGDAVSIREGEVPV
FT                   FWACGVTPQAVAMNVKPEMVITHAPGHMLITDIRDESLAVL"
FT   gene            446651..447373
FT                   /gene="kipI"
FT                   /locus_tag="BSUW23_02115"
FT   CDS_pept        446651..447373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipI"
FT                   /locus_tag="BSUW23_02115"
FT                   /product="putative inhibitor of the autophosphorylation
FT                   reaction of KinA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36481"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E0U320"
FT                   /protein_id="ADM36481.1"
FT                   /translation="MTEQFQIELLGDSAMMIRFGEEINEQVNGLVHAAAAYIEEQPFPG
FT                   FIECIPAFTSLTVFYDMYEVYKHLPQGISSPFEKVKRDVEGRLKEIAIDYENNRRIVEI
FT                   PVCYGGEFGPDLEEVAKINQLSTEEVIDIHTSGEYVVYMLGFAPGFPFLGGMSKRIAAP
FT                   RKSSPRPSIPAGSVGIAGMQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIV
FT                   KFVRISEDDYHAYKEESN"
FT   gene            447370..448383
FT                   /gene="kipA"
FT                   /locus_tag="BSUW23_02120"
FT   CDS_pept        447370..448383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipA"
FT                   /locus_tag="BSUW23_02120"
FT                   /product="putative hydrolase subunit antagonist of KipI"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36482"
FT                   /db_xref="GOA:E0U321"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E0U321"
FT                   /protein_id="ADM36482.1"
FT                   /translation="MSMKVLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLI
FT                   GNSENEAGLEITLMGPGPSFYVSKTTLIAVTGADFTLRINDEEAPLWKPVLVKENSTVS
FT                   FGPCKLGSRAYLATAGGFDVPAVMESKSTYVRAGIGGLHGRALQKEDELSIGETSSLSK
FT                   AIISQLSPQLGKQGFAAPKWSVSRGRFLPLKKNPVIRVLEGKQFGFFTEESKTRFYEET
FT                   FRVTPQSDRMGYRLKGEPLELKAPLEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYP
FT                   RIAHIISADLPIVSQIMPGEHVQFEPVSLQEAEALAIEREQHIKELKTRMKMEWLT"
FT   gene            448399..449151
FT                   /gene="kipR"
FT                   /locus_tag="BSUW23_02125"
FT   CDS_pept        448399..449151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipR"
FT                   /locus_tag="BSUW23_02125"
FT                   /product="IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36483"
FT                   /db_xref="GOA:E0U322"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U322"
FT                   /protein_id="ADM36483.1"
FT                   /translation="MQNKNKTVVKSMDLLNLFLHEPSLTLSELVSLSGMPKTSVHRMIS
FT                   SLEEMGFLNRDSSGAYSLGLVFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIMR
FT                   DGNEAIYVEKIEGTQTVRLYTAIGRRSPLYAGACARSILSFLPREEIETYIKQTELISI
FT                   GSGTITDPEKLLQEIDASVQNGYTVSYSELENYTAAIGAPIFNHKRQVAAGISIAGFEA
FT                   RFTEDRLPYLTEKVKDAALQISRKIGYS"
FT   gene            449215..449856
FT                   /gene="lipC"
FT                   /locus_tag="BSUW23_02130"
FT   CDS_pept        449215..449856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="BSUW23_02130"
FT                   /product="lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36484"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E0U323"
FT                   /protein_id="ADM36484.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLLSPGFVHRFGDMMEADLKTKTAISI
FT                   FAKSGLNTEEILGLLSYPYVQKCIQDADVVTITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKIAEIKGENPSPYAIRVFNLYNPFPGIEIAGKWITSFNSHLETLASA
FT                   PYVKIADAYSIFKGNEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
FT   gene            450030..450275
FT                   /gene="yczI"
FT                   /locus_tag="BSUW23_02135"
FT   CDS_pept        450030..450275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczI"
FT                   /locus_tag="BSUW23_02135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36485"
FT                   /db_xref="GOA:E0U324"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="UniProtKB/TrEMBL:E0U324"
FT                   /protein_id="ADM36485.1"
FT                   /translation="MFRIFKMSFAVIIIALALIAFKYTEHTSVIQSVMLVFLGAVMFMQ
FT                   GLEERKKENDGSGAFNIYTAVFVWSVSLIGFTLHII"
FT   gene            complement(450281..450568)
FT                   /gene="yczJ"
FT                   /locus_tag="BSUW23_02140"
FT   CDS_pept        complement(450281..450568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczJ"
FT                   /locus_tag="BSUW23_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36486"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E0U325"
FT                   /protein_id="ADM36486.1"
FT                   /translation="MVREAAMLHIKEGLEQEFEEAFRQAAPIIAGMKGYITHSLSKCME
FT                   ETHKYLLLVEWETLEDHTEGFRGSSEYQEWKALLHRFYTPFPTVEHFQDV"
FT   gene            450810..452726
FT                   /gene="pbpC"
FT                   /locus_tag="BSUW23_02145"
FT   CDS_pept        450810..452726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="BSUW23_02145"
FT                   /product="penicillin-binding lipoprotein 3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36487"
FT                   /db_xref="GOA:E0U326"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E0U326"
FT                   /protein_id="ADM36487.1"
FT                   /translation="MEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKTIYEQAG
FT                   AKNLKVTAGEVDEDDKDNKAMKHIPYKVSMDTNAGKVSFKNTAVLKLEKTDDEESWNID
FT                   WDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAINTDVPEIGVVPGELGDKKEKV
FT                   IKELAKKLDLTEDDIKKKLDQGWVKDDSFVPVKKVKPDQQKLVSEATSLKGVTRTNVSS
FT                   RYYPYGEKTAHLTGYVRAITAEELKKKKDGTYSDTSNIGIAGLENVYEDKLRGTTGWKI
FT                   YVPQTGEVIAEKKAKDGEDLHLTIDINTQTKLYDELKDDSGTAVALQPKTGETLALVSA
FT                   PSYDPNGFIFGWSDKEWKKLNEDKNNPFSAKFNKTYAPGSTIKPIAAAIGIKNGTLKAD
FT                   EKKTIKGKEWQKDSSWGGYSVTRVSESLQQVDLENALITSDNIYFAQNALDMGADTFTK
FT                   GLKTFGFSEDIPYEFPIQQSSIANGKLDSDILLADTGYGQGQMQMSPLHLAAAYTPFVD
FT                   NGDLVKPTLIKKDSQTAGVWHKQVVTKEGAADITKGLKGVVEDERGSAYQPVVKGITVA
FT                   GKTGTAELKTSKDDKDGAENGWFVGYDYKNKDLLVAMMIQNVQDRGGSHYVVEKAKKQF
FT                   QSN"
FT   gene            452827..453729
FT                   /gene="ycsN"
FT                   /locus_tag="BSUW23_02150"
FT   CDS_pept        452827..453729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsN"
FT                   /locus_tag="BSUW23_02150"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36488"
FT                   /db_xref="GOA:E0U327"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0U327"
FT                   /protein_id="ADM36488.1"
FT                   /translation="MQRIQLAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEWCIDHGIT
FT                   TFDHADIYGGYTCEKLFGNALALSPGLRENIELVTKCGIVLESPERPAHRSHHYNTSKS
FT                   HILASVEQSLLNLRTDYIDVLLIHRPDPLMDPEGVAEAFQALKCSGKVRHFGVSNFKDH
FT                   QYRMLESYLPEKLVTNQIELSAYELENVLDGTLNLCQEKRISPMAWSPLAGGKVFTGDT
FT                   EKDRRVRSALESVQTEIGAASLDEVMYAWLFTHSAGIMPIVGSGKRERISAAVNALAYK
FT                   LDHDQWFRIFTAVQGYDIP"
FT   gene            453918..456002
FT                   /gene="mtlR"
FT                   /locus_tag="BSUW23_02155"
FT   CDS_pept        453918..456002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="BSUW23_02155"
FT                   /product="transcriptional regulator MtlR"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36489"
FT                   /db_xref="GOA:E0U328"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:E0U328"
FT                   /protein_id="ADM36489.1"
FT                   /translation="MYMTAREQKLLKHLLLQNRYITVTELAELMEVSTRTIHRELKSIK
FT                   PLMETVGLTLDKQPGKGLKAVGSPEDKQKLLTDLSYEQHEYSADERKLLILCSLLESQE
FT                   PVKLYTLAHDLQVTNATVSYDLDELEKWISPFGLTLIRKRGFGIQLIGPENAKRKIVGN
FT                   LIVNRLDIQMFLEAVELNIKGKADSSEKMFGVVSKGELLKMERILFQLKEEIAFSLSDS
FT                   SYIALVVHLTFAIERIKLGETITMEQNELEELKNAKEYSSALEIAGELERAFGVTIPEA
FT                   EVGYITIHLRSANRKYKTEYKAQEIELETALQTKRLIAFISDKIRMDLTKNYSLYEGLI
FT                   AHLEPAVSRIKENIEIYNPMKEQIKRDYFLLYMAIEEGVEKYFPGMSFSDDEIAFIVLH
FT                   FGSALEIKKEEAKVKALVVCSSGIGSSKMLASRLKKELPEIQSFDMSSLIELKGKDVQA
FT                   YDMIVSTVPIPYENIDYIMVSPLLNEEDANQVKQYIKRKIPLILEKNRSPKEEVQQVDV
FT                   PDMLKAAESMGRYMAVIQDVLRHFTLTHLKTNLDHSLLLLELFQQLKKDGLIRDPKKAA
FT                   VCLAEREKQGGLGIPGTNMALYHLKNDEIVLPFFKMYDLGTSYEVNGMDGNTLSMTRIL
FT                   VMMAPGSLSAEGSEILSAISSAIIESRESMAGFQEEGEQELYQRLNRIFFTWMKEKNIL
FT                   "
FT   gene            456214..457725
FT                   /gene="ydaB"
FT                   /locus_tag="BSUW23_02160"
FT   CDS_pept        456214..457725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /locus_tag="BSUW23_02160"
FT                   /product="putative acyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36490"
FT                   /db_xref="GOA:E0U329"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E0U329"
FT                   /protein_id="ADM36490.1"
FT                   /translation="METLQHLILHDMPDSEEIEAVKSGAHTLTYKSYRKRINQLANALL
FT                   QKGIQKGDRIALLCKNGHPASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF
FT                   YGAEFKETLDEVLPELSTLRITMETGTAYETSAEFEALFAGPDHLPETEMVSPDDTALL
FT                   MFTSGTTGNPKRCMITHGGIYRYVTRSNSSTTRMKSLRFLACHPIYHTSALICIMLGTF
FT                   AGTTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWETHQTDLSSLVILMTGG
FT                   TKVPSSLIRRYLDIGIPLAHGYGSTEAWGISTWMPDMGMDKAASAGKPVAGVKVKVVDP
FT                   QTGEELPQGEIGEIVVHTPFLFKGYEDNPEATAKVLQNGWFKTGDSGYVDEDGFIFITG
FT                   RYKDVIIYGGDNVYPDQVEEVIQQIPGILETAVVGIPDPLYGEKPRAFIVKNGAQRLTE
FT                   EDVIAFCQERLSAYKIPEVEFVNELPKNNLGKVKKDVLRKQAVHS"
FT   gene            complement(457743..458339)
FT                   /gene="ydaC"
FT                   /locus_tag="BSUW23_02165"
FT   CDS_pept        complement(457743..458339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaC"
FT                   /locus_tag="BSUW23_02165"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36491"
FT                   /db_xref="GOA:E0U330"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E0U330"
FT                   /protein_id="ADM36491.1"
FT                   /translation="MINMLSKKFSKPKGVFGMIAGYIMAAENKTLNQWTIDQLGITRGD
FT                   SILEVGFGPGYCMQQMLKRERDIHLHGIDVSEAMLKLAARRVKSKEVRLIQGSVESFPL
FT                   TASFYDKVISVNNYTIWNDQKKGMKQIYQALKPGGKAAITMQPREADASPEKTKSFGKQ
FT                   MIADFKAAGFEDIELQFKNIKPELSVCTTAKKPAT"
FT   gene            458490..459350
FT                   /gene="ydaD"
FT                   /locus_tag="BSUW23_02170"
FT   CDS_pept        458490..459350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /locus_tag="BSUW23_02170"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36492"
FT                   /db_xref="GOA:E0U331"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U331"
FT                   /protein_id="ADM36492.1"
FT                   /translation="MANYPKELPAQTQNRQPGIESEMNPSPVYEYEDYKGADKLKGKVA
FT                   LITGGDSGIGRAVSVAYAKEGADIAIVYKDEHGDAEETKKRVEQEGVKCLLIAGDVGEE
FT                   EFCNEAVEKTVKELGGLDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKA
FT                   IDYLKPGSAIINTTSINPYRGNPMLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPG
FT                   PIWTPLIPSTFSEDTVAQFGQNTPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHVNGG
FT                   DFVTT"
FT   gene            459365..459868
FT                   /gene="ydaE"
FT                   /locus_tag="BSUW23_02175"
FT   CDS_pept        459365..459868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaE"
FT                   /locus_tag="BSUW23_02175"
FT                   /product="YdaE"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36493"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E0U332"
FT                   /protein_id="ADM36493.1"
FT                   /translation="MSITKEEVNSYYQKAGIVLTDDEVEQIQLMDYGLGKERKVGLQLF
FT                   VYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTQLPK
FT                   VLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFT
FT                   DPRI"
FT   gene            459957..460508
FT                   /gene="ydaF"
FT                   /locus_tag="BSUW23_02180"
FT   CDS_pept        459957..460508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="BSUW23_02180"
FT                   /product="putative ribosomal protein N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36494"
FT                   /db_xref="GOA:E0U333"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0U333"
FT                   /protein_id="ADM36494.1"
FT                   /translation="MFTCKVNEHITIRLLEPKDAERLAELIIENQQRLGQWLFWAEHPS
FT                   SAETYRETIIPDWRREYADLSSIEAGLLYDGILCGMIGLHHLDQINRKAEIGYWIAKEF
FT                   EGKGIVTAACRTLIMYAFEELGLNRVALCAAVGNQKSRAVPERLGFQEEGKARDGLFVN
FT                   GRYHDLVYYSLLKREWKGLK"
FT   gene            460586..461008
FT                   /gene="ydaG"
FT                   /locus_tag="BSUW23_02185"
FT   CDS_pept        460586..461008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="BSUW23_02185"
FT                   /product="putative general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36495"
FT                   /db_xref="GOA:E0U334"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:E0U334"
FT                   /protein_id="ADM36495.1"
FT                   /translation="MNQQDIKQKVLDVLDRHKVGSLATVQKGKPHSRYMTFFHDGLTIY
FT                   TPTSKDTHKAEEIENNPNVHILLGYDCEGFGDAYVEVEGKAKINNSAELKDKIWSSKLE
FT                   RWFDGKDDPNLVILEIEPEDIRLMNAGEKTPVSLEL"
FT   gene            461514..462323
FT                   /gene="ydaH"
FT                   /locus_tag="BSUW23_02190"
FT   CDS_pept        461514..462323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaH"
FT                   /locus_tag="BSUW23_02190"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36496"
FT                   /db_xref="GOA:E0U335"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:E0U335"
FT                   /protein_id="ADM36496.1"
FT                   /translation="MHVMTTQVLFIFCFLLLIHSIETLAYATRLSGARVGFIASALSLF
FT                   NVMVIVSRMSNMVQQPFTGHLIDDAGKNALAIVGEQFRFLIFGSTVGTILGIILLPSFV
FT                   ALFSRAIIHLASGGGSVFQVFRKGFSKQGFKNALSYLRLPSLSYVKGFHIRLIPKRLFV
FT                   INMLITSIYTIGVLSALYAGLLAPERSTTAVMASGLINGIATMLLAIFVDPKVSVLADD
FT                   VAKGKRSYTYLKWTSVTMVTSRVAGTLLAQLMFIPGAYYIAWLTKWF"
FT   gene            complement(462368..462658)
FT                   /gene="ydzA"
FT                   /locus_tag="BSUW23_02195"
FT   CDS_pept        complement(462368..462658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzA"
FT                   /locus_tag="BSUW23_02195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36497"
FT                   /db_xref="GOA:E0U336"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:E0U336"
FT                   /protein_id="ADM36497.1"
FT                   /translation="MLQTPIGKLRTMGFIEGMSLLILLFIAMPLKYWAGLPLAVTIIGS
FT                   VHGGLFILYLLVLAYATFSIKWSLKWSAAGFIAAFVPFGNFLYDRGLRKYK"
FT   gene            462844..463278
FT                   /gene="lrpC"
FT                   /locus_tag="BSUW23_02200"
FT   CDS_pept        462844..463278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrpC"
FT                   /locus_tag="BSUW23_02200"
FT                   /product="transcriptional regulator (Lrp/AsnC family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36498"
FT                   /db_xref="GOA:E0U337"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U337"
FT                   /protein_id="ADM36498.1"
FT                   /translation="MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLES
FT                   FGIIKQYTLEVDQKKLGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYM
FT                   LKINAESLEAVEEFINKTSPYAQTVTHVIFSEIDTKNGRS"
FT   gene            463343..465529
FT                   /gene="topB"
FT                   /locus_tag="BSUW23_02205"
FT   CDS_pept        463343..465529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BSUW23_02205"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36499"
FT                   /db_xref="GOA:E0U338"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:E0U338"
FT                   /protein_id="ADM36499.1"
FT                   /translation="MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHL
FT                   VTLADPEGYGKEFQSWRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIAT
FT                   DAGREGELVARWIIEKANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVAR
FT                   AEADWIVGINATRALTTKFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVD
FT                   GMTLTWQDKKSKQTRTFNQDVTSRLLKDLEGKQAVIAELKKTAKKSFAPALYDLTELQR
FT                   DAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQ
FT                   YVSQIKKRGIKSHKGYVNDAKVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVL
FT                   MPAFEYEETKVIAEIGGETFTAKGKTVQSQGWKAVYDMADDDEEQEDDRDQTLPALQKG
FT                   DALTVSMLTETSGQTKPPARFNEGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVAT
FT                   RADIIEKLFNSFLIEKKDKDIFITSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKL
FT                   KSSVFIKDMKAYANQTVKEIKNSSQTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQD
FT                   RECGSRKTIARKTNARCPNCHKKMELRGQGEGQTFACVCGHREKLSVFEKRKNKDKGRA
FT                   SKRDVSSYMKKQNNKDEPINNALAEQLKKLGLDK"
FT   gene            465732..466820
FT                   /gene="ydaJ"
FT                   /locus_tag="BSUW23_02210"
FT   CDS_pept        465732..466820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaJ"
FT                   /locus_tag="BSUW23_02210"
FT                   /product="putative glycosyl hydrolase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36500"
FT                   /db_xref="GOA:E0U339"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E0U339"
FT                   /protein_id="ADM36500.1"
FT                   /translation="MRHVLFAVILFFLSIGLSAGCAEAGNKTQNQSAAEMNASPLQPAE
FT                   YFIYHNLMNDQGFIKTDFSDQPSYLSESLGLWMEFLISKNDAPHFEEQYQHLTNSFLMS
FT                   NHLVTWKIQNGQASGTNALIDDMRIMLSLDQAAVKWGRSDYAQTARDIGAALKTYNMNN
FT                   GLFTDFYDSQAASKDVTLSYVMPDALAVLKKNGIIDEETEQRNANVLYSAPLQNGFMPK
FT                   TYSSDTKEYTYDSEINLIDQLYAAWHLPEGDENAAVLADWIKQEFQTNGKLYGRYSADT
FT                   KEPAVQYESPSVYALAVLFLTKQHEDTSVIKAIYDRMNDFEILDPVKTYYGGYMSGTQT
FT                   HSFDNLLPLLAERKLFNETIIQ"
FT   gene            466801..467637
FT                   /gene="ydaK"
FT                   /locus_tag="BSUW23_02215"
FT   CDS_pept        466801..467637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaK"
FT                   /locus_tag="BSUW23_02215"
FT                   /product="putative membrane protein with diguanylate
FT                   cyclase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36501"
FT                   /db_xref="GOA:E0U340"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0U340"
FT                   /protein_id="ADM36501.1"
FT                   /translation="MKLSFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFV
FT                   VIAAGIWFGPIYALAVTLIVLFVLGTLMMFFQTGQAEEGLRMLVVWGIALLLFSFISGR
FT                   IHDIAAELRRSVTRLQSEIKSFVAVDRVTGFDNKQRMKLELSEEIKRAERYGNSFVFLL
FT                   LHMHYFKEFKSLYGEKETDRLFQYVSQQIRSSVRETDKKFRPSDERIGIVLTHTPAEHI
FT                   PAVLTKLKKQLDTYQLENGKYVSLTFHVCYLPYRKDIQTADQFLEELENEMMMNEL"
FT   gene            467627..469357
FT                   /gene="ydaL"
FT                   /locus_tag="BSUW23_02220"
FT   CDS_pept        467627..469357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaL"
FT                   /locus_tag="BSUW23_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36502"
FT                   /db_xref="GOA:E0U341"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:E0U341"
FT                   /protein_id="ADM36502.1"
FT                   /translation="MNYKGITLLCVTMLLLSAITTFPVSAQAKEQDVGILIIYSTLDGK
FT                   ESSQVKMLDLLAGHFTSHVTVKKDLDVKESDFKGKDHVIYYGQTKRKLSKKLVSLISNV
FT                   KKPVVAIGYNAGQISQFSGLSLARKENVYQIHSRSEKADVSLESGLNVLSVSGLKGKAL
FT                   YTFKASDGKTHAFIWKTKKDNVYIGLTNLLNDNLIVAKQLREDFGEKAGTTLLYLRLED
FT                   ISPMSDEKLLLQAGTYLHKRHVPFILAVIPVYLNPETGDKVYLSDKPKMVKVLKKLQSM
FT                   GGSIIVHGYTHAYRYSETGEGFEFWDAKADQPITSGNAEDPPSILEKEQAFSNEQAYNN
FT                   YLKPFQEKEETYTKQKLTRAIEDLTSSGLYPLAFEAPHYTMSEYGYQIASRYFTSIFGQ
FT                   VQLSSTTWKTSGAPPFVSAPSMLHGMTLYPETIGFVDTSKQNPLGDMEEHISQMIDFEG
FT                   GVAGGFYHPYLGMKYLPELVDQMERIPDSEWLDLKKTKQTVKTDKVEIHTSGDGTIQVK
FT                   NGVNAIDEFFDHHRQTPLEKALWILSAIVLLFVIMFVSYTFYLRATLKKRIFKERRSLG
FT                   "
FT   gene            469350..470612
FT                   /gene="ydaM"
FT                   /locus_tag="BSUW23_02225"
FT   CDS_pept        469350..470612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaM"
FT                   /locus_tag="BSUW23_02225"
FT                   /product="putative glycosyltransferase associated to
FT                   biofilm formation"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36503"
FT                   /db_xref="GOA:E0U342"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0U342"
FT                   /protein_id="ADM36503.1"
FT                   /translation="MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENM
FT                   KELPKVSVLIPAHNEEVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEK
FT                   YDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDE
FT                   KAGAVVGKFRVINAAKTLLTKFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSII
FT                   EKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQ
FT                   YVVLKFLAQFFKLKRKRIIFDLFYFFFTYFLFFFGVIMSNTIFVLNLFYDLHLSVGFLA
FT                   MILWILAFFLFMTEVMITLSIEKTEMNRQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKH
FT                   RLFKQEVKWYKTERYNQHKSG"
FT   gene            470618..472714
FT                   /gene="ydaN"
FT                   /locus_tag="BSUW23_02230"
FT   CDS_pept        470618..472714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaN"
FT                   /locus_tag="BSUW23_02230"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36504"
FT                   /db_xref="GOA:E0U343"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:E0U343"
FT                   /protein_id="ADM36504.1"
FT                   /translation="MKQIMIFLTSLMLMAMTGQAAFAKEVQVSGSLLGKSSQEQAKQQV
FT                   LTSDLITLYGSKDSAELTYQIPAGASSGNQQLVIEYEASNLLISPSSLTVVIDDEPVKT
FT                   LKLDGDSKRKTVKLNLNKSQSAQGYHNISLTFYGVMKEGVCVRQDTSGNWIKIYPDSRL
FT                   TLADSREAKGTSLDHYPYPFAQSGNTAEETAIVIPDDPSSAEIEAAVKTEGYLKTVDSS
FT                   VSMSYVTESELKKIDKPTIFIGVDKHWNGKVKKLMKQAGLQEKGEKLLLAERVLKAEGK
FT                   QLPVLFAQAASADVLTEKISVITDQTYTGQLSGDTLSISKLKQAEKKESNKLTLENFGA
FT                   GDITIGSDKTSSAHYFYPASAVLDQNQSAKLSLKLKKSETIQALTAENESVSQAAELKI
FT                   MINGQPHSVGLDELGKEDKNGFYHVMVKVDPKLLQKNRYIDIQFVTTGLKENNPCNTTD
FT                   EEKWVYIDKSSTLSYAIKDLSPSADFQEWPLPYAGNQEQTTLIVLPDTVSQLKFEELSL
FT                   VTESFGSEGQHSYTVKKSSDVTANDAKGRNLIFIGGTDQFPLLNEKSSDLLVPQAKNGS
FT                   FDVSGFEMLNETTKQVAFTQASLWDSRYTMAVFTPSKGTGTAVTKEIISYLNSTDDSAT
FT                   VVNETTSQQVFTNHQQLKSETNSSSAEQPSQDNSQKWLYIGVLALIMVIAAVFIWVAVR
FT                   RRKR"
FT   misc_feature    472864..472989
FT                   /note="ydaO riboswitch leader; may be triggered during
FT                   osmotic shock, leading to expression of ydaO; the natural
FT                   ligand has not been determined; BSUW23_misc_RNA_7"
FT   gene            473201..475024
FT                   /gene="ydaO"
FT                   /locus_tag="BSUW23_02235"
FT   CDS_pept        473201..475024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /locus_tag="BSUW23_02235"
FT                   /product="putative metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36505"
FT                   /db_xref="GOA:E0U344"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E0U344"
FT                   /protein_id="ADM36505.1"
FT                   /translation="MYHSIKRFLIGKPLKSQAAGEQKLTKLKALAMLSSDALSSVAYGT
FT                   EQILIILATISAAAFWYSIPIAIGVLILLLALILSYRQIIYAYPQGGGAYVVSKENLGE
FT                   KPGLIAGGSLLVDYILTVAVSISAGTDAITSAFPVLHDYHVPIAVLLVLAIMILNLRGL
FT                   SESASILAYPVYLFVMALLVLIAVGLFKLMTGQIDQPVHHTPLGTPVAGITLFLLLKAF
FT                   SSGCSALTGVEAISNAIPAFKNPPARNAARTLAMMGILLAILFSGITVLAYGYGTAPKP
FT                   DETVVSQIASETFGRNVFYYVIQGVTSLILVLAANTGFSAFPQLAFNLARDQYMPRMFT
FT                   VRGDRLGFSNGIIFLGVASIVLIVLFGGQTEHLIPLYAVGVFIPFTLSQTGMCIKWIKQ
FT                   KPKGWIGKMLINSCGALISFMVLSILFVTKFNVVWPVLIFMPIVVLLFFAIKNHYTAVG
FT                   EQLRIVDKEPEEIKGTVVIVPVAGVTTVVQKSIQYAKSLSDQVIAVHVSFDREQEKKVE
FT                   KRWEELNNGVRLVTLHSSYRSLVHPFDKFLETVEAKAKKEQFSVMVLFPQFITKKRWHT
FT                   ILHNQSAFLLRVRLFWKKDIMVATLPYHFKK"
FT   gene            475082..475531
FT                   /gene="mutT"
FT                   /locus_tag="BSUW23_02240"
FT   CDS_pept        475082..475531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="BSUW23_02240"
FT                   /product="putative NTP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36506"
FT                   /db_xref="GOA:E0U345"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E0U345"
FT                   /protein_id="ADM36506.1"
FT                   /translation="MFTQGAFVIVLNENQQILLVKRKDVPLWDLPGGRVDPEETAEEAA
FT                   VREVLEETGYSAALSAKIGVYQRPKFQDEQHVFAGHITGGQAIANGMETAGLKWFSPQR
FT                   LPLFMVPNRKRQIKDFVNGALDTTITLKDRGMVAAIDLLKRRLGK"
FT   gene            475598..477322
FT                   /gene="ydaP"
FT                   /locus_tag="BSUW23_02245"
FT   CDS_pept        475598..477322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaP"
FT                   /locus_tag="BSUW23_02245"
FT                   /product="pyruvate oxidase"
FT                   /EC_number="1.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36507"
FT                   /db_xref="GOA:E0U346"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E0U346"
FT                   /protein_id="ADM36507.1"
FT                   /translation="MAHKTAGQAMTELLEQWGVDHVYGIPGDSINEFIEDLRHERNQLK
FT                   FIQTRHEEVAALAAAAEAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQV
FT                   SSGEVGRDYFQEIKLEQMFEDVAVFNREVHSAESLPDLLNQAIRTAYSKKGVAVLSVSD
FT                   DLFAEKIKREPVHTSPVYIEGNLEPKKEQLVTCAQYINNAKKPIILAGQGMKKAKRELL
FT                   EFADKAAAPIVVTLPAKGVVPDKHPHFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYR
FT                   DYLPDDTPAIQLDSDPAKIGKRYPVTAGLVCDSALGLRELTEFIERKEDRRFLEACTEH
FT                   MQHWWNEIEKDETEAETPLRPQQVVARLQEAAADNAVLSVDVGTVTVWMARHFKMNENQ
FT                   DFIVSSWLATMGCGLPGAIASSLAEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVV
FT                   ILNNENLGMIEYEQQVKGNIDYVTKLQNVDYAAFAESCGAKGIKVTKVEELAPAFHEAL
FT                   HADQPVVVDVMIGNEPPLPGKITYGQAKGFSKYMLKNFFENQKIEMPSLKKSLKRLF"
FT   gene            477406..477534
FT                   /locus_tag="BSUW23_02250"
FT   CDS_pept        477406..477534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36508"
FT                   /db_xref="UniProtKB/TrEMBL:E0U347"
FT                   /protein_id="ADM36508.1"
FT                   /translation="MQRVVMFAMLKRTKGQMHLLSKQKDQRICPCMFHMFIFINSY"
FT   gene            complement(477553..477849)
FT                   /gene="ydzK"
FT                   /locus_tag="BSUW23_02255"
FT   CDS_pept        complement(477553..477849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzK"
FT                   /locus_tag="BSUW23_02255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36509"
FT                   /db_xref="GOA:E0U348"
FT                   /db_xref="UniProtKB/TrEMBL:E0U348"
FT                   /protein_id="ADM36509.1"
FT                   /translation="MIEEKIGVLMMSIFILFYLWIVPIVIGILCSAVAYKSKGKMRVAP
FT                   GIAMIVLSIISLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK"
FT   gene            complement(477923..479197)
FT                   /gene="mntH"
FT                   /locus_tag="BSUW23_02260"
FT   CDS_pept        complement(477923..479197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="BSUW23_02260"
FT                   /product="manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36510"
FT                   /db_xref="GOA:E0U349"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E0U349"
FT                   /protein_id="ADM36510.1"
FT                   /translation="MNKDITAQSPRSKAIQDALDGKIRGFRGLLPFLGPAFIAAIAYID
FT                   PGNFATNISAGSKYGYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKPV
FT                   SIGLWIQGELVIIATDLAEFIGAALGLYLLFGIPMLEASIIAAIGSFAILELQRRGYRS
FT                   LEAGIAGMLFVVVIAFALQTFFAKPDAASVMKGLFVPAFQGTDSVLLAAGILGATVMPH
FT                   AIYLHSALTQRRVVGKTDTERKKIFRFEFIDILIAMLIAGAINASMLIVAAALFFKNGL
FT                   FVEDLDVAYQQFGHLVSPVSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLYV
FT                   RRFITIIPPILIIASGVNPTTALVLSQVVLSFGIAFALIPLIMFTSNKRIMGSLINAKW
FT                   VTVVSWLIAVLIVALNVFLIVDTFR"
FT   gene            complement(479267..479389)
FT                   /locus_tag="BSUW23_02265"
FT   CDS_pept        complement(479267..479389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36511"
FT                   /db_xref="UniProtKB/TrEMBL:E0U350"
FT                   /protein_id="ADM36511.1"
FT                   /translation="MSFYMGPYPNSYISCYITGKNSGMNFEHFRLTRNWDDHMM"
FT   gene            complement(479428..479685)
FT                   /gene="ydaS"
FT                   /locus_tag="BSUW23_02270"
FT   CDS_pept        complement(479428..479685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /locus_tag="BSUW23_02270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36512"
FT                   /db_xref="GOA:E0U351"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:E0U351"
FT                   /protein_id="ADM36512.1"
FT                   /translation="MISFLVSLVVAIVIGLIGSAIVGNRMPGGIFGSMIAGLIGAWIGH
FT                   GLLGTWGPSLAGFAIFPAIIGAAIFVFLLSLVFRGLRKEA"
FT   gene            complement(479763..480215)
FT                   /gene="ydaT"
FT                   /locus_tag="BSUW23_02275"
FT   CDS_pept        complement(479763..480215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaT"
FT                   /locus_tag="BSUW23_02275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36513"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:E0U352"
FT                   /protein_id="ADM36513.1"
FT                   /translation="MPWSMKDYPASLKNLEKPVKKKAIEIANAMIDEGYEDGRAIPIAT
FT                   SKAKEWAENASKEEIDDFLQHDDETERDEDSSSGNGPELMDKAEHVIKHKNGWAVKAED
FT                   AKRVSEIKDTKKDAIERAKEIAAHKGTEVIVHLADGSVQRKMKTES"
FT   gene            480333..481151
FT                   /gene="ydbA"
FT                   /locus_tag="BSUW23_02280"
FT   CDS_pept        480333..481151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="BSUW23_02280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36514"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:E0U353"
FT                   /protein_id="ADM36514.1"
FT                   /translation="MTAERKEDLHHQLKEIEKWEKDQQKVWFWEKLSRLPFQLLDKLTP
FT                   EFIQKKIGKLLDEVGSFVQTGGQYLTSEKQIIKMFQKKLPEDTFESLEDVRKAPLPVMD
FT                   EIAEGMGKNRINTATVQGATTGVGGVFTLAADIPAVLGLSLKTLQDIAVAYGYDPKEKK
FT                   ERVFIVKCLQLTSADVVGKKTILQELKDYDQDRTYKNVASQIQGWREVVLGYRDTFGWK
FT                   KLFQLVPVAGMVFGAAANRSTLNDITETGMMLYKKRRILERLKETEQEME"
FT   gene            481278..481649
FT                   /gene="gsiB"
FT                   /locus_tag="BSUW23_02285"
FT   CDS_pept        481278..481649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BSUW23_02285"
FT                   /product="general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36515"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="InterPro:IPR038956"
FT                   /db_xref="UniProtKB/TrEMBL:E0U354"
FT                   /protein_id="ADM36515.1"
FT                   /translation="MADDNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHD
FT                   KEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNH
FT                   DKEFYQEIGSKGGNARNND"
FT   gene            481871..482119
FT                   /gene="ydbB"
FT                   /locus_tag="BSUW23_02290"
FT   CDS_pept        481871..482119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /locus_tag="BSUW23_02290"
FT                   /product="putative enzyme; cupin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36516"
FT                   /db_xref="GOA:E0U355"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR019780"
FT                   /db_xref="UniProtKB/TrEMBL:E0U355"
FT                   /protein_id="ADM36516.1"
FT                   /translation="MRLAVFTGEYDWHHHPDSDELFIVLEGELLIDFKDKETAVLKAND
FT                   SLLIPKGTVHRRSYVRTVNLCVEHTQAKTVIIEEVPC"
FT   gene            482113..482472
FT                   /gene="ydbC"
FT                   /locus_tag="BSUW23_02295"
FT   CDS_pept        482113..482472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbC"
FT                   /locus_tag="BSUW23_02295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36517"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="UniProtKB/TrEMBL:E0U356"
FT                   /protein_id="ADM36517.1"
FT                   /translation="MLIKRIVCEVDATNAEAFAKAQSQCGALSHVNGFIKQAGGWRETA
FT                   DGLFTAEIISVWENRAAYDHFMENEHDSIYEENERQAVILSIEVKLYEEGEQLIHNLLH
FT                   NSDIRYEPDWTVLKA"
FT   gene            complement(482509..483330)
FT                   /gene="ydbD"
FT                   /locus_tag="BSUW23_02300"
FT   CDS_pept        complement(482509..483330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="BSUW23_02300"
FT                   /product="putative manganese-containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36518"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:E0U357"
FT                   /protein_id="ADM36518.1"
FT                   /translation="MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQ
FT                   GWNTRGNEKYKDLLMDTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGG
FT                   MNPHHAIVSGLGAMPESSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMT
FT                   DDKGVKDMLSFLLARDTMHQNQWIAAIKELEAQEGPIVPGTFPKALEKQEFSHQLINFS
FT                   EGEESSEQTWLNEKAPDGEAFEYVKEAKAFGEKPELKPAPPFVHDTLPGRE"
FT   gene            complement(483416..484468)
FT                   /gene="dctB"
FT                   /locus_tag="BSUW23_02305"
FT   CDS_pept        complement(483416..484468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="BSUW23_02305"
FT                   /product="C4-dicarboxylate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36519"
FT                   /db_xref="GOA:E0U358"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E0U358"
FT                   /protein_id="ADM36519.1"
FT                   /translation="MKSLLACLALMIAGIATALFIGFHDHTGSEEIVYDDDQEGLQDQI
FT                   VFTFSHVVAENTPKGLAANKFAELVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQ
FT                   FIAPSTSKLGMLSSEWGVLDLPYAFTNYDAVKKGLNGSIGTQLFDSLKKNQLKGLAYWT
FT                   NGFKQITTNQGPVRDPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNI
FT                   VDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTEEHFWNAQTSETRRILTEAMKE
FT                   TTEWNETYAEEMNKEQLEEIKKNSSIKIYELSDKEKKEWMKRLDPVYRQYEPIFGRKLI
FT                   RELLELREDS"
FT   gene            484538..486145
FT                   /gene="dctS"
FT                   /locus_tag="BSUW23_02310"
FT   CDS_pept        484538..486145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctS"
FT                   /locus_tag="BSUW23_02310"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36520"
FT                   /db_xref="GOA:E0U3N8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3N8"
FT                   /protein_id="ADM36520.1"
FT                   /translation="MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKK
FT                   RLMNTARTVSEMTEVKEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVS
FT                   TSIGKKSEGADEEAAFAEHIYFSEAKGEIGTAVRAFYPVKDHDLNQIGVVLVGKTLPGI
FT                   ADILLHLKRDITFIVVLTLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSM
FT                   NEGVIAIDNRLIITIFNEKAKQIFEVQGDLVGKVIWDVLKDSRLPEIVERNKAVYNEEI
FT                   RVSGKVIMSSRIPIVMKKKVIGAVAIFQDRTEAAKMAEELTGVKNFVEALRVQNHEHMN
FT                   KLHTIAGLIQLGKSEKALQLAFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELG
FT                   IAVHIDENSSLQQFPEHVDQHDIVVLLGNLIENAFGSFETVQSDDKRIDISIEQTDDIL
FT                   AILIEDNGCGIEPAHMPHLYDKGFTVNKTGGTGYGLYLVKQITDKGSGTIEVDSHAGQG
FT                   TSFSIVFPMKGEEAQHGS"
FT   gene            486135..486815
FT                   /gene="dctR"
FT                   /locus_tag="BSUW23_02315"
FT   CDS_pept        486135..486815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctR"
FT                   /locus_tag="BSUW23_02315"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36521"
FT                   /db_xref="GOA:E0U3N9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006793"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3N9"
FT                   /protein_id="ADM36521.1"
FT                   /translation="MARKEWKVLLIEDDPMVQEVNKDFITTVKGFTVCATAGNGEEGIK
FT                   LIKEKQPDLVILDVYMPKKDGIKTLQEIRKQKLEVDVIVVSAAKDKETISLMLQNGAAD
FT                   YILKPFKLERMRQALEKYKQYKQKLEASDTLSQEQLDAILNIPQQVVQDLPKGLNHFTM
FT                   NEVTAFLKQQTASLSAEEVAKALGIARVTARRYLDYLEKTGTIKLDVQYGGVGRPVNRY
FT                   VLKG"
FT   gene            486935..488200
FT                   /gene="dctP"
FT                   /locus_tag="BSUW23_02320"
FT   CDS_pept        486935..488200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="BSUW23_02320"
FT                   /product="C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36522"
FT                   /db_xref="GOA:E0U3P0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P0"
FT                   /protein_id="ADM36522.1"
FT                   /translation="MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKM
FT                   VIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLD
FT                   YSKLEKGDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAA
FT                   LGEKGKSVIDFFDKISHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMS
FT                   VYITMFLFVFVALNLICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYG
FT                   CSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGA
FT                   AGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSE
FT                   NEFDEAKSIEAVEGMKKMKTAV"
FT   gene            488350..489402
FT                   /gene="ydbI"
FT                   /locus_tag="BSUW23_02325"
FT   CDS_pept        488350..489402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbI"
FT                   /locus_tag="BSUW23_02325"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36523"
FT                   /db_xref="GOA:E0U3P1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P1"
FT                   /protein_id="ADM36523.1"
FT                   /translation="MAALVKFFQHPGVRRFSIFVVLTGVLYLFKSMINLILLTFIFTFL
FT                   MDRLELVVRQFLSRFFRVSQRVVITFLYMLLAVLLTVGGFVFYPVVAAQIQQLVKQIKH
FT                   IAYHPDTIPFFDEITSVFGDINISSYVKEGFNVVYTYLADISTFGLQIVMALILSMFFL
FT                   FEKKRLTEFMAKFKTSKLRVFYEEISFFGSKFARTFGKVLEAQFIIALVNCILTFIALW
FT                   IMHFPQLFGLSIMVFFLGLIPVAGVVISLIPLSIIAYSTGGGMYVLYIVLVIFAIHAIE
FT                   TYFLNPKLMSAKTELPIFFTFTVLIFSEHFFGIWGLIIGIPIFVFLLDILDVTNKEEGP
FT                   KRFQEKSNKK"
FT   gene            489655..490893
FT                   /gene="nqt"
FT                   /locus_tag="BSUW23_02330"
FT   CDS_pept        489655..490893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqt"
FT                   /locus_tag="BSUW23_02330"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36524"
FT                   /db_xref="GOA:E0U3P2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P2"
FT                   /protein_id="ADM36524.1"
FT                   /translation="MKLATKIIIALVLGAITGIILNVTSPELFENLNKFVFGPLGTIFL
FT                   NLIKMLVVPIVFFSLTLGVAGLGDPKKLGRIGVKAISYFLVTTAVAITIAIILALVIKP
FT                   GEFGTYDTSSAEFTAEKAPSIADTLLNIIPTNPVQAMTEGNMLQIIAFAIFVGLGITML
FT                   GKKADMLLKVVEQGNELMMYLVNLVMKFAPYGTFGLIATAIGSQGFSAMKAMGLYMIVV
FT                   TLALLIHAVVTYGSTVALIARRNPITFFKNFSEVMVVAFSTSSSNATLPISMDVAQRKL
FT                   KVPEPISSFVQPLGATINMDGTAIMQGVATVFIAQVFGHDLTFTQLLMVILTAVLASVG
FT                   TAGVPGVGLIMLAMVLQSVGLPVEGIGLILGIDRLLDMLRTVVNTTGDAACAVIITETE
FT                   KNKQPEQAPTLSV"
FT   gene            490985..491911
FT                   /gene="ydbJ"
FT                   /locus_tag="BSUW23_02335"
FT   CDS_pept        490985..491911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /locus_tag="BSUW23_02335"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36525"
FT                   /db_xref="GOA:E0U3P3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P3"
FT                   /protein_id="ADM36525.1"
FT                   /translation="MAEPILHIEGLDKKIGSKQILKQISMDVMEGEIIGLLGPNGSGKT
FT                   TLIRIIVGLLKQNNGSVTISGFQHDTEFEKAMEAVGAIVENPEFYPYLTGWENLKHFAN
FT                   MHKKIADERLDEVVERVGLTSAIHDKVKTYSLGMRQRLGIAQAILHRPKLLILDEPTNG
FT                   LDPAGMKDFRDHIKELAEKEGTAVLFATHLLREVEDLCDRVIIIQKGEIKAEVSLHGTD
FT                   QKTEKAIIEVQPEEKALNWLAGNQYQAERQDGAIVVEVAKENIPELNRSLVGQDLNVFS
FT                   ITPYTQSLEDEFIKATTAHQEEGEELV"
FT   gene            491904..492671
FT                   /gene="ydbK"
FT                   /locus_tag="BSUW23_02340"
FT   CDS_pept        491904..492671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbK"
FT                   /locus_tag="BSUW23_02340"
FT                   /product="putative efflux ABC-transporter (permease
FT                   component)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36526"
FT                   /db_xref="GOA:E0U3P4"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P4"
FT                   /protein_id="ADM36526.1"
FT                   /translation="MSKLIWNEHMKLFNRKVTLVSLILMAVFQFFMALIIKRIVISAGT
FT                   DENFIGYLSYTPSLNILLQALTIVIAATIVSMEFDKKTIKFLLIRPVKRQKVFWSKLIT
FT                   VVMVSFYLYLAYYILALLFGLVFFGTSVSAESKTLLINTLALIGSNWLEAVMMGLFGLL
FT                   CSSLFRNSAVAVVVSFVVLYGASTLVQLMKLFENKWGSFLLFANTDFTQYRSGATALFS
FT                   GMTPLFSVGIIIIHAIFFIAVGWWCFCKRDVRV"
FT   gene            492766..493101
FT                   /gene="ydbL"
FT                   /locus_tag="BSUW23_02345"
FT   CDS_pept        492766..493101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbL"
FT                   /locus_tag="BSUW23_02345"
FT                   /product="YdbL"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36527"
FT                   /db_xref="GOA:E0U3P5"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P5"
FT                   /protein_id="ADM36527.1"
FT                   /translation="MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYM
FT                   IYKMKTGIRYFIIYLYASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQ
FT                   DRDANPV"
FT   gene            493231..494376
FT                   /gene="ydbM"
FT                   /locus_tag="BSUW23_02350"
FT   CDS_pept        493231..494376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbM"
FT                   /locus_tag="BSUW23_02350"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36528"
FT                   /db_xref="GOA:E0U3P6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P6"
FT                   /protein_id="ADM36528.1"
FT                   /translation="MSLFIQNDQQRQWMEKIGRIADEFQQTAAEDDEQGRFPVEKIQKL
FT                   RDAGYTALTLPASHGGGGISVYDMLLFQERLARGDAPAALSIGWHLSVIGELGEGNSWD
FT                   KDVFAYIAKEVQNGAVINRAATEAQTGSPTRGGRPGTNAVKKDGKWAVNGRKTFTTMSQ
FT                   ALDYFLVTAWIEEKQTTGVFLIHKDDPGLSIEETWDMMAMRATGSHDLVLNAVTLDEEK
FT                   LVELLQGPRGAKPNGWLLHIPAIYLGIAQAARDYAVQFASEYSPNSLKGPIKNVPAVQQ
FT                   RTGEMELELLNARHFLFHTAQLYDDPERRPHLRSELGAAKHIVTNAALSVVDKAMRIVG
FT                   AKSLERTNPLQRYYRDVRAGLHNPPMDDAVIQKLAAEAFDS"
FT   gene            complement(494400..494546)
FT                   /locus_tag="BSUW23_02355"
FT   CDS_pept        complement(494400..494546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36529"
FT                   /db_xref="InterPro:IPR025004"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P7"
FT                   /protein_id="ADM36529.1"
FT                   /translation="MPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRIDRKHQKNLQEQ
FT                   SNT"
FT   gene            complement(494533..494697)
FT                   /gene="ydbN"
FT                   /locus_tag="BSUW23_02360"
FT   CDS_pept        complement(494533..494697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbN"
FT                   /locus_tag="BSUW23_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36530"
FT                   /db_xref="InterPro:IPR025072"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P8"
FT                   /protein_id="ADM36530.1"
FT                   /translation="MTPQSAEIRKKQLIHLLIQNGIYKKSKRHLYELSLTELESEYKHV
FT                   RRAPEHAEA"
FT   gene            494944..495816
FT                   /gene="ydbO"
FT                   /locus_tag="BSUW23_02365"
FT   CDS_pept        494944..495816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbO"
FT                   /locus_tag="BSUW23_02365"
FT                   /product="putative cation efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36531"
FT                   /db_xref="GOA:E0U3P9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3P9"
FT                   /protein_id="ADM36531.1"
FT                   /translation="MERTENLKKGEKGALLNILAYVILAVVKLVIGILYHSEALRADGL
FT                   NNGTDIVASVAVLIGLRISQRPADSDHPYGHYRAETISSLVASFIMMVVGIEVLIGGGR
FT                   AITGGTTETPSLIAAWTALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSA
FT                   GAFIGVLSSQLQLPWIDPVTAFIIGIIICKTAWEIFKDASHSLTDGFHLKDLEPYKQTV
FT                   GRIENVHRLKDVKARYLGSTVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVH
FT                   VHVEPDDIK"
FT   gene            complement(495831..496151)
FT                   /gene="ydbP"
FT                   /locus_tag="BSUW23_02370"
FT   CDS_pept        complement(495831..496151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbP"
FT                   /locus_tag="BSUW23_02370"
FT                   /product="putative thioredoxin or thiol-disulfide
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36532"
FT                   /db_xref="GOA:E0U3Q0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q0"
FT                   /protein_id="ADM36532.1"
FT                   /translation="MKKITTNEQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEE
FT                   YNQNDWYELNKDELPELAEKYQVMGIPSLLIFKNGEKTAHLHSANAKTPEEVTEFLSEH
FT                   IS"
FT   gene            496305..497390
FT                   /gene="ddl"
FT                   /locus_tag="BSUW23_02375"
FT   CDS_pept        496305..497390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BSUW23_02375"
FT                   /product="D-alanyl-alanine synthetase A"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36533"
FT                   /db_xref="GOA:E0U3Q1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q1"
FT                   /protein_id="ADM36533.1"
FT                   /translation="MKTSLGLVYGGKSAEHNVSLQTALAVIKALNTEKFDIHPIYITEK
FT                   GEWVKGARLTEPVSNVKMLQFEQGGSAFSPAALNQEMFPQEASQQNEAIDVVFPLLHGP
FT                   NGEDGTIQGMLELLNIPYVGNGVLASSAGMDKVVMKHLFAQAGLAQAKYAAFLKKDWTR
FT                   SPEESCEQVEQELGYPCFVKPANLGSSVGISKCRNREELQKAFELAFQYDRKVVVEEGI
FT                   NGREIEIGVLGNDDPKCSVVGEIAPKTDFYDYKAKYEDGDTDLMIPAHVTDEEYAKISE
FT                   MAIKAFKAIDGSGLVRADFFLTADGEVLINEVNTMPGFTPFSMFPLLWKEAGVEYADLI
FT                   EQLVELAKERHAEKQLIKHTF"
FT   gene            497465..498838
FT                   /gene="murF"
FT                   /locus_tag="BSUW23_02380"
FT   CDS_pept        497465..498838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BSUW23_02380"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36534"
FT                   /db_xref="GOA:E0U3Q2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q2"
FT                   /protein_id="ADM36534.1"
FT                   /translation="MIKRTVKNIAKMVKGTLTNPQYEQTVIHGVATDTRKLEQHQLFIP
FT                   LKGEHFNGHTFVPQAFEAGVAAVLWDRSEPNPPENQAVILVDDTLSALQQLAKAYLQEL
FT                   GTRVIGVTGSNGKTTTKDMIHAVLGTRYRVHKTGGNFNNHIGLPLTVLAMPEDTEIAVL
FT                   EMGMSAKGEIDLLSRLANPDAAVITNIGESHMQDLGSREGIAEAKLEIINGLKEDGVLI
FT                   YIGDEPLLQKTYSCQTKTYGAGAQNDYQLQDVSQSEEGTHFTIKGMEKTFFIPILGKHN
FT                   VMNAMAAIAAGAYFGITPEDAAKGLSGLKVTGMRLELIKTDSGISIINDAYNASPTSMK
FT                   AAIQLTESLEGYGKKMLVLGDMLELGDLEETFHKECGAVISPEKIDRVFTYGKLGAFIA
FT                   EGALKHFEKERVSHYTEKKDLLQAVKENASKGDLILFKASRGMKLEEIVKDLIESPLS"
FT   gene            499242..500726
FT                   /gene="cshA"
FT                   /locus_tag="BSUW23_02385"
FT   CDS_pept        499242..500726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cshA"
FT                   /locus_tag="BSUW23_02385"
FT                   /product="ATP-dependent RNA helicase; cold shock"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36535"
FT                   /db_xref="GOA:E0U3Q3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q3"
FT                   /protein_id="ADM36535.1"
FT                   /translation="MTITFQDFNLSSDLMKAINRMGFEEATPIQAQTIPLGLSNKDVIG
FT                   QAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRAKVLP
FT                   IYGGQDIGRQIRALKKNPHIIVGTPGRLLDHINRRTIRLNNVNTVVMDEADEMLNMGFI
FT                   DDIESILSNVPSEHQTLLFSATMPAPIKRIAERFMTEPEHVKVKAKEMTVSNIQQFYLE
FT                   VQERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLTQAKRM
FT                   VALRKFKEGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGM
FT                   AMTFITPREKSMLRAIEQTTKRKMDRMKEPTLDEALEGQQQVTVERLRTTISENNLNFY
FT                   MTAAAELLEDHDAVTVVAAAIKMATKEPDNTPVRLTDEAPMVSKRYKNQRSSKRRDGQG
FT                   GGYRGGKGKNNNRSSYDKKRSNDRRSSGDRRQKKSY"
FT   gene            500898..501377
FT                   /gene="ydbS"
FT                   /locus_tag="BSUW23_02390"
FT   CDS_pept        500898..501377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbS"
FT                   /locus_tag="BSUW23_02390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36536"
FT                   /db_xref="GOA:E0U3Q4"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q4"
FT                   /protein_id="ADM36536.1"
FT                   /translation="MRDQPKNQISPDGLKVWRLQEVIISAVCLLMVIAVAVLSYYFHWP
FT                   YWISGGLGAAWLLGSLVTVFIIPKIRHKVWRYEVHEHEIDIQSGIFVVTRVIVPMVRVQ
FT                   HVDTSQGPLLKKYNLATVKISTAATVHSIPALAMEEADRLRDSISRLARVTDDDV"
FT   gene            501370..502848
FT                   /gene="ydbT"
FT                   /locus_tag="BSUW23_02395"
FT   CDS_pept        501370..502848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbT"
FT                   /locus_tag="BSUW23_02395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36537"
FT                   /db_xref="GOA:E0U3Q5"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q5"
FT                   /protein_id="ADM36537.1"
FT                   /translation="MSEPKRLHPAAVILNLCHTIIQTIKNIILPFFFVYIVNSNNTVRF
FT                   YGAIALGVLFIWLIAASIIKWRRFTYRIENDEFRIEEGLFVTKKRYISIDRIQTMNTSA
FT                   GVIQQIFKLVKLQIETAGGGKEAEAVLSAISVEEAERIKEAVFKKKAQRHESEQEEEWL
FT                   AAEQEFIPAVEPQEHYRMNVKELLMAASTSGGIGVIISAVFALFTQIDEVLPMDWFFDK
FT                   FSFLQHASIGIYAVLIFIGLFIAWVSSIAGMMFKYANFQIIKKEQELVISRGIIEKHQV
FT                   TIPLRKIQAIKIKENIIRQLFGFVTVSIVSAGGGDREKEEGALTILFPMIHKKKLPHML
FT                   RTFTPEYTLEENVRRLPRRALKRYLFRSVIFSLFLIIPLCIFFQPWGYLSIILLPIELF
FT                   FGYLAYKDTAWTINEDRLQLTSRFIGRTTAIVLRRRMQICKFSQSYFQKKGRLYTISTS
FT                   VKSSSHMEELTVRDVGEEDADSILNWYSYEKADG"
FT   gene            complement(502845..503444)
FT                   /gene="ydcA"
FT                   /locus_tag="BSUW23_02400"
FT   CDS_pept        complement(502845..503444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcA"
FT                   /locus_tag="BSUW23_02400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36538"
FT                   /db_xref="GOA:E0U3Q6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q6"
FT                   /protein_id="ADM36538.1"
FT                   /translation="MFIRTENFQTFIRLYPIVTFILALQAVLWLFFSLPVHSVVLWRDA
FT                   VTGYNLGVANGEWWRLITPVLLHAGFTHLLFNSMSIFLFAPALERMLGKARFLLVYAGS
FT                   GIIGNIGTYVTEPLDYVHVGASGAIFGLFGVYLFMVLFRKELIGQEHSKMILTLLAFAV
FT                   LMSFINSNINMMAHLFGLCGGFLLSFLCVQKKERRY"
FT   gene            503539..503904
FT                   /gene="acpS"
FT                   /locus_tag="BSUW23_02405"
FT   CDS_pept        503539..503904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BSUW23_02405"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36539"
FT                   /db_xref="GOA:E0U3Q7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q7"
FT                   /protein_id="ADM36539.1"
FT                   /translation="MIYGIGLDITELKRIASMAGRQKRFAERILTQSELDHYQELSEKR
FT                   KIEFLAGRFAAKEAFSKAYGTGIGKQLSFQDIEIKKDQNGKPYIICAKLSQAAVHVSIT
FT                   HTKEYAAAQVVIERLSS"
FT   gene            504078..505085
FT                   /gene="ydcC"
FT                   /locus_tag="BSUW23_02410"
FT   CDS_pept        504078..505085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="BSUW23_02410"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36540"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q8"
FT                   /protein_id="ADM36540.1"
FT                   /translation="MRKSFVLLLTGLLAVLILSACGQKTQQDIVTGLDEKAKEYTSYKA
FT                   KAKMTIETGSEPQVYNVEIWHKKPSLYRVYLENPKKDQNQVILRNENGVFVLTPSLNKS
FT                   FRFQSDWPNNSSQVYLFESLVKDVQNDSDAVFTAKEKKYVFETKTNYQHNKMLPTQEIT
FT                   FNKKDMSPSSVKVMDTDRKVMVKVEFSSFEFNKQFDKESFDEKKNMTLSQMDVATSAKP
FT                   SDTFAVKTPLELPLGVKLLEEKDISTEDGKRIIMTYGGEKSFTLIQEKAQIAKASSSVT
FT                   MNGEPVNLGYTIGALSDASLSWTYDGVDYLLSSKDLSKEEMVTVAKSMQGQSSK"
FT   gene            505200..506369
FT                   /gene="alrA"
FT                   /locus_tag="BSUW23_02415"
FT   CDS_pept        505200..506369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alrA"
FT                   /locus_tag="BSUW23_02415"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36541"
FT                   /db_xref="GOA:E0U3Q9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3Q9"
FT                   /protein_id="ADM36541.1"
FT                   /translation="MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAY
FT                   GHGDAETAKAALDAGASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYAEIAAEYDLT
FT                   LTGYSVEWLQEAARHMKKGSLHFHLKVDTGMNRLGVKTEEEVHHVMAILDRNPRLKCKG
FT                   VFTHFATADEKERGYFLMQFERFKELIAPLPLKKMMVHCANSAAGLRLKKGFFNAVRFG
FT                   IGMYGLRPSADITDEIPFELHPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTV
FT                   PVGYADGWLRKLKGTEILVKGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEY
FT                   ISMDEIAGRLETINYEVSCTISSRVPRMFLENGSIMEVRNPLLQENTSK"
FT   gene            506485..506766
FT                   /gene="ndoAI"
FT                   /locus_tag="BSUW23_02420"
FT   CDS_pept        506485..506766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndoAI"
FT                   /locus_tag="BSUW23_02420"
FT                   /product="antitoxin EndoAI"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36542"
FT                   /db_xref="GOA:E0U3R0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R0"
FT                   /protein_id="ADM36542.1"
FT                   /translation="MSESSARTEMKISLPENLVAELDGVAMREKRSRNELISQAVRAYV
FT                   SERTTRHNRDLMRRGYMEMAKINLNISSEAHFAECEAETTVERLVSGG"
FT   gene            506771..507121
FT                   /gene="ndoA"
FT                   /locus_tag="BSUW23_02425"
FT   CDS_pept        506771..507121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndoA"
FT                   /locus_tag="BSUW23_02425"
FT                   /product="endoribonuclease toxin"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36543"
FT                   /db_xref="GOA:E0U3R1"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R1"
FT                   /protein_id="ADM36543.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVD
FT                   EALQISLALIDF"
FT   gene            507239..508063
FT                   /gene="rsbRA"
FT                   /locus_tag="BSUW23_02430"
FT   CDS_pept        507239..508063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbRA"
FT                   /locus_tag="BSUW23_02430"
FT                   /product="component of the piezosome (stressosome);
FT                   positive regulation of sigma(B) activity in response to
FT                   salt and heat stress"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36544"
FT                   /db_xref="GOA:E0U3R2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R2"
FT                   /protein_id="ADM36544.1"
FT                   /translation="MMSNQTVYQFIAENQNELLHLWTDTLKELSEQESYQLTDQVYENI
FT                   SKEYIDILLSSVKDDSAAESQISELALRAVQIGLSLKFLATALAEFWKRLYTKMNDKRL
FT                   PDQESTELIWQIDRFFSPINTEIFNQYSISWKKTVSLQKIALQELSAPLIPVFENITVM
FT                   PLVGTIDTERAKRIMENLLNGVVKHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVG
FT                   AKCLLAGIRPEIAQTIVNLGIDLSQVITKNTLQKGIQTALEMTDRKIVSLGE"
FT   gene            508068..508433
FT                   /gene="rsbS"
FT                   /locus_tag="BSUW23_02435"
FT   CDS_pept        508068..508433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="BSUW23_02435"
FT                   /product="antagonist of RsbT"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36545"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R3"
FT                   /protein_id="ADM36545.1"
FT                   /translation="MRHPKIPILKLYNCLLVSIQWELDDQTALTFQEDLLNKIYETGAN
FT                   GVVIDLTSVDMIDSFIAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGIALEEIET
FT                   ALDLEQGLETLKRELGE"
FT   gene            508437..508838
FT                   /gene="rsbT"
FT                   /locus_tag="BSUW23_02440"
FT   CDS_pept        508437..508838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="BSUW23_02440"
FT                   /product="switch protein/serine-threonine kinase; controls
FT                   the activity of the piezosome (stressosome)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36546"
FT                   /db_xref="GOA:E0U3R4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R4"
FT                   /protein_id="ADM36546.1"
FT                   /translation="MNDQSCVKIMTEWDIVAARQLGRNVAKELGFGTVDQARITTAISE
FT                   LARNIYLYAGKGQIGIEQVADRGKKGLKIIAEDQGPGIPDIRKVMEDGFSTSGGLGAGL
FT                   PGVKRLMDEFSLNSVAGEGTEIQAIKWLR"
FT   gene            508850..509857
FT                   /gene="rsbU"
FT                   /locus_tag="BSUW23_02445"
FT   CDS_pept        508850..509857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="BSUW23_02445"
FT                   /product="serine phosphatase; controls the activity of the
FT                   piezosome (stressosome)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36547"
FT                   /db_xref="GOA:E0U3R5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R5"
FT                   /protein_id="ADM36547.1"
FT                   /translation="MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPE
FT                   EIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAYQEHQTLRGIQQEIKSEIEIA
FT                   ANVQQTLLGTKIPQEEALDIGAISVPAKQMSGDYYHFVKDKESINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPETGIHPSQVLKNLNRVVEQNVDASMFITMLYANYNMDKHQFTYAS
FT                   AGHEPGFYYSQKDNTFYDLEAKGLVLGISQDYDYKQFDQHLDKGDMIVLFSDGVTECRT
FT                   ENGFLERPDLQKLIEEHMCSSAQEMVKNIYDSLLKLQDFQLHDDFTLIVLRRKV"
FT   gene            509919..510248
FT                   /gene="rsbV"
FT                   /locus_tag="BSUW23_02450"
FT   CDS_pept        509919..510248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="BSUW23_02450"
FT                   /product="anti-anti-sigma factor (antagonist of RsbW)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36548"
FT                   /db_xref="GOA:E0U3R6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R6"
FT                   /protein_id="ADM36548.1"
FT                   /translation="MNINVDVKQNVNDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLR
FT                   ICLKDVSYMDSTGLGVFVGIFKTVKKQGGSLKLENLSERLIRLFEITGLKDIIDISAKS
FT                   EGGVQ"
FT   gene            510245..510727
FT                   /gene="rsbW"
FT                   /locus_tag="BSUW23_02455"
FT   CDS_pept        510245..510727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="BSUW23_02455"
FT                   /product="serine-protein kinase RsbW"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36549"
FT                   /db_xref="GOA:E0U3R7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R7"
FT                   /protein_id="ADM36549.1"
FT                   /translation="MKNNADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKI
FT                   AVSEACTNAVQHAYKEDKNGEVSIRFGVFEDRLEIIVADEGDSFDFDQKQQDLGPYTPS
FT                   HTVDQLSEGGLGLYLMETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTTIKNYETN"
FT   gene            510693..511481
FT                   /gene="sigB"
FT                   /locus_tag="BSUW23_02460"
FT   CDS_pept        510693..511481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="BSUW23_02460"
FT                   /product="RNA polymerase sigma factor SigB"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36550"
FT                   /db_xref="GOA:E0U3R8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R8"
FT                   /protein_id="ADM36550.1"
FT                   /translation="MTQPSKTTKLTKDEVDRLISDYQTNQDEQAQETLVRVYTNLVDML
FT                   AKKYSKGKSFHEDLRQVGMIGLLGAIKRYDPVVGKSFEAFAIPTIIGEIKRFLRDKTWS
FT                   VHVPRRIKELGPRIKMAVDQLTTETQRSPKVEEIAEFLDVSEEEVLETMEMGKSYQALS
FT                   VDHSIEADADGSTVTILDIVGSQEDGYERVNQQMMLQSVLHVLSDREKQIIDLTYIQNK
FT                   SQKETGDILGISQMHVSRLQRKAVKKLREALIEDPSMELM"
FT   gene            511481..512080
FT                   /gene="rsbX"
FT                   /locus_tag="BSUW23_02465"
FT   CDS_pept        511481..512080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /locus_tag="BSUW23_02465"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36551"
FT                   /db_xref="GOA:E0U3R9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3R9"
FT                   /protein_id="ADM36551.1"
FT                   /translation="MIQVEENEHIQTLVYQLNKEGKSICGDSFFMKADDKELICAVADG
FT                   LGSGSLANESSAAIKDLVENYANEDVQSIIERCNQAMKNKRGATASILKINFEQRQFTY
FT                   CSVGNVRFILHSPSGESFYPLPISGYLSGKPQKYKTHTATYEKGSKFIIHTDGLNVPDI
FT                   RSHLKKGQSVEDISNSLKMYTTSRKDDLTYILGQLS"
FT   gene            512187..514346
FT                   /gene="ydcI"
FT                   /locus_tag="BSUW23_02470"
FT   CDS_pept        512187..514346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcI"
FT                   /locus_tag="BSUW23_02470"
FT                   /product="putative RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36552"
FT                   /db_xref="GOA:E0U3S0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S0"
FT                   /protein_id="ADM36552.1"
FT                   /translation="METSALLKQQIAKEIGLSQKYVESVIRLLEDGNTVPFIARYRKEQ
FT                   TGSMDEVQIQTISERWQYIQNLNQRKEEVIRLIAEQDKLTDDVKRKIEQSVKLQEVEDL
FT                   YRPYKQKRKTKATVAKSKGLEPLADYILTLPQDNRLAETADQYISEEKEVFTREEAIEG
FT                   AKHIIAEQISDEPSFRKWIRQETFKRGTIKSTAGKSADTDEKNVYEMYYEYEEPIAKVV
FT                   PHRVLAMNRGEKEDILKVSIEPPADHIKAYLEKQIIKNRSTSVKEILQETIEDSYKRLI
FT                   QPAIEREIRKELSEKADEQAIHIFSENLRKLLLQPPMKGKTVLGVDPAFRTGCKLAVSD
FT                   ETGKVLKIDVIYPHAPVNKTKEAHEKVKVILEQHQVEMVAIGNGTASRETEQFIVNVLK
FT                   DMPRKIYYVIVNEAGASVYSASELAREEFPELQVEERSAVSIARRLQDPLAELVKIDPK
FT                   SVGVGQYQHDVSQKRLNESLRFVVETVVNQVGVNVNTASAALLQYVAGLSKSVAGNVVK
FT                   KREEIGKFSNRKELKDIPRLGAKTYEQCIGFLRVQEGTEPLDRTGIHPESYKETKALLK
FT                   KLGLSTEQIGTAELKDKINQLALSETAQELGIGEITLKDICEQLTRPERDPRDEVPKPL
FT                   LKTDVLQLEDLKEGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLSNQFVKHPLDVVS
FT                   VGDIVTVWVDGVDVQKGRVSLSMVK"
FT   gene            complement(514356..514469)
FT                   /locus_tag="BSUW23_02475"
FT   CDS_pept        complement(514356..514469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36553"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S1"
FT                   /protein_id="ADM36553.1"
FT                   /translation="MPNWLKKQMQKAFLEKDNYQIKLLNQCWYFYRKKHCS"
FT   gene            514573..515025
FT                   /gene="ydcK"
FT                   /locus_tag="BSUW23_02480"
FT   CDS_pept        514573..515025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcK"
FT                   /locus_tag="BSUW23_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36554"
FT                   /db_xref="GOA:E0U3S2"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S2"
FT                   /protein_id="ADM36554.1"
FT                   /translation="MDNKELQKLTEDISETYFKKPFRHQALFNDRLKTTGGRYLLTSHN
FT                   IELNRKYLIEHGREELIGIIKHELCHYHLHLEGKGYKHRDRDFRTLLQQVNAPRFCTPL
FT                   KKKTENKKTYMYICTACGQQYIKKRAMNPDRYRCGKCRGKIKRIFS"
FT   gene            515148..515222
FT                   /locus_tag="BSUW23_t20498"
FT                   /note="trnS-Asn"
FT   tRNA            515148..515222
FT                   /locus_tag="BSUW23_t20498"
FT                   /product="tRNA-Asn"
FT   gene            515227..515317
FT                   /locus_tag="BSUW23_t20500"
FT                   /note="trnS-Ser"
FT   tRNA            515227..515317
FT                   /locus_tag="BSUW23_t20500"
FT                   /product="tRNA-Ser"
FT   gene            515347..515418
FT                   /locus_tag="BSUW23_t20502"
FT                   /note="trns-Glu"
FT   tRNA            515347..515418
FT                   /locus_tag="BSUW23_t20502"
FT                   /product="tRNA-Glu"
FT   gene            515430..515504
FT                   /locus_tag="BSUW23_t20504"
FT                   /note="trnS-Gln"
FT   tRNA            515430..515504
FT                   /locus_tag="BSUW23_t20504"
FT                   /product="tRNA-Gln"
FT   gene            515532..515607
FT                   /locus_tag="BSUW23_t20506"
FT                   /note="trnS-Lys"
FT   tRNA            515532..515607
FT                   /locus_tag="BSUW23_t20506"
FT                   /product="tRNA-Lys"
FT   gene            515619..515700
FT                   /locus_tag="BSUW23_t20508"
FT                   /note="trnS-Leu1"
FT   tRNA            515619..515700
FT                   /locus_tag="BSUW23_t20508"
FT                   /product="tRNA-Leu"
FT   gene            515782..515868
FT                   /locus_tag="BSUW23_t20510"
FT                   /note="trnS-Leu2"
FT   tRNA            515782..515868
FT                   /locus_tag="BSUW23_t20510"
FT                   /product="tRNA-Leu"
FT   gene            516147..516320
FT                   /locus_tag="BSUW23_02485"
FT   CDS_pept        516147..516320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36555"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S3"
FT                   /protein_id="ADM36555.1"
FT                   /translation="MSTEKDIHRSHVVYTLNKMVEIFKESSPLEPALDYNPETEKIIMN
FT                   DPFFRFGVRWQV"
FT   gene            516750..516884
FT                   /locus_tag="BSUW23_02490"
FT   CDS_pept        516750..516884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36556"
FT                   /db_xref="GOA:E0U3S4"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S4"
FT                   /protein_id="ADM36556.1"
FT                   /translation="MKITREKLEKQQIWIYGITLIFGGVLGIAKKALGTGLDRLYHHL"
FT   gene            517484..517843
FT                   /locus_tag="BSUW23_02495"
FT   CDS_pept        517484..517843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02495"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36557"
FT                   /db_xref="GOA:E0U3S5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S5"
FT                   /protein_id="ADM36557.1"
FT                   /translation="MTYSIGEFSKIVGLSEHTLRFYEREGLIKVNRDDNNVRIYSDENK
FT                   LWIESLLHLKNTGMSLKDMKQFFLWGSMGDETVEKRLALLKDHRKKVVEEFNKIRQSLE
FT                   FIDNKINFYENKYRK"
FT   gene            517967..518809
FT                   /locus_tag="BSUW23_02500"
FT   CDS_pept        517967..518809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02500"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36558"
FT                   /db_xref="GOA:E0U3S6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S6"
FT                   /protein_id="ADM36558.1"
FT                   /translation="MTNNKVWFITGAGRGMGVDIAKAALAAGYKVVATGRNPEKVAKVI
FT                   GENENLLVVKLDVTSSTDAETAVKTAVERFGTIDVLVNNAGNFYAGYFEELSPAQIEKQ
FT                   LATNLIGPMNVTRAALPVMRKARSGHIISISSIAGLVGGEFTSAYAASKFAVEGWMESL
FT                   RFEVEPFGIKTTIVEPGFFRTDLLEPESRTWPELTIDDYTERTEKTRAGWDSMSGKQGG
FT                   DPAKLGKALITIASQEEPPLRWIAGADAIAAAEQKVADLQEQINAYRDLSTSLAYEDA"
FT   gene            complement(519189..519329)
FT                   /locus_tag="BSUW23_02505"
FT   CDS_pept        complement(519189..519329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36559"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S7"
FT                   /protein_id="ADM36559.1"
FT                   /translation="MRFIEKAKLLQLLFSNILITLGIKKEMEILTTYDLMREHGVLKQI
FT                   L"
FT   gene            519473..520453
FT                   /locus_tag="BSUW23_02510"
FT   CDS_pept        519473..520453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02510"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36560"
FT                   /db_xref="GOA:E0U3S8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S8"
FT                   /protein_id="ADM36560.1"
FT                   /translation="MKTRRLGTLDVSELGFGCMSISDNYGPPADKEKGIKTIHTAYEKG
FT                   VTFFDTAEVYGPYTNEELVGEALAPFRDEVIIASKFGFDIEGSEGLNSRPEHIKKVVED
FT                   SLKRLKTDRIDLYYQHRVDPKVPIEEVAGVMKDLIEEGKVLHYGLSEASENTIRRAHAV
FT                   HPVTAIQSEYSFMERAPEQNSVLKTCEELGIGFVPWGPVGLGYLTGKIDTRTNFDASTD
FT                   LRAGFFRFTPENLAANMPIVDLLRRFAEKKNATPAQISLAWLMAQKPWIVPIPGTRNID
FT                   HLNENLGAINIQLTPAELRELETNFSKVKVHGGRMNEIHMQSVEQ"
FT   gene            520601..521344
FT                   /locus_tag="BSUW23_02515"
FT   CDS_pept        520601..521344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02515"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36561"
FT                   /db_xref="GOA:E0U3S9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3S9"
FT                   /protein_id="ADM36561.1"
FT                   /translation="MSNIQDKVVIITGASSGIGEATARELASKGAKLVLAARREDRLKK
FT                   LQEEIQNKGGQAIYKVTDVASHEQVEELAHYALKEYGKIDVMVNNAGVMPLSPVHQKKI
FT                   NEWDKMIDVNIKGVLYGIAAVLPSMRERKEGHIINVSSIAGHLVFPASSVYSGTKFAVR
FT                   AITEGLRIEEYSNNIRTTIISPGTIDTELLDTISDEELKSASVEANKKVQIEPASIAHT
FT                   IAFAIEQPSDVAINEMIVRPTIQEL"
FT   gene            521561..522268
FT                   /locus_tag="BSUW23_02520"
FT   CDS_pept        521561..522268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02520"
FT                   /product="carbonyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36562"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T0"
FT                   /protein_id="ADM36562.1"
FT                   /translation="MSQDKQVAFVTGGNRGIGYELVKQLALKGFKVILASRDPKMGHEA
FT                   AEKLKESDLDVSFVMLDVDNQESIRQAAITVSERYGRLDVLINNAGVYLNVNEKLLTMD
FT                   PSILEKTMRTNFFGAYYVIHSFIPLMEKQGYGRIINVSSGYGTMREMAQQGVGAYKLSK
FT                   LSLNGLTQLVSAEVKGDIKINAVCPGWVSTDMGGPSAPRTPKQAAESILWLATIGPEGP
FT                   NGGFFRDGKRIEW"
FT   gene            522246..522962
FT                   /locus_tag="BSUW23_02525"
FT   CDS_pept        522246..522962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02525"
FT                   /product="NADH-dependent flavin oxidoreductase, oye family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36563"
FT                   /db_xref="GOA:E0U3T1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T1"
FT                   /protein_id="ADM36563.1"
FT                   /translation="MENESSGNINLFESFTFKNGITLKNKVVMAPMTTWSSNDDYTVSD
FT                   DELNYYRKRVNGVGLVITGCTRVAPNGIGFTNEFAAYDDKFIPSLRKLAEAAKSGGAPA
FT                   ILQIFHAGNKGVADLIPNGDVVSASSVVTEPTLFHQDKVVPRELSHEEILDIIHAFGET
FT                   TRRAIEAGFDGVELHGAHAFLMQNFFSPLFNRREDQWGGSLENRMRFPIAIVQELKNVI
FT                   KKNTTKPFIFRVQNLS"
FT   gene            523624..524343
FT                   /locus_tag="BSUW23_02530"
FT   CDS_pept        523624..524343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02530"
FT                   /product="short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36564"
FT                   /db_xref="GOA:E0U3T2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T2"
FT                   /protein_id="ADM36564.1"
FT                   /translation="MKNKVIVITGASSGIGRATAALLAEKGAKVVLGARRKENLEELVA
FT                   SIASKGGTATYQVTDVTKRSDVENLVKHAVTTYGKVDVMINNAGIMPLSTLDKLKVDEW
FT                   EKMIDVNIKGVLYGIAAALPIMQEQGYGHIINTSSTAGHTVVPTAAVYAGTKFAVMAIS
FT                   EGLRQEVAGKLKVTAISPGVTETELGHDITDEVSAAFVKEGRNIALPPEIIANAMAYAI
FT                   EQPDYVDVSEIIVREKG"
FT   gene            complement(524869..525897)
FT                   /gene="dfaD"
FT                   /locus_tag="BSUW23_02535"
FT   CDS_pept        complement(524869..525897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfaD"
FT                   /locus_tag="BSUW23_02535"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36565"
FT                   /db_xref="GOA:E0U3T3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T3"
FT                   /protein_id="ADM36565.1"
FT                   /translation="MNEQNLRTLRKLVTPYEKSDLQKSICQIINTLVPFILLWYLAYKS
FT                   LSISYFLTLAISVVAAGFLVRTFIIFHDCCHYSFFKNRKANRILGTITGILTLHPFDHW
FT                   AHDHSVHHATSSNLDKRGTGDIWVLTVEEYKKASTKTKIMYRLYRNPFVMFMIGPIYVF
FT                   GITNRFNRKGAKRKERMNTYVTNLGIVTLAALLCWVIGWQNFLLVQVPIFMISGSLGIW
FT                   MFYIQHTFEDSYFEEDEHWEYVKAAVEGSSFYKLPKVMQWLTGNIGFHHVHHLSPRVPN
FT                   YKLEKAHNNTEPLQNVPTITLATSLKSLKFRLWDEEGKKFVGFSHLKKASKSQVSARLG
FT                   TD"
FT   gene            526681..526884
FT                   /gene="cspC"
FT                   /locus_tag="BSUW23_02540"
FT   CDS_pept        526681..526884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="BSUW23_02540"
FT                   /product="cold-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36566"
FT                   /db_xref="GOA:E0U3T4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T4"
FT                   /protein_id="ADM36566.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIERDNGDDVFVHFSAIQGDGFKSLDEGQ
FT                   KVTFDVEQGARGAQAANVQKAS"
FT   gene            complement(527632..528108)
FT                   /gene="ydeB"
FT                   /locus_tag="BSUW23_02545"
FT   CDS_pept        complement(527632..528108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeB"
FT                   /locus_tag="BSUW23_02545"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36567"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T5"
FT                   /protein_id="ADM36567.1"
FT                   /translation="MEVDDMFQIGDNIVYPMHGVGIIEAIEEKEILGKKQQYYVIKMTI
FT                   SNMQVMIPTRKILSSSIRPVTDIRALKHIIHIFQHGESDRLLPWKQRYIVNTNKIKTGE
FT                   IQEGAEVVRDLMRMKKEKALNASEKKMLDNAYEFLISELEVIKGITENQIKSFC"
FT   gene            complement(528564..529457)
FT                   /locus_tag="BSUW23_02550"
FT   CDS_pept        complement(528564..529457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36568"
FT                   /db_xref="GOA:E0U3T6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T6"
FT                   /protein_id="ADM36568.1"
FT                   /translation="MKSKIQFILSMIIFGTMGLVVRYIDLSSSETALLSSSIGCLFLMF
FT                   VFFMMKKTIPWKLAKANAYILLLSGIALGGNWIFLYQAYDHTTLTNATLGYYFAPVFVM
FT                   ILSPMVLKEQLPIKKMVCIGVAIIGMLLIVGNGISASGTEDLLGIFFGLVAAAFYAALM
FT                   LLNKFIHHMGRLEITIIQLGITALLLLPYVFFTEGFGILGVSNSSVPFIIILGIVNTGI
FT                   GFWLFFSGMQKLKGQSIAILSYVDPFVAILISAMILQEQMTIVQMLGGTLLLGSTFVSE
FT                   SKSFKFPKRLRKLSTK"
FT   gene            530075..530860
FT                   /locus_tag="BSUW23_02555"
FT   CDS_pept        530075..530860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02555"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36569"
FT                   /db_xref="GOA:E0U3T7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T7"
FT                   /protein_id="ADM36569.1"
FT                   /translation="MTFGEKLFKLRKEKGLSQEALAEKVNTTRQAISKWENGQGFPETE
FT                   KLLMIGNIFEVSIDYLLKDSVEPRTDNKEGYYVSREMADGFLLHERKVSKYVSFGLSLL
FT                   ILSTVPYLVFKQEPAIYTLLIMIIAVLGIGAIVTGLITVEDKYRVLKKEALIFDQNHHK
FT                   ELTVKYKDMKRRYAAVLVGGVCSIVAGGIPFFLERKHIVSGFNAYYPVCVVLIAIGAYI
FT                   LIRTLPIIEAYQIMAKNEEYINKLGFKLCKKVKKRVDNF"
FT   gene            complement(531264..532136)
FT                   /gene="ydeE"
FT                   /locus_tag="BSUW23_02560"
FT   CDS_pept        complement(531264..532136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeE"
FT                   /locus_tag="BSUW23_02560"
FT                   /product="putative transcriptional regulator (AraC/XylS
FT                   family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36570"
FT                   /db_xref="GOA:E0U3T8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T8"
FT                   /protein_id="ADM36570.1"
FT                   /translation="MDSLKSMNRALKYIEENLTNDIDFKEVAKLAFCSEYHFKRMFSFL
FT                   AGVSLSEYIRRRRLTLAAFELKDSNVKVIDIAIKYSYKSPDSFARAFQHLHGIRPSEAR
FT                   NNGHSLKAYPPMTFQLSIKGGSEMNYRIEEKEAFRIVGIKKRVPIIFKGVNPEIASMWE
FT                   SLDAAAINTLKKLSNVSPLGLISASTNFSEGRTEENGELDHYIGAATTKQCPDSFSQLE
FT                   VPASTWAVFEAIGSFPDTLQEVWGRIYSEWFPSSNYEQIEGPEILWNEHKDVTSPSFKS
FT                   EIWIPISKK"
FT   gene            532649..533032
FT                   /gene="ydeH"
FT                   /locus_tag="BSUW23_02565"
FT   CDS_pept        532649..533032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeH"
FT                   /locus_tag="BSUW23_02565"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36571"
FT                   /db_xref="GOA:E0U3T9"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3T9"
FT                   /protein_id="ADM36571.1"
FT                   /translation="MLKRFSLVFLTLIMSIVVLLVAGKDSPGDHVISLDEPIILMISIG
FT                   IVIFLFIPPLAMSFFGNLVVRIISGVYQCFIVLTFMGLIPIGFLIPNGFLTILVSVTGT
FT                   LVSIASVVGTLLIGRHKEVKIIK"
FT   gene            533620..534213
FT                   /gene="ydeI"
FT                   /locus_tag="BSUW23_02570"
FT   CDS_pept        533620..534213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeI"
FT                   /locus_tag="BSUW23_02570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36572"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3U0"
FT                   /protein_id="ADM36572.1"
FT                   /translation="MTNNRTNPKVDEFISKAKKWKEEYEKLRAIVLDCDLTEELKWKHP
FT                   CYTLNNKNIVLIHGFKEYCALLFHKGALLQDTHGILIQQTENVQAARQIRFTNVQEIDE
FT                   METILKAYIHEAIEVEKAGLEVDLKKNTEYKIPEELQNKFDEIPALKTAFEALTPGRQR
FT                   AYILHFSQAKQSKTREARVEKYVQKILDGKGLKD"
FT   gene            complement(534429..535103)
FT                   /gene="ydeJ"
FT                   /locus_tag="BSUW23_02575"
FT   CDS_pept        complement(534429..535103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeJ"
FT                   /locus_tag="BSUW23_02575"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36573"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3U1"
FT                   /protein_id="ADM36573.1"
FT                   /translation="MRKLQKIFYCNAALLLIALLLAGCTGSKNEESKQSSDTDSAVQSE
FT                   QIHNKTENSNKIGKDQSEPTTASEESAMDESSETSSEEVKNEEKGKEDNVLAAYSSEKI
FT                   EYARVWLQLGSNQEIDELNVRHISAGKPINPNDNTSASYPEDVIQLAGSRLVDGSVTYH
FT                   GNGDGTIHVYNVPLRWDSADDLDQGVMQEVTENIIKNAKKVYVDPGDNEKIKQLIEIMM
FT                   IH"
FT   gene            complement(535534..535755)
FT                   /locus_tag="BSUW23_02580"
FT   CDS_pept        complement(535534..535755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36574"
FT                   /db_xref="GOA:E0U3U2"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E0U3U2"
FT                   /protein_id="ADM36574.1"
FT                   /translation="MPIQAMIAEGDLVAVYFICEGKHTGTPFAGVPATGKSVTFSLMIL
FT                   LRISDGKMIEHRSHVDVRDILRQLGVPA"
FT   gene            complement(535896..536657)
FT                   /gene="blaW"
FT                   /locus_tag="BSUW23_02585"
FT   CDS_pept        complement(535896..536657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaW"
FT                   /locus_tag="BSUW23_02585"
FT                   /product="Probable beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36575"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4B7"
FT                   /protein_id="ADM36575.1"
FT                   /translation="MNIQQIRNATLVVKYAGKTFLIDPMLAEKGAYPPFPNAPRQDQNN
FT                   PLVELPTSVDNIIKDIDAVIVTHLHYDHWDEAAKEVLPKDIKLFSQNEEDAKEIRNAGF
FT                   KNVEVLTKDTVFEGIQLMKTKGEHGRGEILKLAGLVCGVVFKHKSEKTLYIAGDTVWYD
FT                   AVQEEIETHQPDIIVVNGGDNQFYEGGSLVMGKEDIYETYKAAPNAKIIVSHMEAVNHW
FT                   GLSREELKSFINEKGISSHVLVPDDGESYSF"
FT   gene            536915..537325
FT                   /locus_tag="BSUW23_02590"
FT   CDS_pept        536915..537325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02590"
FT                   /product="LrpA-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36576"
FT                   /db_xref="GOA:E0U4B8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4B8"
FT                   /protein_id="ADM36576.1"
FT                   /translation="MLDHTDMQILEELSKNSRITMKELGEKVHLTGQAAALRVAKLEDN
FT                   GVIEGYTIKVNQVKLGCYIHALLNIYIKSTHHQPYLSFIKTQDKYVINNYKISGDGCYL
FT                   LECKFPSNEMLDQFLVELNKHVNYKLSIVINK"
FT   gene            complement(537455..538318)
FT                   /gene="ydeK"
FT                   /locus_tag="BSUW23_02595"
FT   CDS_pept        complement(537455..538318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeK"
FT                   /locus_tag="BSUW23_02595"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36577"
FT                   /db_xref="GOA:E0U4B9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4B9"
FT                   /protein_id="ADM36577.1"
FT                   /translation="MNKTTNGWINGFIGVLIFSGSLPATRLAVSDFDPLFLTVCRAAIA
FT                   GILAGGLLLIFRQQHPAKRDIISLLVVAFGVVIGFPLLTALALQYVTSAHAIVFVGLLP
FT                   LATAIFGVLRGGERPRPVFWIFSAAGSLLVAGFALIQGGGSSPLGDAYMLASIVVCGLG
FT                   YAEGARLSRRLGNWQVISWALVLSLPLMLPLSFFFTPDSWSGIGVPALLSLAYVSLFSM
FT                   LIGFVFWYRGLAQGGIAAVGQLQLLQPFFGLLLASVILHEKVGWALVAVNIAVIMCVAA
FT                   ARRFAK"
FT   gene            538471..539862
FT                   /gene="ydeL"
FT                   /locus_tag="BSUW23_02600"
FT   CDS_pept        538471..539862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeL"
FT                   /locus_tag="BSUW23_02600"
FT                   /product="putative PLP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36578"
FT                   /db_xref="GOA:E0U4C0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C0"
FT                   /protein_id="ADM36578.1"
FT                   /translation="MDITPFLNRNLDIPLYQQLYRYFKENMHQGRIQKGMKLPSKRLLA
FT                   SQLSISQTTVERAYEQLAAEGYIVSKPRSGWFADYHDSDFAYRKIPSASPSQEKAQEHK
FT                   QWIDFHYGNVDSSYFPFSAWRRSMVNSLDQYGHELYRPGHVLGEFELRTLITEYLYQSR
FT                   GVHCAPEQVIIGAGNPILLQILCQVFEPNIFIGYEDPGYPRARKIFEANRMNILPIPVD
FT                   DEGICIQKIKEQQPNLVYVTPSHQFTLGTIMTINRRIELLKWAAENQSFIIEDDYDGEF
FT                   RYTGQPVPSLQGLDQHHRVIYMGTFSKSLLPSLRISYMILPSPLLKKGHEITSLYKQTV
FT                   SCHSQLTLADFIKNGEWQKHINRMRKLYRKKRAILLETVQRELGEHVRIRGENSGLRIL
FT                   LDVYLPFSEKELIEKAKEYGVKIYPVSLSYKDHPPTKTVSLGFAGVSEFNIREGIKKLK
FT                   AAWKI"
FT   gene            540260..540685
FT                   /gene="ydeM"
FT                   /locus_tag="BSUW23_02605"
FT   CDS_pept        540260..540685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeM"
FT                   /locus_tag="BSUW23_02605"
FT                   /product="putative dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36579"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C1"
FT                   /protein_id="ADM36579.1"
FT                   /translation="MKLDEFTIGQVFKTKSKTLTKDDIMRFASEFDPQYMHVDEEKANK
FT                   GRFNGIIASGIQTLAISFKLWIEEGFYGDDVIAGTEMNHIRFIKPVYPDDELHTIVKVL
FT                   DKQPKRNELGILTVLLSTYNHKEEKVFEGELSVLMKQ"
FT   gene            complement(540745..541317)
FT                   /gene="ydeN"
FT                   /locus_tag="BSUW23_02610"
FT   CDS_pept        complement(540745..541317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeN"
FT                   /locus_tag="BSUW23_02610"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36580"
FT                   /db_xref="GOA:E0U4C2"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C2"
FT                   /protein_id="ADM36580.1"
FT                   /translation="MTKQIYIIHGYRASSTNHWFPWLKKRLLADGLQADILNMPNPLQP
FT                   RLGDWLDTLSLSLHTLNENTYIVAHSVGCPAILRFLEHIQLRKQLGGIILVSGFAKSLP
FT                   ALKMLDEFTQGSFDHQKIIEAAKHRAVIASKDDQIVPFSWSKDLAQQIDAALYEVQHGG
FT                   HFLENEGFTSLPIVYDVLTSYFSKETH"
FT   gene            complement(541402..541731)
FT                   /gene="ydzF"
FT                   /locus_tag="BSUW23_02615"
FT   CDS_pept        complement(541402..541731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzF"
FT                   /locus_tag="BSUW23_02615"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36581"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C3"
FT                   /protein_id="ADM36581.1"
FT                   /translation="MNSLCRSKQAPFEFTLSLIGGKWKMRILYELGCEKTMRYGELKRA
FT                   MPLITHKMLSSQLKELQADGLIIRTEVSQIPLKVEYSLSDRGLSLYPIIDEMCKWGQTQ
FT                   GSPHE"
FT   gene            542184..543056
FT                   /gene="ydeO"
FT                   /locus_tag="BSUW23_02620"
FT   CDS_pept        542184..543056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeO"
FT                   /locus_tag="BSUW23_02620"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36582"
FT                   /db_xref="GOA:E0U4C4"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C4"
FT                   /protein_id="ADM36582.1"
FT                   /translation="MNRIEKHKKFKVKKILQVIMVIIGGIIAAYGLETVLIPNSVSDGG
FT                   VTGLSIVGSQLFNLPLGILIAVINIPFVWLGYKQIGTSFALLSIIGIISLAAGTSFFHH
FT                   TPAIIEGDTLLITVVGGIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFL
FT                   NLFVFIFVSTVFGLQGALLSVIAYYIASKMIHVVEEGLSGSKTFQIITAEPQLMVETIR
FT                   DQLGRSATYKDAYGGFSHEKFKEITCVINRLEETKLKEIINDIDKTAFVTVYDVAEVKG
FT                   SNFRKLNNH"
FT   gene            complement(543437..543598)
FT                   /gene="ydeP"
FT                   /locus_tag="BSUW23_02625"
FT   CDS_pept        complement(543437..543598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeP"
FT                   /locus_tag="BSUW23_02625"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36583"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C5"
FT                   /protein_id="ADM36583.1"
FT                   /translation="MRNRKLGIDYSLEDFEGCPVETTLDNIGGKWKGILLYHLIDGKRG
FT                   LLNLKIIS"
FT   gene            543794..544141
FT                   /gene="aseR"
FT                   /locus_tag="BSUW23_02630"
FT   CDS_pept        543794..544141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aseR"
FT                   /locus_tag="BSUW23_02630"
FT                   /product="transcriptional regulator (metals sensing
FT                   ArsR-SmtB repressors family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36584"
FT                   /db_xref="GOA:E0U4C6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C6"
FT                   /protein_id="ADM36584.1"
FT                   /translation="MAVDTKIGVAAMTHCLKTLSDQTRLMMMKLFLEKEYCVCQLVDMF
FT                   EMSQPAISQHLRKLKNAGFVNEDRRGQWRYYSINSSCPEFDTLQFLLLQIDQEDELLKH
FT                   IKQKETQSSCQ"
FT   gene            544154..545461
FT                   /gene="ydfA"
FT                   /locus_tag="BSUW23_02635"
FT   CDS_pept        544154..545461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfA"
FT                   /locus_tag="BSUW23_02635"
FT                   /product="putative metal-anion antiporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36585"
FT                   /db_xref="GOA:E0U4C7"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C7"
FT                   /protein_id="ADM36585.1"
FT                   /translation="MTSVILAVLIFLVTLVLVIWQPRNLSIGWSACGGAVLALIAGVVN
FT                   FHDVLTVTGIVWNATLAFVAIIIISLILDNIGFFEWAALHMAKAAKGNGVRMFVYVSIL
FT                   GAIVAALFANDGAALILTPIVLAMVRALHFNEKLVFPFIIASGFIADTTSLPLVVSNLV
FT                   NIVSADYFHITFIEYASRMIVPNLFSLLASIIVLYLFFRKSIPKRYDLTEVKKPVEAIK
FT                   DQNMFKLSWYILGLLLVGYFASEFFSIPVSVVAGIIAIFFLIAAQKSPAVQTKKVLKGA
FT                   PWAIVFFSIGMYVVVYGVRNAGLTDVLSDVIQAVSDQGVFAGTIGMGFIAAILSSIMNN
FT                   MPTVMIDALAIAGTDTHGMMREALIYANVIGSDLGPKITPIGSLATLLWLHVLSQKGVK
FT                   ISWGTYFKTGIILTIPTLFITLVGLYLWLMIIHSCF"
FT   gene            545477..545896
FT                   /gene="arsC"
FT                   /locus_tag="BSUW23_02640"
FT   CDS_pept        545477..545896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="BSUW23_02640"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36586"
FT                   /db_xref="GOA:E0U4C8"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C8"
FT                   /protein_id="ADM36586.1"
FT                   /translation="MSKKTIYFLCTGNSCRSQMAEGWGKEYLGDKWNVYSAGIEAHGLN
FT                   PNAVKAMKEAGIDISNQTSDIIDPNILNNADLVITLCGDAADKCPMTPPHVKREHWGFD
FT                   DPAKAQGTEEEKWAFFQRVRDEIGDRLKQFAETGE"
FT   gene            546089..546889
FT                   /gene="ydfB"
FT                   /locus_tag="BSUW23_02645"
FT   CDS_pept        546089..546889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfB"
FT                   /locus_tag="BSUW23_02645"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36587"
FT                   /db_xref="GOA:E0U4C9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4C9"
FT                   /protein_id="ADM36587.1"
FT                   /translation="MKGVVNLQELTKEKYNGLKTLIDETFCPTFVYSILEQTIPGVVYV
FT                   DDQTFPRSFFIGTESGIYFIAGDQGNRAFNDFIAGYYEEQAKSTKRFTLFSSNDIWDRV
FT                   MKTILKDELNQMKRVAFSFQQKSSITELQLPKGFVLKRIDEDIILNSTEFNKAYYEEYW
FT                   DSVSYFSSKGFGFAILHGNHVVSECTSIFLGHHRAEMDIYTLEEYRGMGLAYCVASEFI
FT                   EYCLKNGIIPSWDCDVCNNSSITLAAKLGFKKIIEYSIFYSGKS"
FT   gene            complement(547043..547180)
FT                   /locus_tag="BSUW23_02650"
FT   CDS_pept        complement(547043..547180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36588"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D0"
FT                   /protein_id="ADM36588.1"
FT                   /translation="MSALKKYVTNVTLDNVIDIQRSYKEAVQHVKQIEIKGEDKKTDHI
FT                   "
FT   gene            complement(547283..548176)
FT                   /gene="ydfC"
FT                   /locus_tag="BSUW23_02655"
FT   CDS_pept        complement(547283..548176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfC"
FT                   /locus_tag="BSUW23_02655"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36589"
FT                   /db_xref="GOA:E0U4D1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D1"
FT                   /protein_id="ADM36589.1"
FT                   /translation="MRKKTVQMIISNSLMIGLWASAFPGIRAGLEGYTPEHLALFRLLI
FT                   GSMALLLFAVLTKMRLPDIKDIPAIFLLGFLGFALYHILLNIGEKTVSAGVASLLVTTA
FT                   PIFSAMLSRLFFRGNFGFAKWIGSMISLLGVSLIAFGAGDYTYSMKGILFILLAAFSES
FT                   IYFVFQPHYIKKYGFIRFVTFSIWGGTIPMLVFLPGLGEEMINASMNSTLSIVYLGLLP
FT                   TVVPYFALAYVTSLVGTSEATLSLYATPALALLMSWLWIGEIPAFISLLGGVVTVGGVC
FT                   FTYLKSNNMELVWKRS"
FT   gene            548310..549758
FT                   /gene="ydfD"
FT                   /locus_tag="BSUW23_02660"
FT   CDS_pept        548310..549758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfD"
FT                   /locus_tag="BSUW23_02660"
FT                   /product="putative PLP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36590"
FT                   /db_xref="GOA:E0U4D2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D2"
FT                   /protein_id="ADM36590.1"
FT                   /translation="MSFTEEIKMKKLPKYRQIVHFIKEKIGNGEWPIGSQIPSQRTLAK
FT                   DFQVNRSTVITALEELMADGLIEGRMGKGTVVINNTWTLLAKNSAPNWDQYVTSGIQQP
FT                   SQKIVQEINQSESNTDLIQLSKGELSTEIFPLTAMKEMMGKVSQNMEAFGYEEPKGYLP
FT                   LREALSNYLRTFGINASSSSILIVSGALQALQLISMGLLQRGSTVYLDQPSYLYSLHVF
FT                   QSAGMKLTGLPMDNEGLLPGNLHMTRGERGRVILYTNPCFHNPTGILMSQKRREEILAA
FT                   SENTQLPIIEDDIYRELWIDEIPPCPIKTIDKNGHVLYIGSLSKTLSPGLRIGWIVGPE
FT                   PVIERLSDIKMQTDYGSSSLSQRVAAEWFTSGQYQQHLEKVRQQLKVRRELALSALETH
FT                   LKDVATWNMPKGGFFVWIKILPSISMKSLYIKALSKGILLNLGSIYAQEKGNYVRLSYA
FT                   YASLEDLQKGIYELGLIIKELASR"
FT   gene            complement(549871..550494)
FT                   /gene="ydfE"
FT                   /locus_tag="BSUW23_02665"
FT   CDS_pept        complement(549871..550494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfE"
FT                   /locus_tag="BSUW23_02665"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36591"
FT                   /db_xref="GOA:E0U4D3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D3"
FT                   /protein_id="ADM36591.1"
FT                   /translation="MNIEKQDTLHFKEIKPNIMYYGTSTFLLTTLNEDGTTNISPMSSS
FT                   WALGNYIVLGVGLGGKAIENLERHKECVINLPGPELWENVERISSYSGKKNIPPLKKQL
FT                   GFTYKKEKYESAGLTPLQSKTVAPTRIKECPIQIEAEVKHIRFPEYEPSFAIVETQALH
FT                   FHAEESIILNENHINPSKWSPLIYNFRHYFGLGREIGKTFRSET"
FT   gene            550584..551264
FT                   /gene="ydfF"
FT                   /locus_tag="BSUW23_02670"
FT   CDS_pept        550584..551264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfF"
FT                   /locus_tag="BSUW23_02670"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36592"
FT                   /db_xref="GOA:E0U4D4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D4"
FT                   /protein_id="ADM36592.1"
FT                   /translation="MNPNIAKISSLLSDPSRSSILLTLMDGRIHPAGELAHLANIKPQT
FT                   ASFHLKKLLEEKLISVEKHGRHRYYRLSNSDTAHVIEQFLRIAPKAKVTSLKDSKEKSN
FT                   LHFARTCYDHLAGYVGVQMTNSLVEQGIIKKVDVSFEVTSEGSLFFSNLGINEEQQRSK
FT                   RRAFARCCLDWSERQHHIAGALGNALLVRMLEEEWIVRMPKTRAIRITQSGKIALEKYF
FT                   KVNI"
FT   gene            complement(551329..551772)
FT                   /gene="ydfG"
FT                   /locus_tag="BSUW23_02675"
FT   CDS_pept        complement(551329..551772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfG"
FT                   /locus_tag="BSUW23_02675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36593"
FT                   /db_xref="GOA:E0U4D5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D5"
FT                   /protein_id="ADM36593.1"
FT                   /translation="MSQRVSYYDVAPEGMKMMMDMEKYTKQSSINRTTRELIKIRVSQI
FT                   NGCAFCLDMHTSDARKMGETEQRIYCLHAWNECDFYSPEEKAALELSEHITLIPSKRVP
FT                   DVLYHRVREHYDEKQYVDLVLIINQINSWNRISIAMGNQATSR"
FT   gene            complement(551861..552031)
FT                   /gene="ydzP"
FT                   /locus_tag="BSUW23_02680"
FT   CDS_pept        complement(551861..552031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzP"
FT                   /locus_tag="BSUW23_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36594"
FT                   /db_xref="GOA:E0U4D6"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D6"
FT                   /protein_id="ADM36594.1"
FT                   /translation="MYWFLGAFLYFLIGTCIFIGVIRDSHSGSWILLALAAPLIIVGYP
FT                   YFYSKQLLAKR"
FT   gene            complement(552034..552204)
FT                   /gene="ydzQ"
FT                   /locus_tag="BSUW23_02685"
FT   CDS_pept        complement(552034..552204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzQ"
FT                   /locus_tag="BSUW23_02685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36595"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D7"
FT                   /protein_id="ADM36595.1"
FT                   /translation="MKSIDLTILSLKRKGIRTEKVLKNQCLDRLSNVNEKTDKHRNKNA
FT                   QSKRTCKEKEE"
FT   gene            552535..553698
FT                   /gene="ydfH"
FT                   /locus_tag="BSUW23_02690"
FT   CDS_pept        552535..553698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfH"
FT                   /locus_tag="BSUW23_02690"
FT                   /product="two-component sensor histidine kinase (paired
FT                   with YdfI)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36596"
FT                   /db_xref="GOA:E0U4D8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D8"
FT                   /protein_id="ADM36596.1"
FT                   /translation="MLALRVPGLAFILMIYVASIVLQFLNGSWSILLLHVFTVLTAIFA
FT                   LMHWHSYRWVKKRVILYFALQGLITFTLANVMSGFLVLIIIGLYAFLIGQIIGMADRRK
FT                   TFLILYLLLLLSINVLYHIHKGEYLHFLVIAVPIMIVIITYAATFFAQVDEKIKAQLTL
FT                   ERLELAHQQVEQLTLQNERQRMARDLHDTLAQGLVSLNMQLDAIHVHLANGNTERAKEI
FT                   IQQSMKRVRGTLADARSAIDDLRSKSEEIGFLKERITSLMDHFQESTGMGGFLDYRLHQ
FT                   VLDVRTAENFYYIIGECITNAAKHAEAETVWVSIWDDDKRRLHLTVKDNGKGFDVEKGK
FT                   KKRGHYGLLGIEERVRAMKGQFNIKSTKSKGTQIEITVPIQGEMQDE"
FT   gene            553691..554332
FT                   /gene="ydfI"
FT                   /locus_tag="BSUW23_02695"
FT   CDS_pept        553691..554332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfI"
FT                   /locus_tag="BSUW23_02695"
FT                   /product="two-component response regulator (paired with
FT                   YdfH)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36597"
FT                   /db_xref="GOA:E0U4D9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4D9"
FT                   /protein_id="ADM36597.1"
FT                   /translation="MNKVLIVDDHLVVREGLKLLIETNDHYTIIGEAENGKAAVRLADE
FT                   LKPDIILMDLYMPEMSGLEAIKLIKEQHDIPIIILTTYNEDHLMIEGIELGAKGYLLKD
FT                   TSSETLFHTMDAAIRGNVLLQPDILKRLQEIRLEQMKKQSSDTQLTEKEVIVLKAIAKG
FT                   FKSKAIAFDLGVSERTVKSRLTSIYNKLGANSRTEAVTIAMQRGILTLDK"
FT   gene            554447..556618
FT                   /gene="ydfJ"
FT                   /locus_tag="BSUW23_02700"
FT   CDS_pept        554447..556618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfJ"
FT                   /locus_tag="BSUW23_02700"
FT                   /product="putative proton metabolite efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36598"
FT                   /db_xref="GOA:E0U4E0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E0"
FT                   /protein_id="ADM36598.1"
FT                   /translation="MSKMLYKLGGWVAHHRIKVICAWIVVLVASIGLAITLKPSFSEDM
FT                   SIPDTPSEKAMDVIQKEFPHGPDKGSIRVIFGAEDGEKLTAESAKKAIENTLKEINKDD
FT                   SVDSIASPFVTGTIAKDSTVAYADIKFKSSADDIKDYSIKHLKDSLKMADDAGLQTELS
FT                   GDIPGAEMEIGGVSEIVGIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIGTQ
FT                   VFDIASVSLSLAGMIGLAVGIDYALFIFTKHRQFLGEGAQKNESIARATGTAGSAVVFA
FT                   GLTVIVALCGLTVVNIPFMSAMGLTAGLSVLMAVLASITLVPAVLSIAGKRMVPKSNKK
FT                   KEKQNAETNVWGRFVTKNPIMLSVCSILILLVISIPSMHLELGLPDAGMKAKDNPDRRA
FT                   YDLLADGFGEGFNGQLTIVADATSVTENKAEAFADAVKEIKELDHVSSVTPARPNKEEN
FT                   FAIITVVPTTGPNDVATKDLVKDVRSLSDKNGVDLLVTGSTAVNIDISDRLNDAIPVFA
FT                   VLIVGFAFVLLTIVFRSLLVPLVAVAGFILTMTATLGICVFVLQDGNLIDFFKIPEKGP
FT                   ILAFLPILSIGILFGLAMDYQVFLVSRMREEYVKTKNPVQAIQAGLKHSGPVVTAAGLI
FT                   MIFVFAGFIFAGEASIKANGLALSFGVLFDAFIVRMTLIPSVMKLMGNAAWYLPKWLDK
FT                   IIPNVDIEGHQLTKEIQPEIDHEQKKQIM"
FT   gene            556743..557063
FT                   /locus_tag="BSUW23_02705"
FT   CDS_pept        556743..557063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02705"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36599"
FT                   /db_xref="GOA:E0U4E1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E1"
FT                   /protein_id="ADM36599.1"
FT                   /translation="MFSYFKNNNYSILIASNGLIEYQKAIASFYQLDRWVTEIFSIQQI
FT                   HTLNKSDFINTILQKYIIQHAAVVGDRLSDINAAKDNGLLAIGCYFDFAKEEAQADFVT
FT                   HN"
FT   gene            557439..557774
FT                   /locus_tag="BSUW23_02710"
FT   CDS_pept        557439..557774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02710"
FT                   /product="branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36600"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E2"
FT                   /protein_id="ADM36600.1"
FT                   /translation="MGCISFGLPIYDSDLGRWIAYGIFMHDIGIHAIYPSIMSFIIFTG
FT                   SMEFVAAHFLRGGFAELKLGSLIHMVHAHEKNAVSATIQFFQPAKPVGRIIAHATEIKR
FT                   SYRLGFY"
FT   gene            557966..559288
FT                   /gene="brnQ"
FT                   /locus_tag="BSUW23_02715"
FT   CDS_pept        557966..559288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="BSUW23_02715"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36601"
FT                   /db_xref="GOA:E0U4E3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E3"
FT                   /protein_id="ADM36601.1"
FT                   /translation="MSKKVSSSYVIIIGLMLFALFFGAGNLIFPPMLGQMAGTNVWIAN
FT                   AGFLVTGVGLPLLAMTAFVFSGKHNLQSLASRVHPVFGIVFTTILYLAIGPFFAIPRSG
FT                   NVSFEIGVKPFLSDDAGPVPLIIFTILFFTVACLLSLNPTKIIDVVGKFLTPIKLTFIG
FT                   LLVVIAVAHPIGTIQAPSKGYTSHVFFKGFQEGYLTLDALVAFVFGIIIVNAIKEQGAA
FT                   TKKQLVMICAKATAIAATLLALIYTALSYMGASSVEKLGLLENGAEVLAKVSSYYFGSY
FT                   GSIFLGLMITVACLTTSVGLITACSSFFHELFPNISYKKIAVILAVFSTLVANIGLTQL
FT                   IKVSMPVLMTMYPIAISLIFLTFLHTVFKGKAEVYQGSLLFTFIISLFDGLNEAGVKIE
FT                   VVNRVFTQILPMYSIGLGWFIPAIIGGLGGYILSMFRTKKS"
FT   gene            559443..559889
FT                   /locus_tag="BSUW23_02720"
FT   CDS_pept        559443..559889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36602"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E4"
FT                   /protein_id="ADM36602.1"
FT                   /translation="MAEQRKALCMRLAEIDKHEISILREFQLEREKIFSSLRALERSSK
FT                   EKKRPSQVALVEQTANDVKTYHITSKPIQQKKRRLGRAESKASREAALHILKQQDKPMS
FT                   SIDLKRKIEKETGVHISNMTSFMNTLMKMHPEVKKPYRGQYKMN"
FT   gene            complement(560354..561043)
FT                   /gene="ydfK"
FT                   /locus_tag="BSUW23_02725"
FT   CDS_pept        complement(560354..561043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfK"
FT                   /locus_tag="BSUW23_02725"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36603"
FT                   /db_xref="GOA:E0U4E5"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E5"
FT                   /protein_id="ADM36603.1"
FT                   /translation="MFGTIFNTVMIIAGSIIGGIFKKGIKDEYQNILMQAMGFAAVALG
FT                   INAITQHLPDSKYPILFIVSLALGGLLGQSINLELRFNKLVNKFSKSNLAEGLSTAILL
FT                   FCIGSLSILGPVEAALNENYTYLLTNGMLDGITSIVLASTFGFGIAAAAIVLFAWQGSI
FT                   YLFAKVMESAINTDLINEITIVGGILILSSGLSILGIKKFKTLNLLPSLLIPPVVVYVI
FT                   HVFGLRF"
FT   gene            complement(561134..561967)
FT                   /gene="ydfL"
FT                   /locus_tag="BSUW23_02730"
FT   CDS_pept        complement(561134..561967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfL"
FT                   /locus_tag="BSUW23_02730"
FT                   /product="putative transcriptional regulator of efflux
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36604"
FT                   /db_xref="GOA:E0U4E6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E6"
FT                   /protein_id="ADM36604.1"
FT                   /translation="MNRKVVKMKEFFSIGEVSKLFNVKISALRYYDEIGLLKPEYKDEH
FT                   TNYRYYSTRQFERLDTIKYLRALGLPINKLLDFYNSQNTNTLLHLLKSQQTEIDRKKRE
FT                   LERIERKISRRIMQIEDAVHTPLHHITKIKLPALRVAYLQHEYILGHDIEHSLAELRTH
FT                   LNVNEDIFIGKIGLSISAANVKANQFDKYSSIFMILEDENEETSSEIIFPSREYLQIRF
FT                   KGSHPEAEPYYKQLLAYMKEHHYKLAGDSIEITLIDYGITNHLDNYVTEILLPIK"
FT   gene            complement(562132..563025)
FT                   /gene="ydfM"
FT                   /locus_tag="BSUW23_02735"
FT   CDS_pept        complement(562132..563025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfM"
FT                   /locus_tag="BSUW23_02735"
FT                   /product="putative divalent cation efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36605"
FT                   /db_xref="GOA:E0U4E7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E7"
FT                   /protein_id="ADM36605.1"
FT                   /translation="MASEREQISKKVALIALIANLILMAGKVFFGLIGDSEAVFADGIH
FT                   SAADVVASIAVLAVIGISKKPPDQDHPFGHGKAEVISEAIVGIILMIVSVYILIEAILS
FT                   FVEGPGVPQYSALFAALISYVAKEILYRYSIKQGEKWNSKAIIAIAYDHKGDIVASLAA
FT                   FIGVLLAIIGNTRGWAYLLYADAIASAIVAYLIFKISMELIRPSVDVLMEKSVAPELIE
FT                   EYKAVIFQCDQVKRIDRIRAREHGHYKLLDVRLSLDHDLTIKQGHDIAREIRNEIKRQY
FT                   SDVEEVLIHVNPYFEE"
FT   gene            563480..564100
FT                   /gene="ydfN"
FT                   /locus_tag="BSUW23_02740"
FT   CDS_pept        563480..564100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfN"
FT                   /locus_tag="BSUW23_02740"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36606"
FT                   /db_xref="GOA:E0U4E8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E8"
FT                   /protein_id="ADM36606.1"
FT                   /translation="MAEFSQLVKERRSASNFLPDHPIAKNELNEMFELVALAPSAFNLQ
FT                   HTKYVTVLDPDVKEKLKQAANGQYKVFSSSAVLLVLGDKQAYQQAAGIYEGLKVLGVLN
FT                   KQEYDHMVQDTVSFYENKGEQFKRDEAIRNASLSAMMFMLSAKEKGWDTCPMIGFDAEA
FT                   VKQILNIGDQFEVVMMITIGKEKKESRRPRGYRKPVNEFVEYI"
FT   gene            564127..565065
FT                   /gene="ydfO"
FT                   /locus_tag="BSUW23_02745"
FT   CDS_pept        564127..565065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfO"
FT                   /locus_tag="BSUW23_02745"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36607"
FT                   /db_xref="GOA:E0U4E9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4E9"
FT                   /protein_id="ADM36607.1"
FT                   /translation="MAKNTMGIHHITAIVGHPQENADFYAGVLGLRLVKQTVNFDDPGT
FT                   YHLYFGNEGGKPGTIITFFPWAGARQGIIGDGQVGVTSYVVPKGAMAFWEKRLEKFNVP
FT                   YTKIERFGERYVEFDDPHGLHLEIVEREEGEANAWTFGDITPDVAIKGFGGATLLSAQP
FT                   DKTAELLENIMGLELVGKEGDFVRFRSAGDIGNVIDLKLTPIGRGQMGVGTVHHIAWRA
FT                   SDDEDQLEWQRYIASHGYGVTPVRDRNYFNAIYFREHGEILFEIATDPPGFAHDESPET
FT                   MGGKLMLPVQYEPHRTQIEQGLLPFEVRELD"
FT   gene            565205..565594
FT                   /gene="ydfP"
FT                   /locus_tag="BSUW23_02750"
FT   CDS_pept        565205..565594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfP"
FT                   /locus_tag="BSUW23_02750"
FT                   /product="putative membrane bound oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36608"
FT                   /db_xref="GOA:E0U4F0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F0"
FT                   /protein_id="ADM36608.1"
FT                   /translation="MEDAGLLLIRMMIGVVFLFYGSQKLFGWFGGYGIKGTGQWFESIG
FT                   VKPGNVAAALSGLGELVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGY
FT                   EYNVVLIAVSIGVALIGSGAYALHF"
FT   gene            565779..566117
FT                   /gene="ydfQ"
FT                   /locus_tag="BSUW23_02755"
FT   CDS_pept        565779..566117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfQ"
FT                   /locus_tag="BSUW23_02755"
FT                   /product="putative thioredoxin or thiol-disulfide
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36609"
FT                   /db_xref="GOA:E0U4F1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F1"
FT                   /protein_id="ADM36609.1"
FT                   /translation="MNEMTELHSLDAIDDFIKQHQFSFIYISRPGCTVCHAVLPQLRIL
FT                   LDQFPNITLGHINADDVEEVAGRFSVFTVPVLLLFIDETEFLREARFVHFEQLEERLKR
FT                   VYQLYQDE"
FT   gene            complement(566185..567570)
FT                   /locus_tag="BSUW23_02760"
FT   CDS_pept        complement(566185..567570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02760"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36610"
FT                   /db_xref="GOA:E0U4F2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F2"
FT                   /protein_id="ADM36610.1"
FT                   /translation="MKNMIFAFHHDSPKYKQVYEQFKSLIEQGHIRANEQLPSIRELAH
FT                   SLQVSRNTTLMAYDQLIAEGYIRGERRKGYFVNEIEPLLFQGKETSSQNEQTETAQHVL
FT                   IDFRPGAVDQTHFPLNRWRRLSNQMLTLEKSYLYGEPFGEKRLREQIAAYLLESRGVKT
FT                   DANSIMIGSSTQQMLIYLGQVIKDDFSGIIVEDPGYVGAREAFQLQGFTLETLPVYETG
FT                   ADFSALHQMNERLIYVTPSHHSPYGVSMSIQERQALIHWAAKKDGYILEDDYDSEFRYT
FT                   QQPFPALASIHSERVIYLGNFSKSFLPGIRLCYMVLPEPLLQRYQHRFHQFESTASLLS
FT                   QLTMAEFMKEGEWTRHIKRMRVVYKRKMQHLAASVKHQFGHHVSVIGEQSGLYILVKVH
FT                   ENCTEESLIQRALEYGVKVYPTALYFVNTPPDQPLIKLGFGHLGFDDITHGVQLLKQAW
FT                   GTA"
FT   gene            567717..568352
FT                   /locus_tag="BSUW23_02765"
FT   CDS_pept        567717..568352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02765"
FT                   /product="putative transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36611"
FT                   /db_xref="GOA:E0U4F3"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F3"
FT                   /protein_id="ADM36611.1"
FT                   /translation="MFIPAPFKLNESEAYDVIRENGFATLFSLHEGMPFATHLPLLVNA
FT                   DKSCLYGHFALQNPQWKDIIGQSVLAVFHGPHCYISPSWYETNKAVPTWNYITVHVYGE
FT                   VELLEDEKELADSMRDLVLKYESTDSSYQLEDVDPAFLAGLNKGVRGFKINISKIEGKA
FT                   KLSQNHSLLRQTLVMNQLNQIQNTDEQKISRLMKSNINRKQREGLTDK"
FT   gene            568540..568908
FT                   /locus_tag="BSUW23_02770"
FT   CDS_pept        568540..568908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36612"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F4"
FT                   /protein_id="ADM36612.1"
FT                   /translation="MKSKDVKKEGHHRGDRHKGRGGSQHHGPKTFRRGRAIAFLEMMHL
FT                   KRTTIKQQLEQPEFQSIQQMLIGELKAIDMVINEFSQLFEIHESEAKDVSKKAEDTEAF
FT                   SENGEKGREPNETNEQLY"
FT   gene            568883..569521
FT                   /gene="omtA"
FT                   /locus_tag="BSUW23_02775"
FT   CDS_pept        568883..569521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omtA"
FT                   /locus_tag="BSUW23_02775"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36613"
FT                   /db_xref="GOA:E0U4F5"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F5"
FT                   /protein_id="ADM36613.1"
FT                   /translation="MKQMNSYIDSVFSNEDDLLEEVVSSIKENGMPSISVSPSSGRLLT
FT                   MLVSISGAKHVLEIGALGGYSGICLARGFGKEGALTSLELKKEYAELAHSNLTKAGFGG
FT                   QVTYMTGAALQSLEQLVKSEKRFDFFFIDADKGNYEQYLTHCIELAKPGAVIVADNVLA
FT                   GGSVADQEAAPRRHTEVMRTFNKAVAQHPQLESLLIPIGDGMTVSKVKK"
FT   gene            complement(569597..569839)
FT                   /locus_tag="BSUW23_02780"
FT   CDS_pept        complement(569597..569839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36614"
FT                   /db_xref="GOA:E0U4F6"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F6"
FT                   /protein_id="ADM36614.1"
FT                   /translation="MNSGISIGTIIVQPIIENSLIKTLIAAAIFTIALLFMEWTFLTGK
FT                   ARIVIDHGHVHTENLKRMRLTLISLKCIRKLLANY"
FT   gene            complement(570027..570458)
FT                   /gene="cotP"
FT                   /locus_tag="BSUW23_02785"
FT   CDS_pept        complement(570027..570458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotP"
FT                   /locus_tag="BSUW23_02785"
FT                   /product="spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36615"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F7"
FT                   /protein_id="ADM36615.1"
FT                   /translation="MDIEKIRKWLEITNEYKQSDFWTNVLKHKAPEHFFDSDSYTLVYD
FT                   FYQDEENNFIIVEMPGVYEEELTIRLISKTQLLIKGTITPVFPAEMEVLRERYYGEIER
FT                   TIQLPEATESHLLQLQLLNGLLHISYPRQVETIAFHKGL"
FT   gene            complement(570471..570713)
FT                   /gene="ydgA"
FT                   /locus_tag="BSUW23_02790"
FT   CDS_pept        complement(570471..570713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgA"
FT                   /locus_tag="BSUW23_02790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36616"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F8"
FT                   /protein_id="ADM36616.1"
FT                   /translation="MPYQINIANIKVNGVTQNGNVDIGPTLHSSHTANSKYFGANFSLG
FT                   DFSPASSLLNTGNLDTDVSDQDKIGNFSAPIANQI"
FT   gene            complement(570727..570999)
FT                   /gene="ydgB"
FT                   /locus_tag="BSUW23_02795"
FT   CDS_pept        complement(570727..570999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgB"
FT                   /locus_tag="BSUW23_02795"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36617"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4F9"
FT                   /protein_id="ADM36617.1"
FT                   /translation="MPTTVINLYYLKINSISGNGSITIGEAAYNSPTNNQKSQGINSSF
FT                   GDTSPTESVMENFLNDPDVNDQTSIGNSDTSSVNAPPIVPPPILD"
FT   gene            571239..571838
FT                   /gene="ydgC"
FT                   /locus_tag="BSUW23_02800"
FT   CDS_pept        571239..571838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgC"
FT                   /locus_tag="BSUW23_02800"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36618"
FT                   /db_xref="GOA:E0U4G0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G0"
FT                   /protein_id="ADM36618.1"
FT                   /translation="MKSKKGRKGEESRKRLLEAAANEFAIRGFHETKVSEIVKRAGLTQ
FT                   PSFYLYFQSKEAIFDELITDFHSRVRKLTESLLLEGGLNPEDVSKRVLSAVETVFQCLA
FT                   EDKDVTKIGFFLNPEAKQMKKDLAVVLKDNLEAEQRLGYFHSELDMETVAECLIGMIEH
FT                   LTDSFLLTGIKDPASLAAQVVNLLIYGMLPKGRDVR"
FT   gene            571835..572179
FT                   /gene="ydgD"
FT                   /locus_tag="BSUW23_02805"
FT   CDS_pept        571835..572179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgD"
FT                   /locus_tag="BSUW23_02805"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36619"
FT                   /db_xref="GOA:E0U4G1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G1"
FT                   /protein_id="ADM36619.1"
FT                   /translation="MISMIMKVSLAAFMLVGGIIKVFRVPFQVEHWRHYQYPLWFLTVT
FT                   GILEIAGALAMTAGIWNRYAAFGAGVLFVVLMAGAVHAHMVRAHQSFLMTIPAMICLIV
FT                   SIMIMIREFT"
FT   gene            572333..572806
FT                   /gene="ydgE"
FT                   /locus_tag="BSUW23_02810"
FT   CDS_pept        572333..572806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgE"
FT                   /locus_tag="BSUW23_02810"
FT                   /product="putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36620"
FT                   /db_xref="GOA:E0U4G2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G2"
FT                   /protein_id="ADM36620.1"
FT                   /translation="MTLTLEDMSVEEFEAFRGMSVQNYAKQNIKSGTWTEKEAFEKSEQ
FT                   VYEKMIPDGRSSSNHYFWSITNEQGERMGWLWLYADPFHPQKEAFIYSFGLYEAFRGKG
FT                   LAQLALQTLDERARELGAERLALHVFAHNETAVYLYQKMGYAMSNIRMRKQLF"
FT   gene            complement(572817..573188)
FT                   /locus_tag="BSUW23_02815"
FT   CDS_pept        complement(572817..573188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02815"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36621"
FT                   /db_xref="GOA:E0U4G3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G3"
FT                   /protein_id="ADM36621.1"
FT                   /translation="MQKNNSNKQSEVGHMTEDFYCDEVFSGKTKVNKVLETDNVLAYYH
FT                   TKPFYPVHIVAVPKKHISSLITLEEHDHDLLLELMGVIQKVASMVTEEKGACRVITNLG
FT                   AYQDSTHLHWHIVFGEPLK"
FT   gene            573498..574523
FT                   /gene="idh"
FT                   /locus_tag="BSUW23_02820"
FT   CDS_pept        573498..574523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idh"
FT                   /locus_tag="BSUW23_02820"
FT                   /product="putative inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36622"
FT                   /db_xref="GOA:E0U4G4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G4"
FT                   /protein_id="ADM36622.1"
FT                   /translation="MGNVQVGLLGAGRMGAFHGESIAFRVKGADLYAIADPVPGNAEAF
FT                   AKKLGSNIKAFTNPLDMLEHPDIDAVIIASPARTHAANIIAAAKKGKAVFCEKPMAVTL
FT                   EEADEVIRVVNEESVSLQIGFNRRFAKGFRSAYEEIRAGKIGTPQLMRSITRDPALGDP
FT                   TSIPQWTIFLETLIHDFDTLLYLNPNAKPIEVYAAADALVRPDFKDKGFLDTAVVTIKF
FT                   DNGAIATAEANFQAVYGYDVRGEVFGSEGMLTIGDIRHTNMTRYNKDGVSYNTIRYDQD
FT                   LLFDAYVDELQSFVDAVRNHKPTSVTGEDARAALAIAAACIESCKTKQPVTLKDGVPQT
FT                   V"
FT   gene            574617..575621
FT                   /locus_tag="BSUW23_02825"
FT   CDS_pept        574617..575621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02825"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36623"
FT                   /db_xref="GOA:E0U4G5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G5"
FT                   /protein_id="ADM36623.1"
FT                   /translation="MKTTIYDVAKEANVSISTVSKVLNHTGNISEKTKKRIWKVIEELQ
FT                   YQPSVVTSTRKMMKTIGLLIPDIANPFMAELARAVEDSGRKKDFSVIICSTDNNSLREE
FT                   EYITMLKQKHVDGIIVATGLKNSQAIRELIESDMPVVMLSRDIPHLPVDTVVADDFKGG
FT                   YEAAVHLAQLGHTNIAVIAEKINNTSIKNRVIGFKEGLQVSGIKIDESAVLDCPYDLSA
FT                   SKDISLKLLHQKHRPTAVFVTTELLGLGVLQAARQLHISIPSSLSLVGFDNSILAKISD
FT                   PQLTTIAQPTEEMGEKAIELLIDGMAHSKQKKAVQRVMLSPSLIVRDSTASLL"
FT   gene            575707..576027
FT                   /locus_tag="BSUW23_02830"
FT   CDS_pept        575707..576027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02830"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36624"
FT                   /db_xref="GOA:E0U4G6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G6"
FT                   /protein_id="ADM36624.1"
FT                   /translation="MTSKKAYISLIYFFGALGGLLFGYDTGVISGALLFIREDMELTPF
FT                   LEGLVVSGVLIGALVGAAFCGRFSDRYGRKKTIIWLGVLFTQLEPLEQAWLIISEYYCY
FT                   SE"
FT   gene            577068..577889
FT                   /locus_tag="BSUW23_02845"
FT   CDS_pept        577068..577889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02845"
FT                   /product="xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36625"
FT                   /db_xref="GOA:E0U4G7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G7"
FT                   /protein_id="ADM36625.1"
FT                   /translation="MGREYGLCLWTFGSIPFEQKCRLAAEIGVDGVEVEGDISLNPKDL
FT                   AETLAAHHVKVLSVTPRNVDISSTNERVRSKAVHYFLDLLDWAVDLGAPRICLHGEVGK
FT                   VRGSGDDERDWSLLVESSKKIMAKAEELQIQVVFEVLNRYENHQVVTGEEALQFIRDVG
FT                   SSKLDVLLDAYHMNIEEADPVKAIELTGQKLGVYHVADSNRQAIGNGHANLKEQIEALH
FT                   SIGYKGPIIMEMVAAGPDPFTPVKGNSYLEVVTGYFKSSLETLRSWEGLKI"
FT   gene            578139..579320
FT                   /locus_tag="BSUW23_02850"
FT   CDS_pept        578139..579320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02850"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36626"
FT                   /db_xref="GOA:E0U4G8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G8"
FT                   /protein_id="ADM36626.1"
FT                   /translation="MEVQVEKIHTVKMWSLSFIFVTLSNAFLFMVFEMLLPTLPLFVTA
FT                   IGGGAKQVGLVTGIFMISAIAIRPFAGVLAKRFNKKYLLIFGIVISASSTGAYYLASDV
FT                   SVLLLIRLIHGAGFGLATTYFATIAAEIIPKERRGEGIGYFGVGETIAVSVGPMIGIAA
FT                   LELYDFERLFLGGMSILLLAVLMAVLVRRRPEARDTAEKGMVKVKVLEKRVLFPSFLIL
FT                   LVGIAASGIMSFFSLYAIEKGFRSVGMFFFLIAAASFLIRLISGKIFDRFGAAGILIPA
FT                   SIFSIVGLSILYIAQTNAMFFTAAICYGFGFGSIFPAIQTWCINLVDEHEHEDAMGTFF
FT                   NFFDMGIGGGSLLLGVVATIYSYQELYIASVLVYLLFLLLYILFICSKRKRMK"
FT   gene            579339..579899
FT                   /locus_tag="BSUW23_02855"
FT   CDS_pept        579339..579899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02855"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36627"
FT                   /db_xref="GOA:E0U4G9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4G9"
FT                   /protein_id="ADM36627.1"
FT                   /translation="MTRENIKRTAVRQFNELGYEGVKMAHIAKELGIRKQSLSYHFSSK
FT                   KDLLMEVYPEIVEEEVAFINDFFESRKHMPAKNLIYDFLKETQVRFHAMPNVAFLQAMS
FT                   FKAPAEVSDFISAQYLMFLHALKSRVALVFKESGITCPPEKCAIAFITLFDGLNIQLVY
FT                   ENKQSFERSLEISFDIFWRGLKA"
FT   gene            complement(579946..581574)
FT                   /gene="vmlR"
FT                   /locus_tag="BSUW23_02860"
FT   CDS_pept        complement(579946..581574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vmlR"
FT                   /locus_tag="BSUW23_02860"
FT                   /product="ATP-binding cassette efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36628"
FT                   /db_xref="GOA:E0U4H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H0"
FT                   /protein_id="ADM36628.1"
FT                   /translation="MKEIVTLTNVSYEVKDMTVFKNVNASVQQGDIIGIIGKNGAGKST
FT                   LLHLIHNDLAPAQGQILRQDLKMTLVEQETASYSFEEQTPAEKKLLEKWRVPVRDFQQL
FT                   SGGEKLKARLAKGLSEDADLLLLDEPTNHLDEESLQFLIQQLKSYRGTVILVSHDRYFL
FT                   DKAATKIWSLEAQTLIEFKGNYSGYMKYREKKRLAQQREYEKQQKMVERIEAQMNELAS
FT                   WSEKAHAQSTKKEGFKEYHRVKAKRTDAQIKSKRKRLEQELEKAKAEPVEPEYTVRFSI
FT                   DTTKKTGKRFLEVQHVTKAFGERTLFKNAHFTIQHGEKVAIIGSNGSGKTTLLKIILGQ
FT                   ETAEGSVWVSPSANIGYLTQEVFDLPLEQTPEELFENETYKARGHVQNLMRHLGFTASQ
FT                   WTEPIKHMSMGERVKVKLMAYILEEKDVLILDEPTNHLDLPSREQLEETLSHYSGTLLA
FT                   VSHDRYFLEKTTNSKLVISDNGIEKQLVDVPSERNDREELRLKLETERQEVLGKLSFMT
FT                   PNDKGYKELDQAFNELTKRMKELDQ"
FT   gene            complement(581906..583282)
FT                   /gene="ydgF"
FT                   /locus_tag="BSUW23_02865"
FT   CDS_pept        complement(581906..583282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgF"
FT                   /locus_tag="BSUW23_02865"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36629"
FT                   /db_xref="GOA:E0U4H1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H1"
FT                   /protein_id="ADM36629.1"
FT                   /translation="MTDDMTKDNINQQKLERGLKNRHIQLIAIGGAIGTGLFLGSGKSI
FT                   HFAGPSILFAYMITGIICFLIMRSLGELLLSNLNYHSFVDFVQDYLGDMAAFITGWTYW
FT                   FCWISIAMADLTAVGLYTQYWLPGVPQWVPGLIALIILLIMNLATVKLFGELEFWFALI
FT                   KVIAILALIVIGLVMIFKGFSTSSGVSSFTNLWSHGGMFPNGMHGFILSFQMVVFAFVG
FT                   IELVGLTAGETENPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWNVINPSESPFVQV
FT                   FVAVGIVGAASIINFVVLTSAASACNSAVFSTSRMVYSLAKDNNAPESMAKLTPRKVPR
FT                   NALFFSAIVILIGVTLNYIMPEGVFTLITSISTVCFIYIWGITVICHMKYRKTRPELAK
FT                   TNKFKLPLYPFTNYLILAFLAFILVVLALAQDTRVSLFVTPVWFILLIVIYKVRKAKHQ
FT                   "
FT   gene            complement(583457..583975)
FT                   /gene="dinB"
FT                   /locus_tag="BSUW23_02870"
FT   CDS_pept        complement(583457..583975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="BSUW23_02870"
FT                   /product="nuclease inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36630"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H2"
FT                   /protein_id="ADM36630.1"
FT                   /translation="MSDFSLTLYEYNVWANQQIFNRLKELPKEVYRQEIQSVFPSISHV
FT                   LSHVYLSDLGWIEVFSGKSMTDALMLAEQLKEQTEAKEMEEMEALFLTLSERYTLFLQQ
FT                   KEQLNKPLQIKNPSGGIMKTTVSELVPHVVNHGTYHRGNITAMLRQTGYASAPTDYGLY
FT                   LYMKKTEMA"
FT   gene            584139..584600
FT                   /gene="ydgG"
FT                   /locus_tag="BSUW23_02875"
FT   CDS_pept        584139..584600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgG"
FT                   /locus_tag="BSUW23_02875"
FT                   /product="putative transcriptional regulator (MarR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36631"
FT                   /db_xref="GOA:E0U4H3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H3"
FT                   /protein_id="ADM36631.1"
FT                   /translation="MLNEQKLCQAINLFVEVLLEGTEFVHHEINQDVFKNISREQADLL
FT                   KILKVKGPTSPGSLAMYQNVHKSAISNRLKKLLDKRLVEWDDCPAKSDKRSKLINITTS
FT                   GETILEELDSAIFNALKELIDDIDEKHLNSIIEIFTILKSKFKGGDSAE"
FT   gene            584597..587254
FT                   /gene="ydgH"
FT                   /locus_tag="BSUW23_02880"
FT   CDS_pept        584597..587254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /locus_tag="BSUW23_02880"
FT                   /product="putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36632"
FT                   /db_xref="GOA:E0U4H4"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H4"
FT                   /protein_id="ADM36632.1"
FT                   /translation="MRAIIKFKWAIAAVILALTVVLSLFSPNLTELANQKGQAQLPADA
FT                   VSERANAILKQAGEDNNSISIVFTLDHALKKETEDQLRKMIDKVKKIDGVEEVTSPLTA
FT                   EKEVKDQLISKDKKTLLIPVTITGSDKKAEKIADDIYKIVPDDLTAYITGASLINQDFA
FT                   HSSEEGLKKTEVITVCLIIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGILVYNVDF
FT                   PISTFTQTFLVAILFGIGTDYCILLLTRFREELANGHDKKEAALIAYRTGGKTLFISGF
FT                   AVLIGFSALGFAKFAIFQSAVGVAVGVGILMVILYTLLPLFMVTLGEKLFWPSKKVLSH
FT                   SDNKLWAFLGRHSVVRPFLFIVITVIITLPFILTYDDQISFDSTAEISSDYKSVKALEA
FT                   IKDGFGEGKAFPINVVVKGDKDLTTADTIPYLGNISKAIEKVEHVDSVMTITQPTGEKI
FT                   KDLYIDKQLGSVSDGLDKTVKGIADVQSGLTDIENGLNQMAGQTGSASNSRSGGSLGDA
FT                   ADGLGKINQQLQLVSKQISQTGNTAQTVQQLTAISGQLGQIQTGLEQANQQLSGQQAQA
FT                   GTLTESLQQLAGGVKSANDGLTKISDGITASSDMLEDMSKSSTVRDTGIFIPDQVMKDK
FT                   DFKKSIDQYSFADGKGVQLSVVLDSNPYSEQAITTINQIKKAVANEVDGTPLEDAQIVY
FT                   GGVTSVNADLKELSTTDFSRTMVIMIIGLFIVLTILFRSMIMPIYMIASLLLTYYTSIS
FT                   ITELIFVNGLGNAGVSWAVPFFSFVILIALGVDYSIFLLDRFKEEVHLGIVQGVVRSMS
FT                   KMGSVIITAAIILAGTFAAMMPSGVNTLMQVASVIIIGLLLYGLVILPLFIPAIIMTFG
FT                   EGNWWPFGRKKIKE"
FT   gene            complement(587342..587971)
FT                   /gene="ydgI"
FT                   /locus_tag="BSUW23_02885"
FT   CDS_pept        complement(587342..587971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgI"
FT                   /locus_tag="BSUW23_02885"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36633"
FT                   /db_xref="GOA:E0U4H5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H5"
FT                   /protein_id="ADM36633.1"
FT                   /translation="MIKTNDFMEIMKGRRSIRNYDPTVKISKEEMTEILEEATTAPSSV
FT                   NAQPWRFLVIDSPEGKEKLAPLASFNQTQVTTSSAVIAVFADMNNGDYLEEIYSKAVEL
FT                   GYMPQEVKDRQIAALTAHFEKLPAQVNRETILIDGGLVSMQLMLTARAHGYDTNPIGGY
FT                   DKENIAETFGLDKERYVPVMLLSIGKAADEGYASYRLPIDKIAEWK"
FT   gene            complement(587987..588421)
FT                   /gene="ydgJ"
FT                   /locus_tag="BSUW23_02890"
FT   CDS_pept        complement(587987..588421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgJ"
FT                   /locus_tag="BSUW23_02890"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36634"
FT                   /db_xref="GOA:E0U4H6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H6"
FT                   /protein_id="ADM36634.1"
FT                   /translation="MASFCSEEAEILYQLQGVNKVIGVKFEACTGISQSRLELLSLLYH
FT                   ADEISQSDLQKKVNIDSAAVTRHLKQLEAKGMVSRRRKPEDNRITLVRLTDQGRERIET
FT                   SKKEKERFMKEMLANVSAEERRLLIDVLARMRNNIDNIEA"
FT   gene            complement(588566..589123)
FT                   /locus_tag="BSUW23_02895"
FT   CDS_pept        complement(588566..589123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02895"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36635"
FT                   /db_xref="GOA:E0U4H7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H7"
FT                   /protein_id="ADM36635.1"
FT                   /translation="MDDIQAIIAMNLVKLRKNRNLTLDQVSELTGVSKAMLGQIEKGKS
FT                   TPTVTTLWKIANGLQVSFSVFLKEDKPKVRKINLQDIEPVTDNEENYSVYPFFPYNPET
FT                   KFEIYVVDLKPGCIHEAKTHLGEEYILIKEGELTVILQGQEHMLASGDALQFTGSTPHS
FT                   YINSSEETASFFLLMFYPEPQG"
FT   gene            589242..589967
FT                   /locus_tag="BSUW23_02900"
FT   CDS_pept        589242..589967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02900"
FT                   /product="putative AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36636"
FT                   /db_xref="GOA:E0U4H8"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H8"
FT                   /protein_id="ADM36636.1"
FT                   /translation="MISEKEMTQAKTDEPTFLQGFQDCVPTLVGYISVGLALGIVGVAS
FT                   HLSVMEIVFMSGLVFAGGAQFIMCALLAANSPMSAIILTTFIVNLRNFLLSAALAPHFS
FT                   KYSLAKNVGIGMMVTDESFGVASNKIVKNEPINDRWMFGLNLTAYACWVLSCVAGAVFG
FT                   KWITNPESFGLDFAVTAMFLALLVLQLEHVVPAKIKHYVSLIIYMVIAMVVSSFFMPSH
FT                   LAVIISTVIVATIGVVTDK"
FT   gene            589964..590287
FT                   /locus_tag="BSUW23_02905"
FT   CDS_pept        589964..590287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02905"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36637"
FT                   /db_xref="GOA:E0U4H9"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4H9"
FT                   /protein_id="ADM36637.1"
FT                   /translation="MSINTYVLMVIIGCALVTMIPRIIPFLVVRNITLPEPVLKWLSYV
FT                   PVCILTALVVKDCMIQSHGTLQLNWPAAVILIPTLLIAMKTKSLSITVISGVLLMAGLR
FT                   LWV"
FT   gene            590483..591691
FT                   /gene="ydgK"
FT                   /locus_tag="BSUW23_02910"
FT   CDS_pept        590483..591691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgK"
FT                   /locus_tag="BSUW23_02910"
FT                   /product="putative efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36638"
FT                   /db_xref="GOA:E0U4I0"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4I0"
FT                   /protein_id="ADM36638.1"
FT                   /translation="MLHNPTGKERLALAFLLGMLAILGPLNIDMYLPSFPEIADDLSAS
FT                   ASLVQLSLTACLVGLTIGQLIVGPVSDAQGRRKPLLICIFLFALSSLFCALSPNITTLV
FT                   AARFLQGFTASAGLVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFHVLTIIGFLLVLLIAFRLKETLPPENRIPSSIGTSVKTMGSLLKDRSFMGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSILFGINGLAIISGSFIIGRFGGIIH
FT                   EKSLLRMAVITAMIATAVLLTMTMIHGPLATLVISIFIYMITIGMVLTSTFTLAMERQG
FT                   HRAGSASALLGMLPLLLGSIVSPLVGINETTAIPMGAIMFVTAVIGALAFFGLTKERAG
FT                   QNS"
FT   gene            complement(591727..592464)
FT                   /gene="ydhB"
FT                   /locus_tag="BSUW23_02915"
FT   CDS_pept        complement(591727..592464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhB"
FT                   /locus_tag="BSUW23_02915"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36639"
FT                   /db_xref="GOA:E0U4I1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4I1"
FT                   /protein_id="ADM36639.1"
FT                   /translation="MLIILVMFLLGIILGFIGAGGAGFVIALLTLLFHVPIHTALGTSL
FT                   AGMAFTSLSGAYSHYREGNIQMKIGLTVGCFAAVGSFFGAKLTSFIPADLLHYLTAGML
FT                   FLSAILILIRLFLLKEKAQVNQSSLSTYTRAVILGIVAGVLSGTFGIGSAPFIQIGLMI
FT                   MLNLSIRHSVGTTMLVIIPLAVGGGIGYITEGFVDYVLLIKVLVGTMCGAYVGAKFTNL
FT                   MPKVVLKSAIFLTPAIAGLLLLF"
FT   gene            592713..593387
FT                   /gene="ydhC"
FT                   /locus_tag="BSUW23_02920"
FT   CDS_pept        592713..593387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhC"
FT                   /locus_tag="BSUW23_02920"
FT                   /product="putative transcriptional regulator (GntR family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36640"
FT                   /db_xref="GOA:E0U4I2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4I2"
FT                   /protein_id="ADM36640.1"
FT                   /translation="MDDFKLDKPTPYYLQFYNQLKKMIFNGTFKPGERINETQLAKSFG
FT                   VSRSPIREAMRLLEKDGLLKADDRNGFSITSLTAKDVDEIYKIRIPLEQLAVELVIDEA
FT                   DEKELAILEKQLEETEKAIHNGTEDTEIIHLNQNFHELLVDFSHNRHLKNLLEHVNDLI
FT                   HFCRILNYTGDHRAETILSEHRKILEEVKKKNKEAAKQYVMAHFNHDCEHLKHVLEEGK
FT                   EN"
FT   gene            593511..594773
FT                   /gene="ydhD"
FT                   /locus_tag="BSUW23_02925"
FT   CDS_pept        593511..594773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD"
FT                   /locus_tag="BSUW23_02925"
FT                   /product="spore cortex lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36641"
FT                   /db_xref="GOA:E0U4I3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4I3"
FT                   /protein_id="ADM36641.1"
FT                   /translation="MFIHIVRPGESLFSIGRSYGASVDQIRGVNGLDETNIVPGQALLI
FT                   PLYVYTVQPGDTLTAIAAKALVPLERLRAANPGISPNTLQAGAKITIPSISNYIAGTLS
FT                   FYVLRNPDLDRELINDYAPYSSSISIFEYHIAPNGDIANQLNDAAAIETTWQRRVTPLA
FT                   TITNLTSEGFSTELVHQVLNNPTARTNLVNNIYYLVSTRGYGGVTIDFEQVSAADRDLF
FT                   TGFLRQLRDRLQAGGYVLTIAVPAKTSDNIPWLRGYDYGGIGAVVNYMFIMAYDWHHAG
FT                   SEPGPVAPITEIRRTIEFAIAQVPSRKIIIGVPLYGYDWIIPYQPGTVASAISNQNAIK
FT                   TAMRYQTPIQYSAEYQSPFFRYSDQQGRTHEVWFEDVRSMSRKMQIVREYRLQAIGAWQ
FT                   LTLGFTPGPWLLRKFFTIRKV"
FT   gene            594932..596116
FT                   /gene="ydhE"
FT                   /locus_tag="BSUW23_02930"
FT   CDS_pept        594932..596116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhE"
FT                   /locus_tag="BSUW23_02930"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36642"
FT                   /db_xref="GOA:E0U4I4"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="UniProtKB/TrEMBL:E0U4I4"
FT                   /protein_id="ADM36642.1"
FT                   /translation="MKTVLILNFPAEGHVNPTLGITKAFADRGYDVHYISTEKYKERLE
FT                   AVGATVHLHQDLLRTTPINIASPNGILDFLKIHIKTSLDILHIVKELSKSIQFDFVYYD
FT                   KFGAGELVRDYLNIPGISSSASFLFGEEHLKILPLHPDSEVPLQLDKQCEDLLLEMKQN
FT                   YGVSPENMVQFMNNKGELNVVYTSRYFQPESHRFGDEFLFIGPSFPKRAEKTDFPTDKL
FT                   KDEKVIYISMGTVLDETEEFFNLCIDAFSDVKGKVVIAAGEKADLTKLKQAPENFIIAS
FT                   YVPQLEVLEQSDVFITHGGMNSVNEGIHFNVPLVVMPHDKDQPMVAQRLTELQAGYTVS
FT                   KDHVTAQSLKHAVEEVLNNDRYKEGIQKINRSFQDCMNMEEVMERIDQFIEQRK"
FT   gene            596652..597224
FT                   /locus_tag="BSUW23_02935"
FT   CDS_pept        596652..597224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_02935"
FT                   /product="triple helix repeat-containing collagen"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36643"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR041415"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG2"
FT                   /protein_id="ADM36643.1"
FT                   /translation="MGATGATGEAGPAGATGATGATGDVGPAGATGATGEAGPTGATGA
FT                   TGATGTGAAGLSEYGYIYNLSAQTVAIEADVIFDSTGITTPGITHAPGTSQIAITTPGD
FT                   YEVTFSVSGVEPNQFTLFLNGAPITNTVYGSGAGTQQNNGQAIIAIAAGDVLTLRNHTS
FT                   AAAVTLQTLAGGTQTNVNASIVIKKLD"
FT   gene            complement(597816..598523)
FT                   /gene="ydhF"
FT                   /locus_tag="BSUW23_02940"
FT   CDS_pept        complement(597816..598523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhF"
FT                   /locus_tag="BSUW23_02940"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36644"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG3"
FT                   /protein_id="ADM36644.1"
FT                   /translation="MKRILSIFVFAIVLAGCSSNANTEKQSAGGEQAKATPQSTSSQKD
FT                   SIDEYQPNSQVTDDRSLLKVGQTFSDDKGKAVLKDIKQVNQTYKIGDVELTVKEMKLIH
FT                   LRPDYSMIDYFHVLTHDEEFDFVKVFVDIKNTSSKKVNVAPIALMKTNTGETFDWNKDI
FT                   YLEELNGELEGGAEKSGNLGFIVNASSGHAHDEDADNKKKEKEIKWIEITTSDVFDHNH
FT                   KKISDAQKIKIEF"
FT   gene            complement(598589..599977)
FT                   /gene="phoB"
FT                   /locus_tag="BSUW23_02945"
FT   CDS_pept        complement(598589..599977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="BSUW23_02945"
FT                   /product="alkaline phosphatase III"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36645"
FT                   /db_xref="GOA:E0TTG4"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG4"
FT                   /protein_id="ADM36645.1"
FT                   /translation="MKKFPKKLLPIAVLSSIAFSSLASGSVPEASAQEKKKGNQDEIKN
FT                   VIVLIGDGMGVSYTSAHRYLKDNKKTKFVAPTTFDQYLVGQQTTYPEDPEQNVTDSASA
FT                   ATAMSAGIKTYNNAIAVDNDGSEAKTVLEAAKEKGKSTGLVATSEITHATPASFGSHDH
FT                   SRKNMNSIADDYFDEMVNGKHKIDVLLGGGKSNFDRKDRNLIKEFKKAGYSYVDNRKDM
FT                   LKNKDSQVLGLFADGGLPKKIDRTKDIPSLKDMTNTAIKKLSKDKDGFFLMVEGSQIDW
FT                   AGHDNDIVGAMSEMDDFEQAYKAAIDFAKKDKHTLVVATADHSTGGYSIGADGIYNWFS
FT                   EPIKAAKRTPDFMAEKIADGADVEKTLKTYIDQKKLALTESEIQSVKKAAKSKEVLEID
FT                   NAIEEIFNKRSHTGWTTGGHTGEDVPVYAYGPSSETFAGQIDNTQIAKNVFKALQYNIK
FT                   INDK"
FT   gene            complement(600452..600937)
FT                   /gene="ydhH"
FT                   /locus_tag="BSUW23_02950"
FT   CDS_pept        complement(600452..600937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhH"
FT                   /locus_tag="BSUW23_02950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36646"
FT                   /db_xref="GOA:E0TTG5"
FT                   /db_xref="InterPro:IPR032545"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG5"
FT                   /protein_id="ADM36646.1"
FT                   /translation="MSSHYKYPLIFMASLLLAFCLIFFSYQLIHHMGMEYPNWQGESKD
FT                   QDWKAVFTKNEDAPNEYSGNLYWIGDTDKADSTYVESLIVKKDDEILLSSDTEIPIRDY
FT                   SGGTSLDGSAKEESISFLERLDEHELKGHDITIEVKWKQGDHYSASQLTLNEKTLFD"
FT   gene            complement(600956..601375)
FT                   /gene="ydhI"
FT                   /locus_tag="BSUW23_02955"
FT   CDS_pept        complement(600956..601375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhI"
FT                   /locus_tag="BSUW23_02955"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36647"
FT                   /db_xref="GOA:E0TTG6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG6"
FT                   /protein_id="ADM36647.1"
FT                   /translation="MGFTRDGDFQRHFFRCDELDGYAALDEDGEIIGCITYVIDGKDCE
FT                   IISLDSIIEKKGIGTALLQQVEETAKHSHCQRIKLITTNDNVHAMAFYQKRGYQFAALF
FT                   PNAVEKARRLKPEILEKAENGILIRDEILFSKLID"
FT   gene            601516..602493
FT                   /gene="ydhJ"
FT                   /locus_tag="BSUW23_02960"
FT   CDS_pept        601516..602493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhJ"
FT                   /locus_tag="BSUW23_02960"
FT                   /product="putative metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36648"
FT                   /db_xref="GOA:E0TTG7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG7"
FT                   /protein_id="ADM36648.1"
FT                   /translation="MEINDVIYGQHHIDGVLEELIKSAPVQRLKGVYQGGASFLVNRKW
FT                   DVTRYEHSIGVMLLIKKLGGTIEEQIAGLLHDVSHTAFSHVIDVVFENEAEDYHENIFQ
FT                   QVIIHSEIPGILKKHGYDVEELLSDDTRWTLLEQPAPELCADRTDYTLRDMYRYGHISL
FT                   HEAQTFLDHLIVRNGRMFPDGIEAAEWFVRVYYEEVIDFFLNPVNVYGYEYLAQTLKAA
FT                   LRHNVISAEDLLKTDQEVLDILHAAKNKEVLNLLQHIHPRIQVKEDNIQYDFHQKKKMR
FT                   LIDPSILHHDEWVKASAVSENVRKMGEAAYQRAKKGVYIKVLHH"
FT   gene            602702..603268
FT                   /gene="ydhK"
FT                   /locus_tag="BSUW23_02965"
FT   CDS_pept        602702..603268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhK"
FT                   /locus_tag="BSUW23_02965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36649"
FT                   /db_xref="InterPro:IPR011438"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG8"
FT                   /protein_id="ADM36649.1"
FT                   /translation="MKVSKKALGILMLSLIFVLSACGNNSSTKENNHENHSGSSSHEEM
FT                   EHSGSADVPEGLQESKHPKYKVGSQVVINASHMKGMKGAEATVTGAYDTTAYVVSYTPT
FT                   NGGQRVDHHKWVIQEEIKDAGDKTLNPGGQVILEASHMKGMKGATAEIDSAEKTTVYMV
FT                   DYTSTTSGEKVKNHKWVTEDELSAK"
FT   gene            complement(603440..604606)
FT                   /gene="pbuE"
FT                   /locus_tag="BSUW23_02970"
FT   CDS_pept        complement(603440..604606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuE"
FT                   /locus_tag="BSUW23_02970"
FT                   /product="purine efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36650"
FT                   /db_xref="GOA:E0TTG9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTG9"
FT                   /protein_id="ADM36650.1"
FT                   /translation="MNFKVFLLAASTIAVGLVELIVGGILPQIANDLDISIVSAGQLIS
FT                   VFALGYAVSGPLLLALTAKIERKRLYLIALFVFFLSNLVAYFSPNFATLMVSRVLAAMS
FT                   TGLIVVLSLTIAPKIVAPEYRARAIGIIFMGFSSAIALGVPLGILISDSFGWRILFLGI
FT                   GLLALVSMLIISIFFERIPAEKMIPFREQLKTIGNLKIASSHLVTMFTLAGHYTLYAYF
FT                   APFLEETLHLSSFWVSICYFLFGISAVCGGPFGGALSDRLGSFKSILLVTGSFAIIMFL
FT                   LPLATSSMIFFLPVMVIWGLLSWSLAPAQQSYLIEIAPDSSDIQQSFNTSALQVGIALG
FT                   SAIGGVVLDQTGTVVSTAWCGGSIVIIAVLFAFISLTRPVQTVKKSSL"
FT   misc_binding    complement(604660..604760)
FT                   /bound_moiety="adenine"
FT                   /note="adenine riboswitch leader; regulates the expression
FT                   of pbuE; adopts a a transcription terminator structure in
FT                   the absence of the adenine ligand; BSUW23_misc_RNA_8"
FT   gene            604938..605249
FT                   /gene="gmuB"
FT                   /locus_tag="BSUW23_02975"
FT   CDS_pept        604938..605249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuB"
FT                   /locus_tag="BSUW23_02975"
FT                   /product="oligo-alpha-mannoside phosphotransferase system
FT                   enzyme IIB"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36651"
FT                   /db_xref="GOA:E0TTH0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH0"
FT                   /protein_id="ADM36651.1"
FT                   /translation="MKKILLACSSGMSTSLLVTKMKEYAQSIGEEAEIWAVGQDKAKED
FT                   MRNADAVLIGPQMSFLKSELQKEADQYNIQVEVIDMMAYGMADGKKAYEQALSLMENH"
FT   gene            605249..605581
FT                   /gene="gmuA"
FT                   /locus_tag="BSUW23_02980"
FT   CDS_pept        605249..605581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuA"
FT                   /locus_tag="BSUW23_02980"
FT                   /product="oligo-alpha-mannoside phosphotransferase system
FT                   enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36652"
FT                   /db_xref="GOA:E0TTH1"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH1"
FT                   /protein_id="ADM36652.1"
FT                   /translation="MEQMKITDLTDEQISFQLILHSGNARSSIIQSLRAYKEGNKEEAA
FT                   ALIAKAEHDLSAAHDIHFQMIQKESSGEETAFSLLLMHAEDHLMSTLTMKELVKELLDL
FT                   FKTKNL"
FT   gene            605601..606929
FT                   /gene="gmuC"
FT                   /locus_tag="BSUW23_02985"
FT   CDS_pept        605601..606929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuC"
FT                   /locus_tag="BSUW23_02985"
FT                   /product="oligo-alpha-mannoside phosphotransferase system
FT                   enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36653"
FT                   /db_xref="GOA:E0TTH2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH2"
FT                   /protein_id="ADM36653.1"
FT                   /translation="MFEKISQFLVPIAGRLNNNRYLQVLRDAFMLAFPLTIFGSIFVVL
FT                   TNLPFLNKIMNASMLTSFQSQFGIASTATMGIMSVFVVFGIGYYLSKSYQVEAVFGGAI
FT                   ALVSFLLLTPFIVQPETGDAITGVIPVDRLGAKGMFLGMITAFLSGEIYRRIVQKNLTI
FT                   KMPAGVPPAVAKSFAALIPAFITLTVFLLINVLVTQLFKTNMHDVIYHAIQAPLVGLGS
FT                   GIIPTLIAVFFIQILWFFGLHGQIIINSVMDPIWNTLQVENLSAYTAGKEIPHIISKPF
FT                   MEIYTVGMGGTGMTLAIVLTILIFMKSRQMKQVSKLGLAPGIFNVNEPIIFGLPIVMNP
FT                   IIIVPWVLAPMVVTLVTYLAMSAGLVPPPTGVTVPWTVPLFINGIMATNSIMGGVMQLV
FT                   NLLIVFVIWFPFLKAMDKLNLAKEKEQAVQESAAQQNDNNIKM"
FT   gene            606947..608344
FT                   /gene="gmuD"
FT                   /locus_tag="BSUW23_02990"
FT   CDS_pept        606947..608344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuD"
FT                   /locus_tag="BSUW23_02990"
FT                   /product="mannoside-phospho-beta-d-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36654"
FT                   /db_xref="GOA:E0TTH3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH3"
FT                   /protein_id="ADM36654.1"
FT                   /translation="MAQTEQYRFPKEFWWGSSASATQTEGAADRDGKGQNIWDYWFEKE
FT                   PHRFFDHVGPADTSQFYDNYKEDIRLMKELGHNSFRMSISWSRLIPDGIGEINAKAADF
FT                   YSSVIDELIANGIEPFVNLFHFDMPMELQKNGGWVNRETVDAYENYAKTSFRLFGDRVK
FT                   KWFTHNEPIVPVEGGYLYDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKHDGKIG
FT                   IILNLTPSYPRSSHPADVKAGEIADAFFNRSFLDPSVKGEFPKELVEILKSEGFVPDYQ
FT                   KEDLDVIKHNTVDLLGVNYYQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRG
FT                   WEIYEKGVYDILINLKENYGNIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHL
FT                   KWVHRAIQEGSNVKGYHLWTFMDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKK
FT                   VAEQHGF"
FT   gene            608493..609206
FT                   /gene="gmuR"
FT                   /locus_tag="BSUW23_02995"
FT   CDS_pept        608493..609206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuR"
FT                   /locus_tag="BSUW23_02995"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36655"
FT                   /db_xref="GOA:E0TTH4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH4"
FT                   /protein_id="ADM36655.1"
FT                   /translation="MNKYEIIANEMRDRIKNNVYPIDQPIPDEVSLAKEFNSSRMTMKR
FT                   ALDNLVAEGLLFRKRGHGTFIIQSAIQDDHVHVVSNEILGLTNLLKDKKIKSTVIQFEV
FT                   QFPTEEVAAHLSIDQKTPVYYVVRLRIVEGEPYVLEKTYMPTHLIPGINDDVLHDSIYN
FT                   HITNVLQLKIAGTHRKIRACKSDHIDQQHLGCKQDDPILEVEHVGFLDNGIPFEYSFSR
FT                   HRHDKFVVTSVNIRR"
FT   gene            609235..610134
FT                   /gene="gmuE"
FT                   /locus_tag="BSUW23_03000"
FT   CDS_pept        609235..610134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuE"
FT                   /locus_tag="BSUW23_03000"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36656"
FT                   /db_xref="GOA:E0TTH5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH5"
FT                   /protein_id="ADM36656.1"
FT                   /translation="MLGGIEAGGTKFVCAVGKEDGTIIDRIEFPTTMPDETIEKVIRYF
FT                   RQFSLQAIGIGSFGPVNNDKTSKTYGTITATPKAGWRHYPFLQTVKNEMKIPVGFSTDV
FT                   NAAALGEFLFGEARNLDSCLYITIGTGIGAGAIVEGRLLQGLSHPEMGHIYIRRHPDDV
FT                   YQGKCPYHKDCFEGLASGPAIEARWGKKAADLSDMNQVWELEGYYIAQALAQYILILAP
FT                   KKIILGGGVMQQKQVFSYIYQYVPKIMNNYLDFSELSVNIGDYIVPPRLGSNAGIIGTL
FT                   VLAHQALQAESASGEVRS"
FT   gene            610131..611078
FT                   /gene="gmuF"
FT                   /locus_tag="BSUW23_03005"
FT   CDS_pept        610131..611078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuF"
FT                   /locus_tag="BSUW23_03005"
FT                   /product="phosphohexomutase; cupin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36657"
FT                   /db_xref="GOA:E0TTH6"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH6"
FT                   /protein_id="ADM36657.1"
FT                   /translation="MKYPLFLDPVFKERIWGGTKLRDAFGYALPSERTGECWAVSAHAH
FT                   GSSAVKNGPLAGKTLDQVWQDHPEVFGFPDGKVFPLLVKLLDANMDLSVQVHPDDDYAT
FT                   LHENGDLGKTECWYIIDCKDDAELILGHHASTKEDFKRLMESGDWNGLLRRIKIKPGDF
FT                   FYVPSGTLHALCEGTLVLEIQQNSDTTYRVYDYDRCNDQGQKRTLHIEKAMEVITIPHI
FT                   DKVYAPEVKKVDNAVITAYVQSDYFSVYKWKISGRAVFPSHQTYLLGSVLSGSGRIVNH
FT                   GIQYECNAGSHFILPAHFGEFSIEGTCELMISHP"
FT   gene            611097..612185
FT                   /gene="gmuG"
FT                   /locus_tag="BSUW23_03010"
FT   CDS_pept        611097..612185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuG"
FT                   /locus_tag="BSUW23_03010"
FT                   /product="exported mannan endo-1,4-beta-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36658"
FT                   /db_xref="GOA:E0TTH7"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR016714"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH7"
FT                   /protein_id="ADM36658.1"
FT                   /translation="MFKKHTISLLIFFLLASCILAKPIEAHTVSPVNPNAQQTTKTVMN
FT                   WLAHLPNRTENKVLSGAFGGYSHDTFSMAEDDRIRSAAGQSPAIYGCDYARGWLETANI
FT                   EDSIDVSCNSDLLSYWKSGGIPQISLHLANPAFQSGHFKTPITNDQYKNILDSATAEGK
FT                   RLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYK
FT                   KIYHYMTDSRGLDHLLWIYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQL
FT                   IALNKPFAFTEVGPQNANGSFDYSLLINAIKQKYPNTIYFLAWNDEWSPAANNGASGLY
FT                   NDSWTLNKGEIWNGDSLTPIVE"
FT   gene            complement(612237..613091)
FT                   /gene="ydhU"
FT                   /locus_tag="BSUW23_03015"
FT   CDS_pept        complement(612237..613091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhU"
FT                   /locus_tag="BSUW23_03015"
FT                   /product="Mn-containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36659"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH8"
FT                   /protein_id="ADM36659.1"
FT                   /translation="MYYYKEELINIIKPDKPDPAAAKVLQEILGGHYGEMRTMMQFFFQ
FT                   SSNFRGKQKQYRDLLRGIFLEEIAHVELVQNTINALLDESGGAGVGSQGADQSPLDEAI
FT                   KHANPHHYIIGAQSSLPVDAGGNPWNGSWVYNHGNLITDLLDNLLLESTGVLQKTRIYE
FT                   MSSNQTFRETLAFLIVRDNAHQNAFAKALETLGVEWAKLLPVPNYDINKYPECRKYVEL
FT                   GYHNAQFNFRLDETRIGEIFQGTSPSRNGGELQVIEPPAGFPVPVLPEMPNEHSPGLGD
FT                   MNT"
FT   gene            613424..613500
FT                   /locus_tag="BSUW23_t20512"
FT                   /note="trnE-Arg"
FT   tRNA            613424..613500
FT                   /locus_tag="BSUW23_t20512"
FT                   /product="tRNA-Arg"
FT   gene            613515..613588
FT                   /locus_tag="BSUW23_t20514"
FT                   /note="trnE-Gly"
FT   tRNA            613515..613588
FT                   /locus_tag="BSUW23_t20514"
FT                   /product="tRNA-Gly"
FT   gene            613684..615242
FT                   /locus_tag="BSUW23_r20642"
FT                   /note="rrnE-16S"
FT   rRNA            613684..615242
FT                   /locus_tag="BSUW23_r20642"
FT                   /product="16S ribosomal RNA"
FT   gene            615404..618332
FT                   /locus_tag="BSUW23_r20658"
FT                   /note="rrnE-23S"
FT   rRNA            615404..618332
FT                   /locus_tag="BSUW23_r20658"
FT                   /product="23S ribosomal RNA"
FT   gene            618387..618502
FT                   /locus_tag="BSUW23_r20626"
FT                   /note="rrnE-5S"
FT   rRNA            618387..618502
FT                   /locus_tag="BSUW23_r20626"
FT                   /product="5S ribosomal RNA"
FT   gene            618525..618601
FT                   /locus_tag="BSUW23_t20516"
FT                   /note="trnE-Met"
FT   tRNA            618525..618601
FT                   /locus_tag="BSUW23_t20516"
FT                   /product="tRNA-Met"
FT   gene            618663..618739
FT                   /locus_tag="BSUW23_t20518"
FT                   /note="trnE-Asp"
FT   tRNA            618663..618739
FT                   /locus_tag="BSUW23_t20518"
FT                   /product="tRNA-Asp"
FT   gene            618920..619897
FT                   /gene="thiL"
FT                   /locus_tag="BSUW23_03020"
FT   CDS_pept        618920..619897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BSUW23_03020"
FT                   /product="thiamine monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36660"
FT                   /db_xref="GOA:E0TTH9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTH9"
FT                   /protein_id="ADM36660.1"
FT                   /translation="MDEFDLIHSITPRTIHHSSVDVGIGDDAALYTAKHGVQEIVCVDT
FT                   MVEDVHFKLHYSSPEDIGYKALAVNISDIAAMGGIPKFYLVSLAVPSKWTESEIKAMYE
FT                   GMNELAKLYHMDLIGGDTVSTTDKLVVTVTVIGEVEKGRACLRSLARPNDIVFVTGEIG
FT                   SSAAGLSLLLEKTNPQNSSVETDYFINRHKRPQPRVSMGRLCSSIKRAALNDISDGLAS
FT                   ELNEIAEASCVSIEIDESMLPVHSDLPKLHSNWKEWALFGGEDFELTGTVSKEEWEVLK
FT                   QECEIRQLPITKIGHVREKTEFNVFLKTEKTTMALEKKGYNHFK"
FT   gene            619912..620388
FT                   /gene="ydiB"
FT                   /locus_tag="BSUW23_03025"
FT   CDS_pept        619912..620388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiB"
FT                   /locus_tag="BSUW23_03025"
FT                   /product="putative ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36661"
FT                   /db_xref="GOA:E0TTI0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI0"
FT                   /protein_id="ADM36661.1"
FT                   /translation="MKQLKWRTVNPEETKAIAKLTASFAKPGDVLTLEGDLGAGKTTFT
FT                   KGFAEGLGITRVVNSPTFTIIKEYNDGSLPLYHMDVYRMEDESEDLGLDEYFHGQGVCL
FT                   VEWAHLIEEQLPQERLQIVIKRAGDDEREVTFTAVGNRYEMLCEEISRHDNISN"
FT   gene            620369..621058
FT                   /gene="ydiC"
FT                   /locus_tag="BSUW23_03030"
FT   CDS_pept        620369..621058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /locus_tag="BSUW23_03030"
FT                   /product="putative chaperone or protease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36662"
FT                   /db_xref="GOA:E0TTI1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI1"
FT                   /protein_id="ADM36662.1"
FT                   /translation="MTILAIDTSNYTLGIALLREDTVIAEYITYLKKNHSVRAMPAVHS
FT                   LLNECDMTPQDLSKIVVAKGPGSYTGVRIGVTLAKTLAWSLHIPISPVSSLEALAANGR
FT                   HFDGLISPIFDARRGQVYTGLYEYKNGLLEQVEPDQNVMLAEWLEMLKEKDRSVLFLGH
FT                   DTSIHQQMIEDVLGTKGIVGAAAQHNPRPSELAFLGAEKEAADVHGLVPDYLRLAEAEA
FT                   KWIESQK"
FT   gene            621068..621523
FT                   /gene="rimI"
FT                   /locus_tag="BSUW23_03035"
FT   CDS_pept        621068..621523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BSUW23_03035"
FT                   /product="ribosomal protein S18 alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36663"
FT                   /db_xref="GOA:E0TTI2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI2"
FT                   /protein_id="ADM36663.1"
FT                   /translation="MKTKAAVRNMRLDDIDHVYEIETSSFTSPWTKDSFYHELLENPYA
FT                   HYLVIEKDGHVAGYCGIWIVMDDAQITNIAIKPEYRGQSLGEALFRSAVELCKEKDARR
FT                   LSLEVRVSNHPAQGLYKKFGMQPGGIRKNYYTDNGEDALIMWVTINE"
FT   gene            621516..622556
FT                   /gene="gcp"
FT                   /locus_tag="BSUW23_03040"
FT   CDS_pept        621516..622556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BSUW23_03040"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36664"
FT                   /db_xref="GOA:E0TTI3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI3"
FT                   /protein_id="ADM36664.1"
FT                   /translation="MSEQKELYVLGIETSCDETAAAIVKNGKEIISNVVASQIESHKRF
FT                   GGVVPEIASRHHVEQITLVIEEAFRKAGMTYSDIDAIAVTEGPGLVGALLIGVNAAKAL
FT                   SFAHNIPLVGVHHIAGHIYANRLVEEIVFPALALVVSGGHTELVYMKEHGSFEVIGETL
FT                   DDAAGEAYDKVARTMGLPYPGGPQIDKLAEKGNDNIPLPRAWLEEGSYNFSFSGLKSAV
FT                   INTLHNASQKGQEIAPEDLSASFQNSVIDVLVTKTARAAKEYGVKQVLLAGGVAANRGL
FT                   RAALEKEFAQHEGISLVIPPLALCTDNAAMIAAAGTIAFEKGIRGAYDMNGQPGLELTS
FT                   YQSLTR"
FT   gene            complement(622784..624709)
FT                   /gene="ydiF"
FT                   /locus_tag="BSUW23_03045"
FT   CDS_pept        complement(622784..624709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiF"
FT                   /locus_tag="BSUW23_03045"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36665"
FT                   /db_xref="GOA:E0TTI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI4"
FT                   /protein_id="ADM36665.1"
FT                   /translation="MILQVNQLSKSFGADTILNNIKLEVRNRDRIAIVGRNGAGKSTLL
FT                   KIIAGQLSYEKGEIIKPKDITMGYLAQHTGLDSKLTIKEELLTVFDHLKAMEKEMRAIE
FT                   EKMAAADPDELESIMKTYDRLQQEFKDKGGYQYEADVRSVLHGLGFSHFDDSTQVQSLS
FT                   GGQKTRLALGKLLLTQPDLLILDEPTNHLDIDTLTWLEHYLQGYSGAILIVSHDRYFLD
FT                   KVVNQVYEVSRAESKKYHGNYSAYLDQKAAQYEKELKVYEKQQDEIAKLQDFVDRNLAR
FT                   ASTTKRAQSRRKQLERMEVMSKPLGDEKSANFHFDITKQSGNEVLRVQDLTISYENQPP
FT                   LLTEVSFMLTRGESAALVGPNGIGKSTLLKTLMDTLKPDQGSISYGSNVSVGYYDQEQA
FT                   ELTSSKRVLDELWDEYPGLPEKEIRTCLGNFLFSGDDVLKPVHSLSGGEKARLALAKLM
FT                   LQKANFLILDEPTNHLDLDSKEVLENALIDYPGTLLFVSHDRYFINRIATRVLELSSNH
FT                   IEEYLGDYDYYTEKKTEQLELEKMNQQEESEKTPASVKPDSKRSYEEEKEWKKKERQRL
FT                   RRIEEIEATVQTIEENISHNDELLCDPEIYQDHEKVQAIHADNEKLNQELESLLSEWEE
FT                   LSTEEA"
FT   gene            624751..625350
FT                   /gene="moaC"
FT                   /locus_tag="BSUW23_03050"
FT   CDS_pept        624751..625350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="BSUW23_03050"
FT                   /product="molybdenum cofactor biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36666"
FT                   /db_xref="GOA:E0TTI5"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI5"
FT                   /protein_id="ADM36666.1"
FT                   /translation="MNQKSANNTLAEKDIEKKIVYDLFKESFNMNRFSHFNEQGRAQMV
FT                   DISEKSSTVRTAAAVSSVHMKNEVYEKIQSHDIGKGDVLAVAQVAGIMAAKQTSNIIPM
FT                   CHPLSLSGVDISFDWKIKESEVILHIKAQVKTKGSTGVEMEALTSASVCALTVYDMCKA
FT                   LDKGMVIGPTFLLEKTGGKNGDFKRELSEYNLEDQK"
FT   gene            625347..625994
FT                   /gene="rex"
FT                   /locus_tag="BSUW23_03055"
FT   CDS_pept        625347..625994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="BSUW23_03055"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36667"
FT                   /db_xref="GOA:E0TTI6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI6"
FT                   /protein_id="ADM36667.1"
FT                   /translation="MNKDQSKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVDYLLSFFRKTLDQDEMTDVILIGVGNLGTAFLHYN
FT                   FTKNNNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKNESVAILTVPAVAAQSITD
FT                   RLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYSVLEEIE"
FT   gene            626016..626189
FT                   /gene="tatAY"
FT                   /locus_tag="BSUW23_03060"
FT   CDS_pept        626016..626189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAY"
FT                   /locus_tag="BSUW23_03060"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36668"
FT                   /db_xref="GOA:E0TTI7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI7"
FT                   /protein_id="ADM36668.1"
FT                   /translation="MPIGPGSLAVIAIVALIIFGPKKLPELGKAAGDTLREFKNATKGL
FT                   TSDDEEKKKEDQ"
FT   gene            626205..626960
FT                   /gene="tatCY"
FT                   /locus_tag="BSUW23_03065"
FT   CDS_pept        626205..626960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCY"
FT                   /locus_tag="BSUW23_03065"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36669"
FT                   /db_xref="GOA:E0TTI8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI8"
FT                   /protein_id="ADM36669.1"
FT                   /translation="MKVNQMSLLEHIAELRKRLLVVALAFVVFFIAGFFLAKPMIVYLQ
FT                   KTDEAKELTLNAFNLTDPLFVFMQFAFIIGIVLTSPIILYQLWAFVSPGLYEKERKVTL
FT                   SYIPISILLFLAGLSFSYYILFPFVVDFMKRISQDLNVNQVIGINEYFHFLLQLTIPFG
FT                   LLFQMPVILMFLTRLGIVTPMFLAKIRKYAYFTLLVIAALITPPELLSHMMVTVPLLIL
FT                   YEISILISKAAYRKAQKSSADVQDVSSGQ"
FT   gene            complement(626998..627189)
FT                   /gene="ydiK"
FT                   /locus_tag="BSUW23_03070"
FT   CDS_pept        complement(626998..627189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiK"
FT                   /locus_tag="BSUW23_03070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36670"
FT                   /db_xref="GOA:E0TTI9"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTI9"
FT                   /protein_id="ADM36670.1"
FT                   /translation="MRNPVVWGMIYFAVGCIFTYLAASSPGSMWSFYSILLMVFAAYNI
FT                   SISFKMFAFSFKIKKNQK"
FT   gene            complement(627186..627920)
FT                   /gene="ydiL"
FT                   /locus_tag="BSUW23_03075"
FT   CDS_pept        complement(627186..627920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiL"
FT                   /locus_tag="BSUW23_03075"
FT                   /product="putative membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36671"
FT                   /db_xref="GOA:E0TTJ0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ0"
FT                   /protein_id="ADM36671.1"
FT                   /translation="MRKQYWFIILTYIIMQFSALIGIPLLFKFGYAGGQPTAENMLHAQ
FT                   GLWSVISFIACLVVVLLILRTVPKETLRNGQKDSIGLSILWAIAGFFIALFSQGIAGSI
FT                   EYYIFGIGRESENTQAILDVIQAVPLMIMVSSVVGPILEEIIFRKIIFGTLYEKTNFFF
FT                   AGLISSVIFGIVHADLKHLLLYTAMGFTFAFLYARTKRIWVPIFAHVMMNTFVVIMQFE
FT                   PVQKYLEQQSTQMQLIIGGLFL"
FT   gene            628158..628442
FT                   /gene="groES"
FT                   /locus_tag="BSUW23_03080"
FT   CDS_pept        628158..628442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BSUW23_03080"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36672"
FT                   /db_xref="GOA:E0TTJ1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ1"
FT                   /protein_id="ADM36672.1"
FT                   /translation="MLKPLGDRVVIELVESEEKTASGIVLPDSAKEKPQEGKIVAAGSG
FT                   RVLESGERVALEVKEGDRIIFSKYAGTEVKYEGTEYLILRESDILAVIG"
FT   gene            628489..630114
FT                   /gene="groEL"
FT                   /locus_tag="BSUW23_03085"
FT   CDS_pept        628489..630114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BSUW23_03085"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36673"
FT                   /db_xref="GOA:E0TTJ2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ2"
FT                   /protein_id="ADM36673.1"
FT                   /translation="MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPVGVRKGMEKAVAVAIENLKEISKPIEGKESIAQVAAISAADEEVGSLIAEA
FT                   MERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITD
FT                   KKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDIAVLTGGEVITEDLGLDLKSTQITQLGRASKVVVTKENTTIVEGAGETDKI
FT                   SARVTQIRAQVEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVSGGGTALVNVYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLE
FT                   GSVIVERLKNEEIGVGFNAATGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEENAGGAGMPDMGGMGGMM"
FT   gene            630857..631852
FT                   /gene="ydjBC"
FT                   /locus_tag="BSUW23_03090"
FT   CDS_pept        630857..631852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjBC"
FT                   /locus_tag="BSUW23_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36674"
FT                   /db_xref="InterPro:IPR019149"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ3"
FT                   /protein_id="ADM36674.1"
FT                   /translation="MHFSKMIDRLALYDLHRKRSKDKHFSAVFTADIDDREEFYSANTA
FT                   DVSIDLNESKKNYRVGTFSYESLIQTGNLVNDTLKGEVFLNENEIDQPNVIFVHGWRMD
FT                   SYNRIKKIFHNRIMNDLGWNMYYYSLPYHFEREPENSLYSGELMISANIDRTIESTRQA
FT                   VVDLRALIYWIKANKKGPVIIVGVSLGGWVTNLIATLDSQIDVMVSIFYANRLSYSIWN
FT                   TIPGKFIREELEQNGVTYEDLTKYWNITDPSQALPKVNKDNILLISAKHDQYIDLKDAD
FT                   YLWESWEKPKRYVYNCGHSGIVLCRKKLANDTISFIRERIHTGKPGSVHL"
FT   gene            complement(631941..634430)
FT                   /gene="gutR"
FT                   /locus_tag="BSUW23_03095"
FT   CDS_pept        complement(631941..634430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutR"
FT                   /locus_tag="BSUW23_03095"
FT                   /product="transcriptional regulator of the glucitol operon"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36675"
FT                   /db_xref="GOA:E0TTJ4"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ4"
FT                   /protein_id="ADM36675.1"
FT                   /translation="MAELENRKQFAQLLAPGVKSLKLHPDYKVRRKKNEKTGQSYIDKI
FT                   ALQLGVSSNTIKSWIGQMGINYIPGRIDDGKLFGIIWIILEKTDLDIEWLTGLLETTTI
FT                   PVIKPALPVWAASCLKKAKTLRKDGSFGAPSDNDIEKAVKRLFHDIPVQETNALTEQPI
FT                   THNLPSRWSGSFIGRSFDMEAIRQWMLSPSPVCLITGWAGMGKTTIALEAAYSCVDDTS
FT                   DWPAFNSIIWVSADWKGLSFSDFLNTIAYQLGRAEQIDKSINEKRFVVRNALANYTREK
FT                   PVLLIVDSIDTAERDIHEFITSLPQGVKVLLTARENVKQTYRESFGEMSAIQLSGLDQT
FT                   DALEFFQQEVHRCLQTCNIQNKREKLEQLLQLSSELKNEFISATAGNPKAMALSIAYMS
FT                   DDDIPAQQLIHELGKAGYTLLELFEFLFGRTWDRCNEDTRKLWQALCFFSKPPDEKSLA
FT                   AAAGLDARHFHFAIEQMRSFALIQPERSEGRTQYLAHQTVVAYGEQHLSEHHKYEKEAR
FT                   NRWAHFYIDYAETHLKREQPNSIYWSYLLGRNLDQMKKEWPNILKVIQWASETGQNEIL
FT                   IELITRISHFLSRINLPLRIEYGRKAADAAHQLGQHTREAFFRIDTAGWALMEVNDLDG
FT                   ALQQIEAGLRILEQSDTHDAHDLKVWGHALKARLFLKDRQQEKAETILNEIEDQPISPT
FT                   IQHRVLLVRGDLSFARGHDEEAIQLYEAANEISFTYGGEKTIEAYFNLGVAYVKCGQFE
FT                   KAEEAFEQMLYDKHNANQVELIYYHYGMAQLLHRKGEKTKAMEANQKAIRLINSWEPAI
FT                   GIWGEVEELAMVIKEND"
FT   gene            634633..635694
FT                   /gene="gutB"
FT                   /locus_tag="BSUW23_03100"
FT   CDS_pept        634633..635694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutB"
FT                   /locus_tag="BSUW23_03100"
FT                   /product="glucitol (sorbitol) dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36676"
FT                   /db_xref="GOA:E0TTJ5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ5"
FT                   /protein_id="ADM36676.1"
FT                   /translation="MTHTVPQNMKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGIC
FT                   GSDLHYYTNGRIGNYVVEKPFILGHECAGEIAAIGSSVDQFKVGDRVAVEPGVTCGRCE
FT                   ACKEGRYNLCPDVQFLATPPVDGAFVQYIKMRQDFVFLIPDSLSYEDAAVIEPFSVGIH
FT                   AAARTNLQPGSTIAIMGMGPVGLMAVAAAKAFGASTIIVTDLEPLRLEAAKKMGATHVI
FT                   NIREQDALEEIKTITNDRGVDVAWETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPL
FT                   NVPFIADNEIDIYGIFRYANTYPKGIEFLASGIVDTKHLVTDQYSLEQTQEAMERALQF
FT                   KNECLKVMVYPNR"
FT   gene            635726..637159
FT                   /gene="gutP"
FT                   /locus_tag="BSUW23_03105"
FT   CDS_pept        635726..637159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutP"
FT                   /locus_tag="BSUW23_03105"
FT                   /product="H+-glucitol symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36677"
FT                   /db_xref="GOA:E0TTJ6"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ6"
FT                   /protein_id="ADM36677.1"
FT                   /translation="MFTGNENGFLGWEMMIETEKVTTLKAKHQSKSSTSLSWFERIGYG
FT                   FGDMSYNIIFQFVNAYLLFYYTDVGGIQPAVIATLFLVVRVLDAIFDPIMGLILDKTNT
FT                   RWGKARPYLLWVAFPFALFTFLCFTTPHFGETGNMVYAYITYILLGMSFSMQTIPVNSL
FT                   TGRMTNSVEERTVLTTTRMILVYIGILLSISCATPLATAIGGEDQAFGFQMTALIYAAV
FT                   SIVLNLFSFFTVRERIQPKKRKKQGIKKTLSVLFRNKPLLMLVSSFLAFAIGFNIKLST
FT                   MVYYFTYNVNHKEFVFLGTVLFFGAALISNLFIPFFSEKWGRKQVMMITAALSLISYAG
FT                   LHFTPYSSITLIFIWLFVSGFFTTPLNTLAWGMVADCVDYAEWKTGVRADGVVISSMSF
FT                   INKLGVALAGSFSAIYLGIAGYVANADQTVTSLNAIKNMNALIPGFFILLSIILIAFYP
FT                   LTEKRYKHIISELEQRSAR"
FT   gene            637254..638216
FT                   /gene="ydjE"
FT                   /locus_tag="BSUW23_03110"
FT   CDS_pept        637254..638216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjE"
FT                   /locus_tag="BSUW23_03110"
FT                   /product="putative sugar kinase (ribokinase family)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36678"
FT                   /db_xref="GOA:E0TTJ7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ7"
FT                   /protein_id="ADM36678.1"
FT                   /translation="MRSYSVVCIGELLIDFFCTDVDVDLMEGRHFLKSAGGAPANVSAA
FT                   IAKLGGQAAFSGKVGKDPFGYFLKQTLDAVHVDTSMLVMDEKAPTTLAFVSLKQNGERD
FT                   FVFNRGADALFTLEDIEQEKLNEAKILHFGSATALLSDPFCSAYLRLMSIAKDNGQFVS
FT                   FDPNYREDLWKGRVSEFVSIAKKAIAVSDFVKVSDEELEIISGVKNHEKGVAILHEIGA
FT                   NIVAVTLGKSGTLLSNGKDHEIIPSIPVTSIDSTGAGDAFVGAALYQLANTDHIQSVEA
FT                   DFAKLREIVAFANKVGALVCTKIGAIDALPSMKEIEVSL"
FT   gene            638415..639098
FT                   /gene="pspA"
FT                   /locus_tag="BSUW23_03115"
FT   CDS_pept        638415..639098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="BSUW23_03115"
FT                   /product="phage shock protein PspA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36679"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ8"
FT                   /protein_id="ADM36679.1"
FT                   /translation="MSIIGRFKDIMSANINALLDKAENPEKMVDQYLRNMNSDLAKVKA
FT                   ETAAVMAEEQRAKRELHECQADMEKMESYAMKALQAGNEGDARKFLERKTSLESKLSEL
FT                   QTANQIAATNAAQMRKMHDKLVSDIGELEARKNMIKAKWAVAKTQERMNKLGASVSNTS
FT                   QSMSAFGRMEDKVNKALDQANAMAELNSAPQDDIADLTAKYDTAGSSQVDDELAALKAK
FT                   MMLDK"
FT   gene            639164..640189
FT                   /gene="ydjG"
FT                   /locus_tag="BSUW23_03120"
FT   CDS_pept        639164..640189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjG"
FT                   /locus_tag="BSUW23_03120"
FT                   /product="putative phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36680"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTJ9"
FT                   /protein_id="ADM36680.1"
FT                   /translation="MIISYKCPNCGSDMAFDSDSGSLSCGSCGRQDNIESLPKENIAAR
FT                   FSEDEAKEYQCENCGAVLITEVETTATTCSFCGGAAILADRLSGHLAPAKVIPFTISKQ
FT                   EAEQAFRKWCKKGLLTPRGFMSADRIKSITGMYIPFWMFDLNSEVQVRANCTRVNQYEE
FT                   GDYICTETEHFEAFRDINLDYLKIPVDASEKMNDELMDKLEPYSYDQLKDFQTAYLAGY
FT                   IAEKYNYTDEELFPRAKEKISSYIDSYIHSTFSGYTSVNVRDKHIHTKNVNSFYVLLPV
FT                   WMVSYDYERAEHIFAMNGQTGKVVGKPPISSGKVAAWFSGIAGGTFLALKLVSLMMGGG
FT                   F"
FT   gene            640189..640956
FT                   /gene="ydjH"
FT                   /locus_tag="BSUW23_03125"
FT   CDS_pept        640189..640956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjH"
FT                   /locus_tag="BSUW23_03125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36681"
FT                   /db_xref="GOA:E0TTK0"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK0"
FT                   /protein_id="ADM36681.1"
FT                   /translation="MRGFLGKAILVVLAVFMVMPVLGIEAARASESQQHVYDQAHLLSK
FT                   AEIGKLESLSAELGAKRDTDFIIITTKSTNGEDIADYTGDFYDRYGKGSTAILTIDMAN
FT                   REVFIAGFKKAEQYLDNSRLNSIRNTISSDLSNENYFKAFKTYIQLSYKDMGIKPGINP
FT                   DNIFFKWWFQLIAAIAVGGIAVSIMLYNAGGKVTVNGNTYMDHRTSDVIDQYDTYIRTT
FT                   VTRERKPSNDKDSGGDGGVTKGGTSYSGSRGSF"
FT   gene            640986..641957
FT                   /gene="ydjI"
FT                   /locus_tag="BSUW23_03130"
FT   CDS_pept        640986..641957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjI"
FT                   /locus_tag="BSUW23_03130"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36682"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK1"
FT                   /protein_id="ADM36682.1"
FT                   /translation="MSFFRNQLANVVEWEEFRDDMIFYKWNNREIKKGSRLIIRPGQDA
FT                   VFLNNGRVEGVFQDDGDYDIESEIIPFLSTLKGFKFGFNSGMRAEVLFVNTKEFTVRWG
FT                   TKQAINIPAAGMPGGMPIRANGTFHFKVQDYISLIDKIAGVKNQYFVEDIKTRITSILD
FT                   QLLMKWITREGKDMFNLQANAFDIAKGIQEDLDMQLIGDGMTITGFQIMSFNYPQEVQD
FT                   MITKNASYGMVGDVNRYQQISMTDGMASGKMSGGGAASDMAGMMMGMNMANQMMNQMNQ
FT                   NQQAQSSDSQSSGSGSKPNFCPNCGTKTGEANFCPNCGQKLV"
FT   gene            complement(642005..643045)
FT                   /gene="ydjJ"
FT                   /locus_tag="BSUW23_03135"
FT   CDS_pept        complement(642005..643045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjJ"
FT                   /locus_tag="BSUW23_03135"
FT                   /product="putative membrane associated potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36683"
FT                   /db_xref="GOA:E0TTK2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK2"
FT                   /protein_id="ADM36683.1"
FT                   /translation="MAGLGEAKKLNEIYIITGLLLLTAGMIDFLWTTLWLESGAGPITR
FT                   CLSAWLWKGCRKISGDHAKVLSMAGPLLLCLTLVIWIILFWGGWFLIFSSDPHSLVETQ
FT                   SKEPASWSDRIYFSGYVMFTLGNGDLAPNGDLWKLVTVIETAQGLLTITFSVTYLISVL
FT                   SAVNQKRSFAQSVLSLGRDGTEIVQNAWNGKDFHNIDFLLVAISSELGKLTAQHNAFPI
FT                   LHFYHSTQRQESSIIAVTVLDEALTILKYGIPEQYQPNQLHIKETRSSIKNYLDTVHTA
FT                   YIHSAEQAPPEPDISKLQQSGIPALSKQTFQTAVNSLKERRQLLLGVVQAGARKWPVQE
FT                   QTIDNG"
FT   gene            643451..643558
FT                   /locus_tag="BSUW23_03140"
FT   CDS_pept        643451..643558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36684"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK3"
FT                   /protein_id="ADM36684.1"
FT                   /translation="MKSLPKKLTCEEEGKVMSPLEKNMMNFFLKPAYKM"
FT   gene            643632..645053
FT                   /gene="iolT"
FT                   /locus_tag="BSUW23_03145"
FT   CDS_pept        643632..645053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolT"
FT                   /locus_tag="BSUW23_03145"
FT                   /product="myo-inositol transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36685"
FT                   /db_xref="GOA:E0TTK4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK4"
FT                   /protein_id="ADM36685.1"
FT                   /translation="MNKQGNQMSFLRTIILVSTFGGLLFGYDTGVLNGALPYMGEPDQL
FT                   NLNAFTEGLVTSSLLFGAALGAVFGGRMSDFNGRRKNILFLAVIFFISTIGCTFAPNVT
FT                   IMIISRFVLGIAVGGASVTVPAYLAEMSPVDSRGRMVTQNELMIVSGQLLAFVFNAILG
FT                   TTMGDNSHVWRYMLVIASLPAIFLFFGMIRMPESPRWLVSKGRKEDALRVLKKIRDEKR
FT                   AASELQEIEFAFKKEDQLEKATFKDLSVPWVRRIVFIGLGIAVVQQITGVNSIMYYGTE
FT                   ILRDSGFQTEAALIGNIANGVISVLATFVGIWLLGKVGRRPMLMTGLIGTTTALLLIGI
FT                   FSLVMEGSPALPYVVLSLTVTFLAFQQGAISPVTWLMLSEIFPLRLRGLGMGVTVFCLW
FT                   MVNFAVSFTFPILLAAIGLSTTFFIFVGLGICSVLFVKRFLPETKGLSLEQLEENFRAY
FT                   DRSEAKKDSSAEVVG"
FT   gene            complement(645102..646142)
FT                   /gene="bdhA"
FT                   /locus_tag="BSUW23_03150"
FT   CDS_pept        complement(645102..646142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA"
FT                   /locus_tag="BSUW23_03150"
FT                   /product="acetoin reductase/2,3-butanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36686"
FT                   /db_xref="GOA:E0TTK5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK5"
FT                   /protein_id="ADM36686.1"
FT                   /translation="MKAARWHNQKDIRIEHIEEPKTEPGKVKIKVKWCGICGSDLHEYL
FT                   GGPIFIPVDKPHPLTNETAPVTMGHEFSGEVVEVGEGVENYKIGDRVVVEPIFATHGHQ
FT                   GAYNLDEQMGFLGLAGGGGGFSEYVSVDEELLFKLPDELSYEQGALVEPSAVALYAVRS
FT                   SKIKAGDKAAVFGCGPIGLLVIEALKAAGATDIYAVELSPERQQKAEELGAIIVDPSKT
FT                   DDVVAEIAERTGDGVDVAFEVTGVPVVLRQAIQSTTIAGETVIVSIWEKGAEIHPNDIV
FT                   IKERTVKGIIGYRDIFPAVLSLMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVK
FT                   ILVRPN"
FT   gene            646589..646957
FT                   /gene="ydjM"
FT                   /locus_tag="BSUW23_03155"
FT   CDS_pept        646589..646957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjM"
FT                   /locus_tag="BSUW23_03155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36687"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK6"
FT                   /protein_id="ADM36687.1"
FT                   /translation="MKKVILAAFILVGSTLGAFSFSSDASAKHVNGNITWYNGVGKKGS
FT                   SGKKLGHWDCATKIGFDVPKNGTKIRAYAKAKPKKVITVYKNDVGRMPNAVLDVSPKAF
FT                   KALGYPLSKGKVAGHYSY"
FT   gene            647023..648066
FT                   /gene="ydjN"
FT                   /locus_tag="BSUW23_03160"
FT   CDS_pept        647023..648066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjN"
FT                   /locus_tag="BSUW23_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36688"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK7"
FT                   /protein_id="ADM36688.1"
FT                   /translation="MKKRIILLLAVIIAAATGVAFYVTKDKGHEKAADVSVNTESGDKL
FT                   LVSITNTDLQTKYYENDKVIHEEKLTSYPAFALDQKQQVLYYTGNNDQNEMRLFKLDLK
FT                   SNKKTMLYKGAESADSLFLSKDGSTIYFRLGKADESNFRIAAFDLKTKKYKNLYPAAND
FT                   QDDTVSSFFYNKKTDSFALLHYSVEEDYKKTDEANEKGIDPEPTTIHFAAGHQNKFDEL
FT                   KSLDQFISDIAVSDDDKRILFTSYTQKGTEQTAAVQMLNADTKKYETIISNQKSFKLLI
FT                   DAQPQFSKDGKNIYFLAEAEGAKKLKDETGREAKVRTIYSYNLENKTFKKVWENPNGII
FT                   NSFSVIN"
FT   mobile_element  648086..649374
FT                   /mobile_element_type="insertion sequence:ISBsu1"
FT                   /note="ten copies are present in genome"
FT   gene            648182..648514
FT                   /locus_tag="BSUW23_03165"
FT   CDS_pept        648182..648514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_03165"
FT                   /product="ISBsu1 transposase, ORFA"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36689"
FT                   /db_xref="GOA:E0TTK8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK8"
FT                   /protein_id="ADM36689.1"
FT                   /translation="MGTRVSYPVEVKQKAVEMRLAGVPMKEIMQKLNIKNKTQVQTWVR
FT                   WHKAGDTHRFEQPVGKQYTYGKGPEYSSELEKLQAENHYLRQQNEVLKKYNELERKLIA
FT                   KRQSNL"
FT   gene            648532..649332
FT                   /locus_tag="BSUW23_03170"
FT   CDS_pept        648532..649332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSUW23_03170"
FT                   /product="ISBsu1 transposase, ORFB"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36690"
FT                   /db_xref="GOA:E0TTK9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTK9"
FT                   /protein_id="ADM36690.1"
FT                   /translation="MTVQDICIHLGISRASYYRWKKNLTKDHPKRHLEKQIGTLCREHK
FT                   YRYGYRKITAILKKRMRINHKTVQRIMQKNQWQCQVKVKKRKKNGQPYAVVDNILDRNF
FT                   QSDRPLEKLVTDITSLPYGQKQLYLSSILDLYNGEVIAFTIGAKQDTDFVLDTLNQLPT
FT                   LPENCVLHSDQGSVYTSYEYQKAVNTKGITMSMSRKGTPADNASIESFHSSLKSETFYL
FT                   NSIDRTTTAIVERTVIEYIHYYNNIRIQTKLNNQSPINYRQLAV"
FT   gene            complement(649390..649548)
FT                   /gene="ydzJ"
FT                   /locus_tag="BSUW23_03175"
FT   CDS_pept        complement(649390..649548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzJ"
FT                   /locus_tag="BSUW23_03175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36691"
FT                   /db_xref="GOA:E0TTL0"
FT                   /db_xref="UniProtKB/TrEMBL:E0TTL0"
FT                   /protein_id="ADM36691.1"
FT                   /translation="MFSNQQQKDLKKRARFKKLNLAINAYVELLFLSIPLIHLFKWLGS
FT                   LALHLVH"
FT   gene            complement(649735..649944)
FT                   /gene="ydjO"
FT                   /locus_tag="BSUW23_03180"
FT   CDS_pept        complement(649735..649944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjO"
FT                   /locus_tag="BSUW23_03180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36692"
FT                   /db_xref="InterPro:IPR025916"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU41"
FT                   /protein_id="ADM36692.1"
FT                   /translation="MSYYNKRNQEPLPKEDVSTWECTKEDCNGWTRKNFASSDSPSCPL
FT                   CGSKMIDGIRSLVNLQNNSQTKTS"
FT   gene            complement(650027..650842)
FT                   /gene="ydjP"
FT                   /locus_tag="BSUW23_03185"
FT   CDS_pept        complement(650027..650842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjP"
FT                   /locus_tag="BSUW23_03185"
FT                   /product="putative peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36693"
FT                   /db_xref="GOA:E0TU42"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU42"
FT                   /protein_id="ADM36693.1"
FT                   /translation="MPYITLEDQTRLYYETHGSGTPILFIHGVLMSGQFFHKQFSALSA
FT                   NYQCIRLDLRGHGESDKTLHGHTISQYARDVREFLKVMELDQAVLAGWSMGAFVVWDYF
FT                   NQFGNDNIQAAVIIDQSASDYQWEGWEHGPFDFDGLKTAMHAIQTDPLPFYESFIHNMF
FT                   AEPPAETETEWMLAEILKQPAAISSTILFNQTAADYRGILQNINVPTLLCFGEDRKFFS
FT                   TAAGEHLRSNIPNSTLVTFSKSSHCPFLEEPDAFNSTLLSFLDGLIGKP"
FT   gene            complement(650856..651845)
FT                   /gene="yeaA"
FT                   /locus_tag="BSUW23_03190"
FT   CDS_pept        complement(650856..651845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaA"
FT                   /locus_tag="BSUW23_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36694"
FT                   /db_xref="InterPro:IPR025062"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU43"
FT                   /protein_id="ADM36694.1"
FT                   /translation="MLTNDLNEKTKQYISIYAELKSKLKWKVAHDQILMLISSAYIVNK
FT                   REFDFQRFYDLSSYIKSNIGSFSTLNSHHRFTVASILDIHFQHEAKQTFHTFIDVYNEM
FT                   VKLGYKRDMFTYLAALILLTGKSETTNQREQMNMGLSVYQQMKKNHYFLTSTQNIPLAV
FT                   LLGENGKGLQALNKAETCYQRLAAKGFKKGHYLHQVSHILALQSEKDPETLVSQCKHIY
FT                   QSITDSFKKPKDYHYPDLALLTFLEEPNIKTILDITHELNQEKAFKWQKEMNFKIAVSL
FT                   YLSEHMEKNLLMESGLYTAIETVIQAQQAAATAAIISSTAASHSHDGN"
FT   gene            complement(651944..653485)
FT                   /gene="cotA"
FT                   /locus_tag="BSUW23_03195"
FT   CDS_pept        complement(651944..653485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotA"
FT                   /locus_tag="BSUW23_03195"
FT                   /product="spore copper-dependent laccase (outer coat)"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36695"
FT                   /db_xref="GOA:E0TU44"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU44"
FT                   /protein_id="ADM36695.1"
FT                   /translation="MTLEKFADALPIPDTLKPVQQTTEKTYYEVTMEECAHQLHRDLPP
FT                   TRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSEHFLPIDHTIHHSDSQHEEPEVKTVV
FT                   HLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLN
FT                   VYAGLVGAYIIHDPKEKRLKLPSGEYDVPLLITDRTINEDGSLFYPSGPENPSPSLPKP
FT                   SIVPAFCGDTILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGEFIQIGSDGG
FT                   LLPRSVKLNSFSLAPAERYDIIIDFTAYEGQSIILANSEGCGGDANPETDANIMQFRVT
FT                   KPLAQKDESRKPKYLASYPSVQNERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTE
FT                   APKAGTTEIWSIVNPTQGTHPIHLHLVSFRVLDRRPFDIARYQERGELSYTGPAVPPPP
FT                   SEKGWKDTIQAHAGEVLRIAVTFGPYSGRYVWHCHILEHEDYDMMRPMDITDPRK"
FT   gene            complement(653637..655046)
FT                   /gene="gabP"
FT                   /locus_tag="BSUW23_03200"
FT   CDS_pept        complement(653637..655046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="BSUW23_03200"
FT                   /product="gamma-aminobutyrate (GABA) permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36696"
FT                   /db_xref="GOA:E0TU45"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU45"
FT                   /protein_id="ADM36696.1"
FT                   /translation="MNQSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGA
FT                   IVSYALAGLLVIFIMRMLGEMSAVNPTSGSFSQYAHDAIGPWAGFTIGWLYWFFWVIVI
FT                   AIEAIAGAGIIQYWFHDIPLWLTSLILTIVLTLTNVYSVKSFGEFEYWFSLIKVVTIIA
FT                   FLIVGFAFIFGFAPGSEPVGLSNITGKGGFFPEGISSVLLGIVVVIFSFMGTEIVAIAA
FT                   GETSNPIESVTKATRSVVWRIIVFYVGSIAVVVALLPWNSANILESPFVAVLEHIGVPA
FT                   AAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTF
FT                   FSYIAVVMNYFSPDTVFLFLVNSSGAIALLVYLVIAVSQLRMRKELEKTNPEALKIKMW
FT                   LFPFLTYLTIIAICGILVSMAFIDSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAAK
FT                   PVTQQQPDILP"
FT   gene            655460..656332
FT                   /gene="yeaB"
FT                   /locus_tag="BSUW23_03205"
FT   CDS_pept        655460..656332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaB"
FT                   /locus_tag="BSUW23_03205"
FT                   /product="putative cation efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36697"
FT                   /db_xref="GOA:E0TU46"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU46"
FT                   /protein_id="ADM36697.1"
FT                   /translation="MERYDELKKGETGALVSIAAYLVLSAIKLIIGYLFHSEALTADGL
FT                   NNTTDIIASVAVLIGLRISQKPPDEDHPYGHFRAETIASLIASFIMMVVGLQVLFSAGE
FT                   SIFSAKQETPDMIAAWTAAGGAALMLVVYQYNRRLAKKVKSQALLAAAADNKSDAFVSI
FT                   GTFIGIVAAQFHLAWIDTVTAFVIGLLICKTAWDIFKESSHSLTDGFDVKDMSAYKQTI
FT                   EKISGVSRLKDIKARYLGSTVYVDVVVEVSADLNITESHDIANEIERRMKEEHAIDYSH
FT                   VHMEPLEHK"
FT   gene            656484..657446
FT                   /gene="yeaC"
FT                   /locus_tag="BSUW23_03210"
FT   CDS_pept        656484..657446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaC"
FT                   /locus_tag="BSUW23_03210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36698"
FT                   /db_xref="GOA:E0TU47"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU47"
FT                   /protein_id="ADM36698.1"
FT                   /translation="MAYQEDLHPLLGKAVEHINRVMVGKRDIAILSLAAILAKGHVLLE
FT                   DVPGVGKTMMVRALAKSIGADFKRIQFTPDLLPSDVTGVSIYNAKTMEFEYRPGPIMGN
FT                   IVLADEINRTSPKTQSALLEAMEEGSVTVDGHTMPLAAPFFVMATQNPVEYEGTYPLPE
FT                   AQLDRFLFKLRMGYPSFNEELDVLSLQENSHPIETLEPVITKEDFIRLQREVQNVRADD
FT                   SIKEYIVEIVQKTRQHASVQLGVSPRGSIALMKAAQAYALLHHRDYVIPDDIQYLAPFT
FT                   LPHRMLLQPEAKFEGIEAETIVREIMSAVKVPVQRSSIR"
FT   gene            657446..658642
FT                   /gene="yeaD"
FT                   /locus_tag="BSUW23_03215"
FT   CDS_pept        657446..658642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaD"
FT                   /locus_tag="BSUW23_03215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36699"
FT                   /db_xref="GOA:E0TU48"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU48"
FT                   /protein_id="ADM36699.1"
FT                   /translation="MKKKLQWFVYGWKLIVLMLLTAAVFSYAMFQGGFVSWFLFYTFLP
FT                   FVVYAGLLALYPLRSFQASRQMAKTQLLAGDRLDVSVTLRRKLPFPMMYMVIEDCLPEG
FT                   IESLNRDEAVAKRLVFPWFKRSITMSYELARVPRGEHHFHAVRVRTGDVLGLIEKTAFY
FT                   ELEDTLLVYPSFQRLSYQVNERHQEDGVSGSSPVHQHHSAVAASVRNYQPGDRFAALDW
FT                   KTSARRSQLMTKEFEPSRSKNLFLLMDRSSSEAFEEVVSMTASILHSVLKNGAGAGLAS
FT                   VGKEKTIFPIQEGEHHFNHMLHHLAVAHSDAADPVSRYVREELGKPSVRQADKVIVTGQ
FT                   FTEDLLNIAETRGGRVTVILAKEKDAELSQAENVMIERMMKRQIRVQVMRGGRVSRVV"
FT   gene            658664..660877
FT                   /gene="yebA"
FT                   /locus_tag="BSUW23_03220"
FT   CDS_pept        658664..660877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA"
FT                   /locus_tag="BSUW23_03220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36700"
FT                   /db_xref="GOA:E0TU49"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU49"
FT                   /protein_id="ADM36700.1"
FT                   /translation="MPHDDQNESRLSLLLFYFLAFLLLWEWLRPLDSFTDTKHTGFFSV
FT                   FIGLTFLLTFFRMRWFVTVPFCVLFTLISIHILFYQGSIFDLSWVSSFLQDVYLNIKLI
FT                   QSGQWNDMIPSFRTLLFFVLLWLLVYLLHYWVIYQRRILFFFIMTVAYITILDTFTPYD
FT                   ATFAVIRIVLIGFFMLGLLYLDRIKLMERITLPKTSVLKWFLPLSVLVLAAVGFGLAAP
FT                   KSEPAWPDPVPFLKKITNQDHVPAGESKIGYGNHDESLGGPFQQDDTPVFTWQGKERTY
FT                   FRVETKDTYTGKGWVETDTGMSYQLSGGKVENLWFDHKVATERNTVRVKVDEHYGYNHV
FT                   MYPIGAETIQPKRAVSLEMNGNTEQISPISEQAGEIRNMGNYTVTYHSPVYKLDELRKV
FT                   KVRNNSEEYRFSDRYMQLPDSLPERVRTLAIKLTQDQGNMFDKVKAVEDYLGSNEFTYE
FT                   TENVSIPKNDEDYVDQFLFETKMGYCDNFSSAMVVLLRSAGIPARWIKGYTSGEYKEAG
FT                   NKNGSIYEVTNNNAHSWVEVYFPEQGWVTFEPTKGFTNPAEFASSDTKDSGSESSSSPE
FT                   KTKEEQKEEKKQPENEEKQKEKREPAGSKQPSASHTHAGAGWYLGLAILAVLLLTAVLL
FT                   YVFRSLWIPVFVVRKLKRRSDQYVFFEAYGALLKQLRRRGLPKRDSETLRDYAKRIDGK
FT                   YDSEDMSKLTLCYERALYRNEDSAALWNESRELWENLIKRRWS"
FT   gene            661041..662582
FT                   /gene="guaA"
FT                   /locus_tag="BSUW23_03225"
FT   CDS_pept        661041..662582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BSUW23_03225"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36701"
FT                   /db_xref="GOA:E0TU50"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU50"
FT                   /protein_id="ADM36701.1"
FT                   /translation="MTKLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEI
FT                   KEMNPKGIILSGGPNSVYDENSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEAASQ
FT                   REYGKANIHIEGTPDLFKDLPNEQVVWMSHGDLVVEVPEGFTVDATSHHCPNSAMSKAD
FT                   KKWYGVQFHPEVRHSEYGNDLLKNFVFGVCDCEGKWSMENFIEIEMQKIRETVGDKQVL
FT                   CALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDA
FT                   KDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEADKLKGIDYLAQGTLYTDIIESGTATA
FT                   QTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIR
FT                   VLGEVTEEKLEIVRESDAILREEVANHGLERDIWQYFTVLPDIRSVGVMGDARTYDYTI
FT                   GIRAVTSIDGMTSDWARIPWDVLEVISTRIVNEVKHINRVVYDITSKPPATIEWE"
FT   misc_binding    662726..662828
FT                   /bound_moiety="guanine"
FT                   /note="guanine riboswitch leader; BSUW23_misc_RNA_9"
FT   gene            662963..664285
FT                   /gene="pbuG"
FT                   /locus_tag="BSUW23_03230"
FT                   /note="regulates the expression of pbuG; adopts a a
FT                   transcription terminator structure in the presence of the
FT                   guanine ligand"
FT   CDS_pept        662963..664285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuG"
FT                   /locus_tag="BSUW23_03230"
FT                   /product="hypoxanthine/guanine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36702"
FT                   /db_xref="GOA:E0TU51"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU51"
FT                   /protein_id="ADM36702.1"
FT                   /translation="MKTFFQFDELGTSYRNEIIGGLTTFLSMAYILFVNPITLALESVK
FT                   DFPEALRIDQGAVFTATALASAAGCILMGLIARYPIAIAPGMGLNAFFAFSVVLGMGIS
FT                   WQAALSGVFISGLIFVALSLTGFREKIINAIPPELKLAVGAGIGLFITFVGLQGSGIIA
FT                   ANPSTLVTIGNIHSGPVLLTIFGVIVTVILMVLRVNAGVFIGMLLTAVAGMIFGLVPVP
FT                   SQIVGSVPSLAPTFGQAWIHLPDIFSVQMLIVILTFLFVGFFDTAGTLVAVATQAGLMK
FT                   ENKLPRAGRALLADSSSIVIGAVLGTSTTTSYVESSSGVAAGARSGFAAIVTGILFLLA
FT                   TFFSPLLSVVTSNVTAPALIIVGALMVAPLGKIAWDKFEVAVPAFLTMIMMPLTYSIAT
FT                   GIAIGFIFYPITMVCKGKAKEVHPIMYGLFVVFILYFIFLK"
FT   gene            664496..665299
FT                   /gene="yebC"
FT                   /locus_tag="BSUW23_03235"
FT   CDS_pept        664496..665299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebC"
FT                   /locus_tag="BSUW23_03235"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36703"
FT                   /db_xref="GOA:E0TU52"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU52"
FT                   /protein_id="ADM36703.1"
FT                   /translation="MTEERKETFEEEVNQSERIDADEEPLSRMSRNASRQSKQKQKQKQ
FT                   KPRQERGISTAKDKLASVWAAINRYCGFAFSILKSPAKTVVADGFSHYKYGLISMLIFS
FT                   MIFSIGNWFQLKASWNRPLGFGERHHAFYDGFLVVLVYLLLFFAVMVLAVWAVSRYMMK
FT                   QKVTFREAAAGLGSLLVPVIAVSILWLIFAIVNIPMLTVLFTVLILFSIFFMMALYVQR
FT                   LYQAAQDAPIDYIYCVFAVVAIALLFAVVTWPLISEYLTASLIPL"
FT   gene            665458..665625
FT                   /gene="yebD"
FT                   /locus_tag="BSUW23_03240"
FT   CDS_pept        665458..665625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebD"
FT                   /locus_tag="BSUW23_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36704"
FT                   /db_xref="InterPro:IPR025072"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU53"
FT                   /protein_id="ADM36704.1"
FT                   /translation="MADVLRRAINQKKQFLKTKLLLSEFYQGRGEQLADYTLSELEKEY
FT                   KSLLKMKKEI"
FT   gene            665840..666394
FT                   /gene="yebE"
FT                   /locus_tag="BSUW23_03245"
FT   CDS_pept        665840..666394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebE"
FT                   /locus_tag="BSUW23_03245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36705"
FT                   /db_xref="GOA:E0TU54"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU54"
FT                   /protein_id="ADM36705.1"
FT                   /translation="MMQTILSNGLAMVLIILIINIVYVSFFTIRMILTLKGQRYLAAGI
FT                   STIEILVYVTGLSLVLDNLDQIQNVIAYAIGYGLGVIVGMKIEEKLALGYIMVNVITKE
FT                   LDLDLPRQLREKGYGVTNWVAGGLEGDRTALQILTPRRYELQLYDTIKTLDSKAFIIAY
FT                   EPKTIHGGFWVKAVKKRRIKE"
FT   gene            666394..666591
FT                   /gene="yebG"
FT                   /locus_tag="BSUW23_03250"
FT   CDS_pept        666394..666591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebG"
FT                   /locus_tag="BSUW23_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSUW23_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADM36706"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:E0TU55"
FT                   /protein_id="ADM36706.1"
FT                   /translation="MAKPKKKKFEVTEQQTIDAVLQQMKEEGYLPVRRMEEPIFMEKKE
FT                   NGSIQIVPCGKKIVFEGKLI"
FT   misc_binding    666669..666773
FT                   /bound_moiety="guanine"
FT                   /note="purine riboswitch leader; regulates the expression
FT                   of purE; adopts a transcription terminator structure in the
FT                   presence of the guanine ligand; BSUW23_misc_RNA_10"
FT   gene            666913..667401
FT                   /gene="purE"
FT                   /locus_tag="BSUW23_03255"
FT   CDS_pept        6669